FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37296

FusionGeneSummary for TAX1BP1_RABGEF1

check button Fusion gene summary
Fusion gene informationFusion gene name: TAX1BP1_RABGEF1
Fusion gene ID: 37296
HgeneTgene
Gene symbol

TAX1BP1

RABGEF1

Gene ID

8887

27342

Gene nameTax1 binding protein 1RAB guanine nucleotide exchange factor 1
SynonymsCALCOCO3|T6BP|TXBP151RABEX5|RAP1|rabex-5
Cytomap

7p15.2

7q11.21

Type of geneprotein-codingprotein-coding
Descriptiontax1-binding protein 1TRAF6-binding proteinTax1 (human T-cell leukemia virus type I) binding protein 1rab5 GDP/GTP exchange factorRAB guanine nucleotide exchange factor (GEF) 1rabaptin-5-associated exchange factor for Rab5
Modification date2018052220180522
UniProtAcc

Q86VP1

Q9UJ41

Ensembl transtripts involved in fusion geneENST00000543117, ENST00000265393, 
ENST00000409980, ENST00000433216, 
ENST00000396319, ENST00000494033, 
ENST00000450873, ENST00000284957, 
ENST00000439720, ENST00000437078, 
ENST00000484547, 
Fusion gene scores* DoF score9 X 6 X 7=3784 X 4 X 4=64
# samples 84
** MAII scorelog2(8/378*10)=-2.24031432933371
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TAX1BP1 [Title/Abstract] AND RABGEF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDMESOTCGA-TS-A8AY-01ATAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000543117ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000543117ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000543117ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000543117ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
5CDS-3UTRENST00000543117ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000265393ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000265393ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000265393ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000265393ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
5CDS-3UTRENST00000265393ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000409980ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000409980ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000409980ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000409980ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
5CDS-3UTRENST00000409980ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000433216ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000433216ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000433216ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000433216ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
5CDS-3UTRENST00000433216ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000396319ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000396319ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000396319ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
In-frameENST00000396319ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
5CDS-3UTRENST00000396319ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
3UTR-3CDSENST00000494033ENST00000450873TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
3UTR-3CDSENST00000494033ENST00000284957TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
3UTR-3CDSENST00000494033ENST00000439720TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
3UTR-3CDSENST00000494033ENST00000437078TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+
3UTR-3UTRENST00000494033ENST00000484547TAX1BP1chr7

27809453

+RABGEF1chr7

66260498

+

Top

FusionProtFeatures for TAX1BP1_RABGEF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAX1BP1

Q86VP1

RABGEF1

Q9UJ41

Rab effector protein acting as linker between gamma-adaptin, RAB4A or RAB5A. Involved in endocytic membrane fusion andmembrane trafficking of recycling endosomes. Stimulates nucleotideexchange on RAB5A. Can act as a ubiquitin ligase (By similarity).{ECO:0000250, ECO:0000269|PubMed:11452015,ECO:0000269|PubMed:15339665, ECO:0000269|PubMed:9323142}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000284957+39624_665171492Coiled coilOntology_term=ECO:0000255
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000450873+410624_665171492Coiled coilOntology_term=ECO:0000255
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000284957+39449_592171492DomainVPS9
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000450873+410449_592171492DomainVPS9

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000265393+517144_599204748Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000396319+517144_599204790Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000433216+416144_59947591Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000543117+517144_599204748Coiled coilOntology_term=ECO:0000255
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000265393+517320_420204748RegionNote=Oligomerization
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000396319+517320_420204790RegionNote=Oligomerization
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000433216+416320_42047591RegionNote=Oligomerization
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000543117+517320_420204748RegionNote=Oligomerization
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000265393+517725_754204748Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000265393+517755_789204748Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000396319+517725_754204790Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000396319+517755_789204790Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000433216+416725_75447591Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000433216+416755_78947591Zinc fingerNote=UBZ-type 2
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000543117+517725_754204748Zinc fingerNote=UBZ-type 1
HgeneTAX1BP1chr7:27809453chr7:66260498ENST00000543117+517755_789204748Zinc fingerNote=UBZ-type 2
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000284957+39151_185171492Zinc fingerA20-type
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000450873+410151_185171492Zinc fingerA20-type


Top

FusionGeneSequence for TAX1BP1_RABGEF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_368aa
MKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKY
IMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKI
TKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQ
EAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPL

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_368aa
MKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKY
IMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKI
TKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQ
EAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPL

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_368aa
MKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKY
IMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKI
TKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQ
EAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPL

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_368aa
MKEKEELLKLIAVLEKETAQLREQVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKY
IMTRLYKYVFCPETTDDEKKDLAIQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKI
TKNEPASADDFLPTLIYIVLKGNPPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQ
EAESWSPDACLGVKQMYKNLDLLSQLNERQERIMNEAKKLEKDLIDWTDGIAREVQDIVEKYPLEIKPPNQPLAAIDSENVENDKLPPPL

