FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 37080

FusionGeneSummary for TAF15_PTRH2

check button Fusion gene summary
Fusion gene informationFusion gene name: TAF15_PTRH2
Fusion gene ID: 37080
HgeneTgene
Gene symbol

TAF15

PTRH2

Gene ID

8148

51651

Gene nameTATA-box binding protein associated factor 15peptidyl-tRNA hydrolase 2
SynonymsNpl3|RBP56|TAF2N|TAFII68BIT1|CFAP37|CGI-147|IMNEPD|PTH|PTH 2|PTH2
Cytomap

17q12

17q23.1

Type of geneprotein-codingprotein-coding
DescriptionTATA-binding protein-associated factor 2NRBP56/CSMF fusionTAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 68kDaTATA box binding protein (TBP)-associated factor, RNA polymerase II, N, 68kD (RNA-binding protein 56)TATA box-binpeptidyl-tRNA hydrolase 2, mitochondrialbcl-2 inhibitor of transcription 1cilia and flagella associated protein 37
Modification date2018052320180523
UniProtAcc

Q92804

Q9Y3E5

Ensembl transtripts involved in fusion geneENST00000588240, ENST00000592237, 
ENST00000311979, 
ENST00000393038, 
ENST00000537860, ENST00000409433, 
ENST00000470557, ENST00000579915, 
Fusion gene scores* DoF score9 X 7 X 4=2526 X 4 X 5=120
# samples 157
** MAII scorelog2(15/252*10)=-0.748461233004036
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: TAF15 [Title/Abstract] AND PTRH2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A1ES-01ATAF15chr17

34151202

+PTRH2chr17

57775339

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000588240ENST00000393038TAF15chr17

34151202

+PTRH2chr17

57775339

-
In-frameENST00000588240ENST00000537860TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000588240ENST00000409433TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000588240ENST00000470557TAF15chr17

34151202

+PTRH2chr17

57775339

-
5CDS-intronENST00000588240ENST00000579915TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000592237ENST00000393038TAF15chr17

34151202

+PTRH2chr17

57775339

-
In-frameENST00000592237ENST00000537860TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000592237ENST00000409433TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000592237ENST00000470557TAF15chr17

34151202

+PTRH2chr17

57775339

-
5CDS-intronENST00000592237ENST00000579915TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000311979ENST00000393038TAF15chr17

34151202

+PTRH2chr17

57775339

-
In-frameENST00000311979ENST00000537860TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000311979ENST00000409433TAF15chr17

34151202

+PTRH2chr17

57775339

-
Frame-shitENST00000311979ENST00000470557TAF15chr17

34151202

+PTRH2chr17

57775339

-
5CDS-intronENST00000311979ENST00000579915TAF15chr17

34151202

+PTRH2chr17

57775339

-

Top

FusionProtFeatures for TAF15_PTRH2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
TAF15

Q92804

PTRH2

Q9Y3E5

RNA and ssDNA-binding protein that may play specificroles during transcription initiation at distinct promoters. Canenter the preinitiation complex together with the RNA polymeraseII (Pol II). {ECO:0000269|PubMed:19124016}. The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.{ECO:0000250}. Promotes caspase-independent apoptosis by regulating thefunction of two transcriptional regulators, AES and TLE1.{ECO:0000269|PubMed:15006356}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for TAF15_PTRH2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_TAF15_ENST00000588240_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_381aa
MSDSGSYGQSGGEQQSTSTTGNPGSQGTGQASQSTSGTGQTTDSSTGQNYSGYSSTGQSQSGTSQSTGGTENQKQSSTSQQPTNNQGQQQ
NMESSGSQGGRAPSTDQPDTGQQDSTDQQSGTDQHQGSTDEQSNTDQQHDSTSQNQQSTHSQRENYSHHTQDDRRDVSRTGEDNRGTGGS
QGGGRGRGGTDKDGRGPMTGSRCPPNPWLWNIWLIPVHSAWLLELLVACAWAGAFETALGCSPKARRARHTQILKVKQASWETAGSTR_F
LWFEMT_RWEKGKWLPSALMLLFQPTSRFKEEILKCSNNGNTVASPRWWSKLLMKKP_LHTWPMQKCWD_L_V_FKMLDVLRLHQALKLS