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_525aa
MTSFQEVPLQTSNFAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGY
YLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASSPVEELLTMEDEGNSDMLVVTTKAGLLELKIEKTMKEKEELLKLIAVLEKETAQLRE
QVGRMERELNHEKERCDQLQAEQKDLSIEEQSECAQDFYHNVAERMQTRGKVPPERVEKIMDQIEKYIMTRLYKYVFCPETTDDEKKDLA
IQKRIRALRWVTPQMLCVPVNEDIPEVSDMVVKAITDIIEMDSKRVPRDKLACITKCSKHIFNAIKITKNEPASADDFLPTLIYIVLKGN
PPRLQSNIQYITRFCNPSRLMTGEDGYYFTNLCCAVAFIEKLDAQSLNLSQEDFDRYMSGQTSPRKQEAESWSPDACLGVKQMYKNLDLL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_1104nt
ATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGA
GAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGAT
TTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTAC
ATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCC
CTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGAT
ATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATC
ACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAAT
ATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCT
TTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAA
GAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAA
GAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAG
AAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTG

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_1104nt
ATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGA
GAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGAT
TTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTAC
ATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCC
CTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGAT
ATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATC
ACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAAT
ATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCT
TTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAA
GAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAA
GAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAG
AAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTG

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_1104nt
ATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGA
GAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGAT
TTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTAC
ATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCC
CTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGAT
ATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATC
ACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAAT
ATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCT
TTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAA
GAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAA
GAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAG
AAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTG

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1104nt
ATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGA
GAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGAT
TTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTAC
ATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCC
CTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGAT
ATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATC
ACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAAT
ATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCT
TTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAA
GAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAA
GAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAG
AAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTG

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1575nt
ATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCA
CACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCT
CGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATAT
TACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTT
CGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTT
GAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAA
CAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAA
CAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATA
ATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCC
ATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATG
GTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCAC
ATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAAC
CCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACC
AATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGC
CAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTG
TCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGA
GAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_2293nt
ACGGCAACAGAAGACTATGATGAATTCGAATGGGACACATTTGCTTCTGTGGAGTTACGATTCAAACTGAATGTCCAATATAGGAAGGCA
ACATATACAACAAGCAAAAGTGATTTTAGAAATAACAGAACGCGGGAGAAAATTCACACACGGAAAATGATACGGATAACAAAAGCAGAT
TCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTA
ATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTA
CTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAG
GATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCC
AGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCC
TTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTC
GAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTG
AAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGA
AGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATC
TTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTG
ATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCA
AGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGG
GCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATT
TCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGT
CTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATC
TCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTG
CAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTG
AAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGT
AGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATG
GGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTT
GTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCC
TTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATA
ATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTT

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_3940nt
ACGGCAACAGAAGACTATGATGAATTCGAATGGGACACATTTGCTTCTGTGGAGTTACGATTCAAACTGAATGTCCAATATAGGAAGGCA
ACATATACAACAAGCAAAAGTGATTTTAGAAATAACAGAACGCGGGAGAAAATTCACACACGGAAAATGATACGGATAACAAAAGCAGAT
TCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTA
ATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTA
CTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAG
GATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCC
AGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCC
TTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTC
GAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTG
AAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGA
AGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATC
TTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTG
ATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCA
AGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGG
GCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATT
TCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGT
CTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATC
TCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTG
CAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTG
AAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGT
AGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATG
GGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTT
GTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCC
TTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATA
ATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTT
ATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAG
AAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTA
TGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCT
TATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAA
TGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGC
AAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGG
GCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAA
TTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCT
CCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTG
ACAGCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTATAACCTAAATATACCATTGATGATTCTTCTTCCATTCAGTG
ACATCCACAGATTATGCAGCTATACTTGTGAAATCGTGCATGAGGCCCCAGGGCACCGTTCTAGAACAACGTCACTTCACACAGGCAGCT
GAGAAAGGTTCTCTTGCTTTTCCAGTATCTTCCTAAGGATGGAGCCCAAAATTGCAGAGCAGTAACTTTGGAATAAAACCAGGGTGGGTA
TAAAACTTCTTATTCTTAAATTTACATATAAGATCTATTAAGCTTGACACATCTGTGTCATCACGCACTGAAGACAGGAAGCAGTTCACT
GAGTCAGCTGGTTCCCAAGCTCGCACAGAAGGTGATAAGTTACTATCAAATGCCAGTGAGAATCTTCTTATAGAATAACCTGGGCCCAAG
TGATTTTAGTACAAAACTTGCCCTTCTTTGGTTTAATTTTCTATGTGCTTTTAGGTGTGAATCCAGATATGCGGTCTTAATTCCTTTGGA
AATACACAGTTCGTTTAGTTACTGTACACTCTGTTTGTTCAATAAACTGCATATCAACTTCCCACAAAAGCTGACTTTTTTGGGTCTCTT
ACATATAAAGTAGGTTATTGAGTTGATTTTTTTGGAGGTATCTCATATTGGTCGAATTCTTCTGGTATGGACTCTTGCCTTATATAGAGG
CTTCTATTTCTCTTAAGTCAGCATCAATACAACGGCCGGAGTTTCTGTTTTTGCAATAAGAAGATGTTGGTATTTTATGTAGGGTAAATG

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_3143nt
ACGGCAACAGAAGACTATGATGAATTCGAATGGGACACATTTGCTTCTGTGGAGTTACGATTCAAACTGAATGTCCAATATAGGAAGGCA
ACATATACAACAAGCAAAAGTGATTTTAGAAATAACAGAACGCGGGAGAAAATTCACACACGGAAAATGATACGGATAACAAAAGCAGAT
TCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTA
ATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTA
CTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAG
GATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCC
AGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCC
TTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTC
GAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTG
AAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGA
AGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATC
TTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTG
ATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCA
AGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGG
GCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATT
TCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGT
CTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATC
TCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTG
CAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTG
AAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGT
AGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATG
GGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTT
GTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCC
TTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATA
ATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTT
ATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAG
AAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTA
TGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCT
TATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAA
TGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGC
AAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGG
GCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAA
TTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCT
CCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTG

>In-frame_TAX1BP1_ENST00000543117_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_2052nt
ACGGCAACAGAAGACTATGATGAATTCGAATGGGACACATTTGCTTCTGTGGAGTTACGATTCAAACTGAATGTCCAATATAGGAAGGCA
ACATATACAACAAGCAAAAGTGATTTTAGAAATAACAGAACGCGGGAGAAAATTCACACACGGAAAATGATACGGATAACAAAAGCAGAT
TCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTA
ATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTA
CTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAG
GATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCC
AGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCC
TTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTC
GAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTG
AAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGA
AGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATC
TTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTG
ATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCA
AGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGG
GCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATT
TCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGT
CTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATC
TCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTG
CAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTG
AAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGT
AGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATG
GGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTT

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_2290nt
GGAAGAGACCGCCCCGTGGGCGGAAGTGACGCAAGGCCTACTGTCGGCTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGT
GGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCA
CAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATG
CACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTG
CTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGAT
ATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGT
TTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTC
TTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAG
AACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAG
AACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGA
TAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTG
CCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATA
TGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGC
ACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCA
ACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCA
CCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTG
GCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCT
TGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAA
GAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAA
ATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGG
TAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGG
ATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTG
TGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTT
TAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATT
GTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATA

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_3937nt
GGAAGAGACCGCCCCGTGGGCGGAAGTGACGCAAGGCCTACTGTCGGCTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGT
GGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCA
CAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATG
CACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTG
CTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGAT
ATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGT
TTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTC
TTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAG
AACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAG
AACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGA
TAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTG
CCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATA
TGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGC
ACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCA
ACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCA
CCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTG
GCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCT
TGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAA
GAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAA
ATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGG
TAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGG
ATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTG
TGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTT
TAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATT
GTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATA
TGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAG
TGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGA
CACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTAT
TTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGG
GCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAA
CGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCC
ACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTC
TCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCT
GGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACA
GCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTATAACCTAAATATACCATTGATGATTCTTCTTCCATTCAGTGACA
TCCACAGATTATGCAGCTATACTTGTGAAATCGTGCATGAGGCCCCAGGGCACCGTTCTAGAACAACGTCACTTCACACAGGCAGCTGAG
AAAGGTTCTCTTGCTTTTCCAGTATCTTCCTAAGGATGGAGCCCAAAATTGCAGAGCAGTAACTTTGGAATAAAACCAGGGTGGGTATAA
AACTTCTTATTCTTAAATTTACATATAAGATCTATTAAGCTTGACACATCTGTGTCATCACGCACTGAAGACAGGAAGCAGTTCACTGAG
TCAGCTGGTTCCCAAGCTCGCACAGAAGGTGATAAGTTACTATCAAATGCCAGTGAGAATCTTCTTATAGAATAACCTGGGCCCAAGTGA
TTTTAGTACAAAACTTGCCCTTCTTTGGTTTAATTTTCTATGTGCTTTTAGGTGTGAATCCAGATATGCGGTCTTAATTCCTTTGGAAAT
ACACAGTTCGTTTAGTTACTGTACACTCTGTTTGTTCAATAAACTGCATATCAACTTCCCACAAAAGCTGACTTTTTTGGGTCTCTTACA
TATAAAGTAGGTTATTGAGTTGATTTTTTTGGAGGTATCTCATATTGGTCGAATTCTTCTGGTATGGACTCTTGCCTTATATAGAGGCTT
CTATTTCTCTTAAGTCAGCATCAATACAACGGCCGGAGTTTCTGTTTTTGCAATAAGAAGATGTTGGTATTTTATGTAGGGTAAATGTGA