>In-frame_TAF15_ENST00000592237_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_290aa
MESSGSQGGRAPSTDQPDTGQQDSTDQQSGTDQHQGSTDEQSNTDQQHDSTSQNQQSTHSQRENYSHHTQDDRRDVSRTGEDNRGTGGSQ
GGGRGRGGTDKDGRGPMTGSRCPPNPWLWNIWLIPVHSAWLLELLVACAWAGAFETALGCSPKARRARHTQILKVKQASWETAGSTR_FL
WFEMT_RWEKGKWLPSALMLLFQPTSRFKEEILKCSNNGNTVASPRWWSKLLMKKP_LHTWPMQKCWD_L_V_FKMLDVLRLHQALKLS_

>In-frame_TAF15_ENST00000311979_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_378aa
MSDSGSYGQSGGEQQSTSTTGNPGSQGTGQASQSTSGTGQTTDSSTGQNYSGYSSTGQSTSQSTGGTENQKQSSTSQQPTNNQGQQQNME
SSGSQGGRAPSTDQPDTGQQDSTDQQSGTDQHQGSTDEQSNTDQQHDSTSQNQQSTHSQRENYSHHTQDDRRDVSRTGEDNRGTGGSQGG
GRGRGGTDKDGRGPMTGSRCPPNPWLWNIWLIPVHSAWLLELLVACAWAGAFETALGCSPKARRARHTQILKVKQASWETAGSTR_FLWF
EMT_RWEKGKWLPSALMLLFQPTSRFKEEILKCSNNGNTVASPRWWSKLLMKKP_LHTWPMQKCWD_L_V_FKMLDVLRLHQALKLS_GL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_TAF15_ENST00000588240_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_1145nt
ATGTCGGATTCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAAGGCTATGGACAA
GCATCACAAAGCTATTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTCAG
TCAGGTTATTCACAGTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAGGGACAGCAGCAA
AACATGGAATCATCAGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCA
GGCTATGATCAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCAT
TCACAAAGGGAAAACTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCA
CAGGGAGGAGGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGATGCCCTCCAAATCCTTGGTTATGG
AATATTTGGCTCATCCCAGTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGCTGGAGCCTTCGAGTATGCTTTGGGA
TGCTCCCCAAAAGCAAGACGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGAGACAGCGGGGAGTACAAGATGATTC
TTGTGGTTCGAAATGACTTAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCTGTTTCAGCCTACAAGCAGATTCAAA
GAAGAAATCCTGAAATGCTCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCTCCTGATGAAGAAACCCTGATTGCAT
TATTGGCCCATGCAAAAATGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAGATTGCACCAGGCTCTCAAACTGTCC

>In-frame_TAF15_ENST00000592237_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_872nt
ATGGAATCATCAGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGC
TATGATCAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCATTCA
CAAAGGGAAAACTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAG
GGAGGAGGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGATGCCCTCCAAATCCTTGGTTATGGAAT
ATTTGGCTCATCCCAGTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGCTGGAGCCTTCGAGTATGCTTTGGGATGC
TCCCCAAAAGCAAGACGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGAGACAGCGGGGAGTACAAGATGATTCTTG
TGGTTCGAAATGACTTAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCTGTTTCAGCCTACAAGCAGATTCAAAGAA
GAAATCCTGAAATGCTCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCTCCTGATGAAGAAACCCTGATTGCATTAT
TGGCCCATGCAAAAATGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAGATTGCACCAGGCTCTCAAACTGTCCTAG