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_3140nt
GGAAGAGACCGCCCCGTGGGCGGAAGTGACGCAAGGCCTACTGTCGGCTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGT
GGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCA
CAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATG
CACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTG
CTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGAT
ATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGT
TTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTC
TTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAG
AACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAG
AACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGA
TAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTG
CCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATA
TGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGC
ACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCA
ACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCA
CCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTG
GCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCT
TGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAA
GAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAA
ATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGG
TAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGG
ATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTG
TGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTT
TAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATT
GTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATA
TGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAG
TGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGA
CACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTAT
TTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGG
GCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAA
CGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCC
ACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTC
TCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCT
GGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACA

>In-frame_TAX1BP1_ENST00000265393_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_2049nt
GGAAGAGACCGCCCCGTGGGCGGAAGTGACGCAAGGCCTACTGTCGGCTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGT
GGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCA
CAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATG
CACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTG
CTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGAT
ATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGT
TTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTC
TTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAG
AACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAG
AACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGA
TAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTG
CCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATA
TGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGC
ACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCA
ACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCA
CCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTG
GCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCT
TGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAA
GAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAA
ATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGG
TAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGG
ATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTG

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_2243nt
CTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTG
CGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCC
CATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACAT
CCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTAT
GTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTT
ACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAA
GGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTA
AAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGA
TGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGG
ATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATAT
GTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATG
CTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGT
GTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCG
GATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGC
AATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAG
TCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGAT
GCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAG
AAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCT
CCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGA
TCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAAT
TGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATA
CTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTG
CTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAAT
TAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_3890nt
CTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTG
CGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCC
CATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACAT
CCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTAT
GTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTT
ACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAA
GGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTA
AAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGA
TGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGG
ATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATAT
GTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATG
CTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGT
GTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCG
GATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGC
AATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAG
TCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGAT
GCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAG
AAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCT
CCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGA
TCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAAT
TGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATA
CTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTG
CTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAAT
TAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAAT
ATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTA
GCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACG
TGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTT
TAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGA
AGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAA
GGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGG
GACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATC
CATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGT
TAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGT
GTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACAGCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTAT
AACCTAAATATACCATTGATGATTCTTCTTCCATTCAGTGACATCCACAGATTATGCAGCTATACTTGTGAAATCGTGCATGAGGCCCCA
GGGCACCGTTCTAGAACAACGTCACTTCACACAGGCAGCTGAGAAAGGTTCTCTTGCTTTTCCAGTATCTTCCTAAGGATGGAGCCCAAA
ATTGCAGAGCAGTAACTTTGGAATAAAACCAGGGTGGGTATAAAACTTCTTATTCTTAAATTTACATATAAGATCTATTAAGCTTGACAC
ATCTGTGTCATCACGCACTGAAGACAGGAAGCAGTTCACTGAGTCAGCTGGTTCCCAAGCTCGCACAGAAGGTGATAAGTTACTATCAAA
TGCCAGTGAGAATCTTCTTATAGAATAACCTGGGCCCAAGTGATTTTAGTACAAAACTTGCCCTTCTTTGGTTTAATTTTCTATGTGCTT
TTAGGTGTGAATCCAGATATGCGGTCTTAATTCCTTTGGAAATACACAGTTCGTTTAGTTACTGTACACTCTGTTTGTTCAATAAACTGC
ATATCAACTTCCCACAAAAGCTGACTTTTTTGGGTCTCTTACATATAAAGTAGGTTATTGAGTTGATTTTTTTGGAGGTATCTCATATTG
GTCGAATTCTTCTGGTATGGACTCTTGCCTTATATAGAGGCTTCTATTTCTCTTAAGTCAGCATCAATACAACGGCCGGAGTTTCTGTTT
TTGCAATAAGAAGATGTTGGTATTTTATGTAGGGTAAATGTGACTGGAATACACCTTTGGAACGGAATTCTTTATCAATAAAGTTTCACA

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_3093nt
CTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTG
CGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCC
CATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACAT
CCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTAT
GTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTT
ACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAA
GGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTA
AAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGA
TGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGG
ATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATAT
GTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATG
CTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGT
GTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCG
GATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGC
AATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAG
TCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGAT
GCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAG
AAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCT
CCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGA
TCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAAT
TGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATA
CTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTG
CTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAAT
TAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAAT
ATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTA
GCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACG
TGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTT
TAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGA
AGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAA
GGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGG
GACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATC
CATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGT
TAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGT
GTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACAGCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTAT

>In-frame_TAX1BP1_ENST00000409980_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_2002nt
CTGGGAGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTG
CGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCC
CATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACAT
CCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTAT
GTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTACCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTT
ACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCGAGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAA
GGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTA
AAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGA
TGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGG
ATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATAT
GTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATG
CTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGT
GTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCG
GATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGC
AATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAG
TCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGAT
GCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAG
AAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCT
CCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGA
TCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAAT
TGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATA
CTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTG

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_2050nt
AGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAA
CTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGT
CATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAA
AGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGA
AGGATCAACAGTCAATTGTGTACTAGCATTCCAAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCG
TTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGC
AAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTG
GGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAG
AAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTG
TTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACA
AGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCC
CCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGAC
TGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAA
GTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCG
TCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAG
ACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGT
TAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTG
GAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGT
CAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAG
TTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCAT
TCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCAC
TCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAG

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_3697nt
AGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAA
CTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGT
CATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAA
AGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGA
AGGATCAACAGTCAATTGTGTACTAGCATTCCAAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCG
TTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGC
AAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTG
GGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAG
AAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTG
TTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACA
AGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCC
CCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGAC
TGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAA
GTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCG
TCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAG
ACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGT
TAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTG
GAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGT
CAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAG
TTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCAT
TCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCAC
TCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAG
AATGGTGTCTGCTGTGCATGGCATTTTATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATT
TGGTTTGTCCCACTAAAATGACTCGAGAAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAAC
TTTGAGGTTCTATATAGTCAGAGACTATGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGAT
GGAAGACTTTAAACTATGCTTCTAGCTTATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACT
GGGCCTGGAATGGAAGGCGGGAATGAATGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCA
GCCTCCATAATATACATTTGACTTTGCAAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATT
AGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAG
TAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGA
TGTCTTTTACAAACCAGGAGTTATCCTCCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTA
AAACGAGTTAAATATTTAGGAGGCTTGACAGCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTATAACCTAAATATAC
CATTGATGATTCTTCTTCCATTCAGTGACATCCACAGATTATGCAGCTATACTTGTGAAATCGTGCATGAGGCCCCAGGGCACCGTTCTA
GAACAACGTCACTTCACACAGGCAGCTGAGAAAGGTTCTCTTGCTTTTCCAGTATCTTCCTAAGGATGGAGCCCAAAATTGCAGAGCAGT
AACTTTGGAATAAAACCAGGGTGGGTATAAAACTTCTTATTCTTAAATTTACATATAAGATCTATTAAGCTTGACACATCTGTGTCATCA
CGCACTGAAGACAGGAAGCAGTTCACTGAGTCAGCTGGTTCCCAAGCTCGCACAGAAGGTGATAAGTTACTATCAAATGCCAGTGAGAAT
CTTCTTATAGAATAACCTGGGCCCAAGTGATTTTAGTACAAAACTTGCCCTTCTTTGGTTTAATTTTCTATGTGCTTTTAGGTGTGAATC
CAGATATGCGGTCTTAATTCCTTTGGAAATACACAGTTCGTTTAGTTACTGTACACTCTGTTTGTTCAATAAACTGCATATCAACTTCCC
ACAAAAGCTGACTTTTTTGGGTCTCTTACATATAAAGTAGGTTATTGAGTTGATTTTTTTGGAGGTATCTCATATTGGTCGAATTCTTCT
GGTATGGACTCTTGCCTTATATAGAGGCTTCTATTTCTCTTAAGTCAGCATCAATACAACGGCCGGAGTTTCTGTTTTTGCAATAAGAAG
ATGTTGGTATTTTATGTAGGGTAAATGTGACTGGAATACACCTTTGGAACGGAATTCTTTATCAATAAAGTTTCACAATCCGTCCCTCTT

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_2900nt
AGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAA
CTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGT
CATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAA
AGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGA
AGGATCAACAGTCAATTGTGTACTAGCATTCCAAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCG
TTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGC
AAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTG
GGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAG
AAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTG
TTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACA
AGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCC
CCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGAC
TGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAA
GTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCG
TCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAG
ACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGT
TAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTG
GAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGT
CAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAG
TTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCAT
TCACTGTGGTTTTGGTAAATAATTGCCTTTTAAAGGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCAC
TCTTCCACAGTTTGGAATAATTTTATAATTGTAAAGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAG
AATGGTGTCTGCTGTGCATGGCATTTTATATGTTAATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATT
TGGTTTGTCCCACTAAAATGACTCGAGAAGTGTTTAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAAC
TTTGAGGTTCTATATAGTCAGAGACTATGACACCACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGAT
GGAAGACTTTAAACTATGCTTCTAGCTTATTTTTCCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACT
GGGCCTGGAATGGAAGGCGGGAATGAATGGGCCTCTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCA
GCCTCCATAATATACATTTGACTTTGCAAACGTCTAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATT
AGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCCTGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAG
TAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTCCAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGA
TGTCTTTTACAAACCAGGAGTTATCCTCCTGGTGGTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTA
AAACGAGTTAAATATTTAGGAGGCTTGACAGCTACCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTATAACCTAAATATAC

>In-frame_TAX1BP1_ENST00000433216_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1809nt
AGGGGAGGTGTAGCCGGTCTTTGGGGGTAGGCGGTAGTGGCGGAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAA
CTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAATGACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGT
CATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACACCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAA
AGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCGTGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGA
AGGATCAACAGTCAATTGTGTACTAGCATTCCAAGTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCG
TTCTGGAAAAAGAAACAGCACAACTTCGAGAACAAGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGC
AAGCAGAACAAAAGGATCTAAGCATTGAAGAACAGTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTG
GGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAATGGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAG
AAACTACTGATGATGAGAAGAAAGATCTTGCCATTCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTG
TTAATGAAGACATCCCAGAAGTGTCTGATATGGTGGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACA
AGCTGGCCTGCATCACCAAGTGCAGCAAGCACATCTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCC
CCACCCTCATCTACATTGTTTTGAAGGGCAACCCCCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGAC
TGATGACTGGAGAGGATGGCTACTATTTCACCAATCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAA
GTCAGGAGGATTTTGATCGCTACATGTCTGGCCAGACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCG
TCAAGCAAATGTATAAGAACTTGGATCTCTTGTCTCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAG
ACCTCATAGATTGGACAGATGGAATTGCAAGAGAAGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGT
TAGCAGCTATTGACTCTGAAAACGTTGAAAATGATAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTG
GAGAGTATTTATTTGAGCCTAAATTGTAGGTAGCCCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGT
CAGCATTTTTTAAAGGTACAGTATATGGGGATTGTTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAG
TTACTGATACAGATTCATTTAAGGCTTGTGTGCAAATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCAT

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000450873_chr7_66260498_+_2196nt
GAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAAT
GACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACA
CCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCG
TGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTA
CCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCG
AGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGA
GTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACA
AGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACA
GTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAAT
GGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCAT
TCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGT
GGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACAT
CTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCC
CCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAA
TCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCA
GACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTC
TCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGA
AGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGA
TAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGC
CCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTG
TTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCA
AATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAA
GGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAA
AGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATATGTT

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000284957_chr7_66260498_+_3843nt
GAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAAT
GACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACA
CCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCG
TGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTA
CCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCG
AGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGA
GTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACA
AGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACA
GTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAAT
GGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCAT
TCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGT
GGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACAT
CTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCC
CCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAA
TCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCA
GACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTC
TCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGA
AGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGA
TAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGC
CCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTG
TTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCA
AATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAA
GGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAA
AGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATATGTT
AATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAGTGTT
TAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGACACC
ACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTATTTTT
CCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGGGCCT
CTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAACGTC
TAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCC
TGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTC
CAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCTGGTG
GTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACAGCTA
CCTGCATTGTAGAACCTTTTCTTATCTCAGTGGAACCTTCTATAACCTAAATATACCATTGATGATTCTTCTTCCATTCAGTGACATCCA
CAGATTATGCAGCTATACTTGTGAAATCGTGCATGAGGCCCCAGGGCACCGTTCTAGAACAACGTCACTTCACACAGGCAGCTGAGAAAG
GTTCTCTTGCTTTTCCAGTATCTTCCTAAGGATGGAGCCCAAAATTGCAGAGCAGTAACTTTGGAATAAAACCAGGGTGGGTATAAAACT
TCTTATTCTTAAATTTACATATAAGATCTATTAAGCTTGACACATCTGTGTCATCACGCACTGAAGACAGGAAGCAGTTCACTGAGTCAG
CTGGTTCCCAAGCTCGCACAGAAGGTGATAAGTTACTATCAAATGCCAGTGAGAATCTTCTTATAGAATAACCTGGGCCCAAGTGATTTT
AGTACAAAACTTGCCCTTCTTTGGTTTAATTTTCTATGTGCTTTTAGGTGTGAATCCAGATATGCGGTCTTAATTCCTTTGGAAATACAC
AGTTCGTTTAGTTACTGTACACTCTGTTTGTTCAATAAACTGCATATCAACTTCCCACAAAAGCTGACTTTTTTGGGTCTCTTACATATA
AAGTAGGTTATTGAGTTGATTTTTTTGGAGGTATCTCATATTGGTCGAATTCTTCTGGTATGGACTCTTGCCTTATATAGAGGCTTCTAT
TTCTCTTAAGTCAGCATCAATACAACGGCCGGAGTTTCTGTTTTTGCAATAAGAAGATGTTGGTATTTTATGTAGGGTAAATGTGACTGG