>In-frame_TAF15_ENST00000311979_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_1136nt
ATGTCGGATTCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAAGGCTATGGACAA
GCATCACAAAGCTATTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTTAT
TCACAGTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAGGGACAGCAGCAAAACATGGAA
TCATCAGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGCTATGAT
CAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCATTCACAAAGG
GAAAACTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAGGGAGGA
GGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGATGCCCTCCAAATCCTTGGTTATGGAATATTTGG
CTCATCCCAGTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGCTGGAGCCTTCGAGTATGCTTTGGGATGCTCCCCA
AAAGCAAGACGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGAGACAGCGGGGAGTACAAGATGATTCTTGTGGTTC
GAAATGACTTAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCTGTTTCAGCCTACAAGCAGATTCAAAGAAGAAATC
CTGAAATGCTCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCTCCTGATGAAGAAACCCTGATTGCATTATTGGCCC
ATGCAAAAATGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAGATTGCACCAGGCTCTCAAACTGTCCTAGGGATTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_TAF15_ENST00000588240_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_1391nt
AGTCCGCCTCAGCCCGCCGCGCCGCCCTCAGTACAGCTCCGGCCGCCGCGCCGCCTGGCTTTCGTATTCGTTGTTCTCGGCGGGCTGTGG
GGCCTCCGCGCCGCGGCCGTTAGTCATGTCGGATTCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAA
TCCAGGCAGCCAAGGCTATGGACAAGCATCACAAAGCTATTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGG
TTACTCCAGTTATGGACAAAGTCAGTCAGGTTATTCACAGTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACC
ATATAATAACCAGGGACAGCAGCAAAACATGGAATCATCAGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCA
ACAAGATTCATATGACCAGCAGTCAGGCTATGATCAACATCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTA
TAGTCAAAACCAGCAGTCCTATCATTCACAAAGGGAAAACTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGA
AGATAATAGAGGATATGGCGGGTCACAGGGAGGAGGTAGAGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAG
ATGCCCTCCAAATCCTTGGTTATGGAATATTTGGCTCATCCCAGTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGC
TGGAGCCTTCGAGTATGCTTTGGGATGCTCCCCAAAAGCAAGACGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGA
GACAGCGGGGAGTACAAGATGATTCTTGTGGTTCGAAATGACTTAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCT
GTTTCAGCCTACAAGCAGATTCAAAGAAGAAATCCTGAAATGCTCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCT
CCTGATGAAGAAACCCTGATTGCATTATTGGCCCATGCAAAAATGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAG
ATTGCACCAGGCTCTCAAACTGTCCTAGGGATTGGGCCAGGACCAGCAGACCTAATTGACAAAGTCACTGGTCACCTAAAACTTTACTAG
GTGGACTTTGATATGACAACAACCCCTCCATCACAAGTGTTTGAAGCCTGTCAGATTCTAACAACAAAAGCTGAATTTCTTCACCCAACT

>In-frame_TAF15_ENST00000592237_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_1532nt
AGTACAGCTCCGGCCGCCGCGCCGCCTGGCTTTCGTATTCGTTGTTCTCGGCGGGCTGTGGGGCCTCCGCGCCGCGGCCGTTAGTCATGT
CGGCGAGGCCTCGGGCCAGTCATCTCGCCGCCTCGTACCTCAGTTTTCCCATCCTCGAAGTGGAGCTGGGCCTGCCTGACTCACCCATTC
ATCAGCAAGTCTTTGGAAATATTTTTGTTGGTGCTGACAGCCAAAGCAGTCCAATACAGAGGAATGGTGTATATCTTGGGGTGATTCTGG
AAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAAGGCTATGGACAAGCATCACAAAGCTA
TTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTCAGTCAGGTTATTCACA
GTCCTATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAGGGACAGCAGCAAAACATGGAATCATC
AGGAAGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGCTATGATCAACA
TCAAGGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCATTCACAAAGGGAAAA
CTACAGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAGGGAGGAGGTAG
AGGGCGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGATGCCCTCCAAATCCTTGGTTATGGAATATTTGGCTCAT
CCCAGTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGCTGGAGCCTTCGAGTATGCTTTGGGATGCTCCCCAAAAGC
AAGACGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGAGACAGCGGGGAGTACAAGATGATTCTTGTGGTTCGAAAT
GACTTAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCTGTTTCAGCCTACAAGCAGATTCAAAGAAGAAATCCTGAA
ATGCTCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCTCCTGATGAAGAAACCCTGATTGCATTATTGGCCCATGCA
AAAATGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAGATTGCACCAGGCTCTCAAACTGTCCTAGGGATTGGGCCA
GGACCAGCAGACCTAATTGACAAAGTCACTGGTCACCTAAAACTTTACTAGGTGGACTTTGATATGACAACAACCCCTCCATCACAAGTG
TTTGAAGCCTGTCAGATTCTAACAACAAAAGCTGAATTTCTTCACCCAACTTAAATGTTCTTGAGATGAAAATAAAACCTATTCCCATGT

>In-frame_TAF15_ENST00000311979_chr17_34151202_+_PTRH2_ENST00000537860_chr17_57775339_-_1348nt
AGCTCCGGCCGCCGCGCCGCCTGGCTTTCGTATTCGTTGTTCTCGGCGGGCTGTGGGGCCTCCGCGCCGCGGCCGTTAGTCATGTCGGAT
TCTGGAAGTTACGGTCAGTCTGGGGGTGAGCAGCAAAGTTATTCTACCTATGGAAATCCAGGCAGCCAAGGCTATGGACAAGCATCACAA
AGCTATTCTGGCTATGGGCAAACGACTGATTCCTCTTATGGACAGAACTACAGCGGTTACTCCAGTTATGGACAAAGTTATTCACAGTCC
TATGGTGGTTATGAGAATCAAAAGCAGAGCTCATATAGCCAGCAACCATATAATAACCAGGGACAGCAGCAAAACATGGAATCATCAGGA
AGCCAAGGTGGAAGAGCACCTTCCTATGACCAGCCAGACTATGGTCAACAAGATTCATATGACCAGCAGTCAGGCTATGATCAACATCAA
GGCTCATATGATGAGCAGTCAAATTATGATCAGCAGCATGATTCCTATAGTCAAAACCAGCAGTCCTATCATTCACAAAGGGAAAACTAC
AGCCACCACACACAAGATGACCGTCGTGATGTGAGTAGGTATGGAGAAGATAATAGAGGATATGGCGGGTCACAGGGAGGAGGTAGAGGG
CGTGGGGGATATGACAAGGATGGAAGAGGTCCTATGACAGGATCAAGATGCCCTCCAAATCCTTGGTTATGGAATATTTGGCTCATCCCA
GTACACTCGGCTTGGCTGTTGGAGTTGCTTGTGGCATGTGCCTGGGCTGGAGCCTTCGAGTATGCTTTGGGATGCTCCCCAAAAGCAAGA
CGAGCAAGACACACACAGATACTGAAAGTGAAGCAAGCATCTTGGGAGACAGCGGGGAGTACAAGATGATTCTTGTGGTTCGAAATGACT
TAAAGATGGGAAAAGGGAAAGTGGCTGCCCAGTGCTCTCATGCTGCTGTTTCAGCCTACAAGCAGATTCAAAGAAGAAATCCTGAAATGC
TCAAACAATGGGAATACTGTGGCCAGCCCAAGGTGGTGGTCAAAGCTCCTGATGAAGAAACCCTGATTGCATTATTGGCCCATGCAAAAA
TGCTGGGACTGACTGTAAGTTTAATTCAAGATGCTGGACGTACTCAGATTGCACCAGGCTCTCAAACTGTCCTAGGGATTGGGCCAGGAC
CAGCAGACCTAATTGACAAAGTCACTGGTCACCTAAAACTTTACTAGGTGGACTTTGATATGACAACAACCCCTCCATCACAAGTGTTTG


Top

FusionGenePPI for TAF15_PTRH2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
TAF15SAFB, PRMT1, TAF7, TAF5, TAF13, TAF11, POLR2C, POLR2G, POLR2E, SF1, KAT2B, POLR2A, HIST2H2AC, HIST1H3A, HIST2H4A, CACNA1A, SIRT7, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, DDB1, TPR, SAP30BP, RNF168, SCARB2, TPM2, TMED9, MED26, PRMT8, FUS, RPA3, RPA2, RPA1, HIST3H3, CUL7, OBSL1, EZH2, SUZ12, EED, RNF2, BMI1, RPS6KB2, ACAA2, SFN, HNRNPA1, PPP1CB, MATR3, MED12, MCM2, NF2, DNPEP, KLHL8, TRIM25, BRCA1PTRH2AES, ATP6V0A1, ATP6V0A2, ATP6V1D, STT3B, FLOT1, RPS2, LAMTOR3, RPS15, JUP, CD55, ABCC2, FLOT2, GADD45GIP1, PTK2, PHYHIP, ARHGEF10, DLK1, FAM63B, TNFRSF10B, CLEC5A, CLTC, COQ9, CHCHD2, DUSP22, DUSP6, DUSP8, DUSP9, EYA3, TLR5, CHRM3, CD7, SLC6A15, HTR2C, SIGLEC10, SLC18A1, HTR3A, SCGB2A2, TEX29, GPR21, YIPF3, HMOX2, SLC39A12, MED21, GRPR, PTPN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for TAF15_PTRH2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for TAF15_PTRH2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneTAF15C0029463Osteosarcoma1CTD_human
HgeneTAF15C0038356Stomach Neoplasms1CTD_human
TgenePTRH2C0033578Prostatic Neoplasms1CTD_human
TgenePTRH2C4015728NEUROLOGIC, ENDOCRINE, AND PANCREATIC DISEASE, MULTISYSTEM, INFANTILE-ONSET1ORPHANET;UNIPROT