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000439720_chr7_66260498_+_3046nt
GAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAAT
GACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACA
CCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCG
TGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTA
CCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCG
AGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGA
GTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACA
AGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACA
GTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAAT
GGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCAT
TCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGT
GGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACAT
CTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCC
CCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAA
TCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCA
GACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTC
TCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGA
AGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGA
TAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGC
CCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTG
TTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCA
AATTTTGTCTCAATCTTTTTTCCCTCCATGATTTTCCTATGTGCTTCCTCTGGCATTCACTGTGGTTTTGGTAAATAATTGCCTTTTAAA
GGATTAAACAAATGAATGCTACAAAGTGTATGTTCAAGAAAATTAAATGGTACCACTCTTCCACAGTTTGGAATAATTTTATAATTGTAA
AGATAGAAATTATATTGATAAGTAAATATGTAAAATTGTAAATATGTAAAAAAAAGAATGGTGTCTGCTGTGCATGGCATTTTATATGTT
AATTTTTTAGTTTAAAATGAAGTATATTGAATGTTTGCCTTTAGCACCATTTTATTTGGTTTGTCCCACTAAAATGACTCGAGAAGTGTT
TAGACAAACTCCCCTTAAGATGTGCACTCCATCTTTAAGAACGTGTTAGCCTTAACTTTGAGGTTCTATATAGTCAGAGACTATGACACC
ACTAAGGTTCAGAATAAAGTTTAGGCCACATAAAATTGCTGTTTAATGTAGTCGATGGAAGACTTTAAACTATGCTTCTAGCTTATTTTT
CCCTCATTCATTCAGCAAATCTCTATTGAGTTCTTCAGTGAGAAGGAGCAGGCACTGGGCCTGGAATGGAAGGCGGGAATGAATGGGCCT
CTGATGGTGAGAGGTGACGGGGTCCCTCAGCTGTGAGATGCAAGGGGCGCCTTGCAGCCTCCATAATATACATTTGACTTTGCAAACGTC
TAGACATGTTTTCTGAACCTTTTTCAGGACATTTCAACCTCGGGACTATTCATATTAGTGGCCTGAGAGGTGTTTGTTGTGGGGCCACCC
TGTGCATGGTAGAATGTTCAGCAGCATTCCTGCCATCCATATCCATTAGGTGCCAGTAGCACCCCCGCTAGAGCTGTGAAAAATTCTCTC
CAGACATAGTCAGATGTCTCCTGGGGCCATATCACCCCTCCGTTAAGAACCACTGATGTCTTTTACAAACCAGGAGTTATCCTCCTGGTG
GTTAATATGGTGTAACCAAAGAATCTTGCACTCAATGCACAGTGTGATGTTAACTAAAACGAGTTAAATATTTAGGAGGCTTGACAGCTA

>In-frame_TAX1BP1_ENST00000396319_chr7_27809453_+_RABGEF1_ENST00000437078_chr7_66260498_+_1955nt
GAAGAGGTTCGGCGGCTGATGGCGGATCAGGATCGGAAGCCTGCGTAACTTTCTCCCTTGATCCGGGAGTCTTTCCACTGGATTCACAAT
GACATCCTTTCAAGAAGTCCCATTGCAGACTTCCAACTTTGCCCATGTCATCTTTCAAAATGTGGCCAAGAGTTACCTTCCTAATGCACA
CCTGGAATGTCATTACACCTTAACTCCATATATTCATCCACATCCAAAAGATTGGGTTGGTATATTCAAGGTTGGATGGAGTACTGCTCG
TGATTATTACACGTTTTTATGGTCCCCTATGCCTGAACATTATGTGGAAGGATCAACAGTCAATTGTGTACTAGCATTCCAAGGATATTA
CCTTCCAAATGATGATGGAGAATTTTATCAGTTCTGTTACGTTACCCATAAGGGTGAAATTCGTGGAGCAAGTACACCTTTCCAGTTTCG
AGCTTCTTCTCCAGTTGAAGAGCTGCTTACTATGGAAGATGAAGGAAATTCTGACATGTTAGTGGTGACCACAAAAGCAGGCCTTCTTGA
GTTGAAAATTGAGAAAACCATGAAAGAAAAAGAAGAACTGTTAAAGTTAATTGCCGTTCTGGAAAAAGAAACAGCACAACTTCGAGAACA
AGTTGGGAGAATGGAAAGAGAACTTAACCATGAGAAAGAAAGATGTGACCAACTGCAAGCAGAACAAAAGGATCTAAGCATTGAAGAACA
GTCAGAGTGTGCTCAGGATTTCTACCACAATGTGGCCGAAAGGATGCAAACTCGTGGGAAAGTGCCTCCAGAAAGAGTCGAGAAGATAAT
GGATCAGATTGAAAAGTACATCATGACTCGTCTCTATAAATATGTATTCTGTCCAGAAACTACTGATGATGAGAAGAAAGATCTTGCCAT
TCAAAAGAGAATCAGAGCCCTGCGCTGGGTTACGCCTCAGATGCTGTGTGTCCCTGTTAATGAAGACATCCCAGAAGTGTCTGATATGGT
GGTGAAGGCGATCACAGATATCATTGAAATGGATTCCAAGCGTGTGCCTCGAGACAAGCTGGCCTGCATCACCAAGTGCAGCAAGCACAT
CTTCAATGCCATCAAGATCACCAAGAATGAGCCGGCGTCAGCGGATGACTTCCTCCCCACCCTCATCTACATTGTTTTGAAGGGCAACCC
CCCACGCCTTCAGTCTAATATCCAGTATATCACGCGCTTCTGCAATCCAAGCCGACTGATGACTGGAGAGGATGGCTACTATTTCACCAA
TCTGTGCTGTGCTGTGGCTTTCATTGAGAAGCTAGACGCCCAGTCTTTGAATCTAAGTCAGGAGGATTTTGATCGCTACATGTCTGGCCA
GACCTCTCCCAGGAAGCAAGAAGCTGAGAGTTGGTCTCCTGATGCTTGCTTAGGCGTCAAGCAAATGTATAAGAACTTGGATCTCTTGTC
TCAGTTGAATGAACGACAAGAAAGGATCATGAATGAAGCCAAGAAACTGGAAAAAGACCTCATAGATTGGACAGATGGAATTGCAAGAGA
AGTTCAAGACATCGTTGAGAAATACCCACTGGAAATTAAGCCTCCGAATCAACCGTTAGCAGCTATTGACTCTGAAAACGTTGAAAATGA
TAAACTTCCTCCACCACTGCAACCTCAAGTTTATGCAGGATGATCACAATTTAGTGGAGAGTATTTATTTGAGCCTAAATTGTAGGTAGC
CCTTACTACACTCAACTGATTGGGATCTAGAATGTAACTAAATTGCTTATAAATGTCAGCATTTTTTAAAGGTACAGTATATGGGGATTG
TTTCGTTTTTCCTAGCAGGGGAACCTTAGTTAATAATAAAATACTACTTATTTGAGTTACTGATACAGATTCATTTAAGGCTTGTGTGCA


Top

FusionGenePPI for TAX1BP1_RABGEF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAX1BP1TNFAIP3, STARD13, TBC1D17, TRAF6, RNF11, RIPK1, OPTN, TNIP1, IKBKE, TBK1, TRAF3, GABRR1, ITCH, MYO6, CALCOCO2, UBC, VCP, PARK2, ORC5, IKBKG, MAP1LC3B, MAP1LC3C, GABARAP, FOXC2, KIF5B, LGALS8, SSX2, TCEA2, TSG101, FAM189A2, DAZAP2, DSTN, EMILIN1, RAB18, FAM168A, CXXC1, NMRK1, LMO3, RAD18, TSHZ3, MRPL11, TNIP3, PLEKHN1, COG7, MRPL53, CWF19L2, REEP4, FHL5, RNF126, HSD17B3, FAM58A, LDLRAD4, NTRK1, MED4, RAD54L2, HNRNPD, UBE2A, AGO1, GABARAPL1, GABARAPL2, RFWD2, RABGEF1, SLC22A23, KDELR1, RNF115, DNAJC11, SLC5A12, RNF26, DLSTRABGEF1KXD1, YWHAG, YWHAB, GGA1, UBC, HRAS, MAPK1, RAB22A, RAB5A, ESR1, RABGEF1, RABEP1, EEA1, EGFR, L1CAM, RAB21, UBE2D3, UBE2D1, MON1A, MON1B, RNF11, SLMAP, ROCK2, TNKS1BP1, DGCR6, TEAD4, DAZAP2, THOC1, TXN2, BLOC1S6, TRIM54, ZC2HC1C, CIPC, TRIM15, CCDC183, NTRK1, CRBN, RABEP2, CPNE2, CPNE5, RBCK1, OTUD5, SHARPIN, EXOC1, TNFRSF1A, RNF31, BIRC2, GAK, TAX1BP1, HGFAC, CYHR1, VTI1B, FAM189B, TRAF2, UBR1, CLINT1, KCTD10, HERC1, PKN3, NCKAP5L, TFPT, CCHCR1, YEATS4, TUFT1, RABGAP1L, GOLGA5, CLOCK, PSMD9, VPS53, DZIP3, GRIPAP1, RCOR1, HMG20A, CCDC132, GIT2, CCDC93, OIP5, PHF21A, PTRF, PHLDB3, HAUS6, RPRD1A, ARNTL, MAX, NUF2, THAP11, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000284957+39139_252171492ubiquitinated proteins
TgeneRABGEF1chr7:27809453chr7:66260498ENST00000450873+410139_252171492ubiquitinated proteins


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAX1BP1_RABGEF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAX1BP1_RABGEF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource