FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36680

FusionGeneSummary for STXBP4_NIPA2

check button Fusion gene summary
Fusion gene informationFusion gene name: STXBP4_NIPA2
Fusion gene ID: 36680
HgeneTgene
Gene symbol

STXBP4

NIPA2

Gene ID

252983

81614

Gene namesyntaxin binding protein 4NIPA magnesium transporter 2
SynonymsSynipSLC57A2
Cytomap

17q22

15q11.2

Type of geneprotein-codingprotein-coding
Descriptionsyntaxin-binding protein 4STX4-interacting proteinsyntaxin 4 interacting proteinmagnesium transporter NIPA2non imprinted in Prader-Willi/Angelman syndrome 2non-imprinted in Prader-Willi/Angelman syndrome region protein 2
Modification date2018052020180523
UniProtAcc

Q6ZWJ1

Q8N8Q9

Ensembl transtripts involved in fusion geneENST00000299341, ENST00000376352, 
ENST00000405898, ENST00000434978, 
ENST00000398391, 
ENST00000337451, 
ENST00000398014, ENST00000398013, 
ENST00000539711, ENST00000359727, 
ENST00000559571, 
Fusion gene scores* DoF score4 X 4 X 2=321 X 1 X 1=1
# samples 31
** MAII scorelog2(3/32*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: STXBP4 [Title/Abstract] AND NIPA2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTXBP4

GO:0006974

cellular response to DNA damage stimulus

19451233

HgeneSTXBP4

GO:0061178

regulation of insulin secretion involved in cellular response to glucose stimulus

12855681


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A1F2-01ASTXBP4chr17

53158544

+NIPA2chr15

23014528

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000299341ENST00000337451STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000299341ENST00000398014STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000299341ENST00000398013STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000299341ENST00000539711STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000299341ENST00000359727STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-intronENST00000299341ENST00000559571STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000376352ENST00000337451STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000376352ENST00000398014STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000376352ENST00000398013STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000376352ENST00000539711STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000376352ENST00000359727STXBP4chr17

53158544

+NIPA2chr15

23014528

+
5CDS-intronENST00000376352ENST00000559571STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000405898ENST00000337451STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000405898ENST00000398014STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000405898ENST00000398013STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000405898ENST00000539711STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000405898ENST00000359727STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-intronENST00000405898ENST00000559571STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000434978ENST00000337451STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000434978ENST00000398014STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000434978ENST00000398013STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000434978ENST00000539711STXBP4chr17

53158544

+NIPA2chr15

23014528

+
In-frameENST00000434978ENST00000359727STXBP4chr17

53158544

+NIPA2chr15

23014528

+
5CDS-intronENST00000434978ENST00000559571STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000398391ENST00000337451STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000398391ENST00000398014STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000398391ENST00000398013STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000398391ENST00000539711STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-3CDSENST00000398391ENST00000359727STXBP4chr17

53158544

+NIPA2chr15

23014528

+
intron-intronENST00000398391ENST00000559571STXBP4chr17

53158544

+NIPA2chr15

23014528

+

Top

FusionProtFeatures for STXBP4_NIPA2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STXBP4

Q6ZWJ1

NIPA2

Q8N8Q9

Plays a role in the translocation of transport vesiclesfrom the cytoplasm to the plasma membrane. Inhibits thetranslocation of SLC2A4 from intracellular vesicles to the plasmamembrane by STX4A binding and preventing the interaction betweenSTX4A and VAMP2. Stimulation with insulin disrupts the interactionwith STX4A, leading to increased levels of SLC2A4 at the plasmamembrane. May also play a role in the regulation of insulinrelease by pancreatic beta cells after stimulation by glucose (Bysimilarity). {ECO:0000250}. Acts as a selective Mg(2+) transporter. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for STXBP4_NIPA2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_792aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDTEEVIRLLEAKITELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSN
LSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLN
LHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGL
GIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTI

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_792aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDTEEVIRLLEAKITELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSN
LSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLN
LHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGL
GIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTI

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_792aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDTEEVIRLLEAKITELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSN
LSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLN
LHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGL
GIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTI

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_792aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDTEEVIRLLEAKITELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSN
LSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLN
LHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGL
GIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTI

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_792aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEKLLESDKQRKQLTEELQNVKQEAKAVVEETRALRSRIHLAEAAQ
RQAHGMEMDTEEVIRLLEAKITELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSN
LSERRAVLASQTSLTPLGRNGRSIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLN
LHGKIGCLLSILGSTVMVIHAPKEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGL
GIAIKELFAGKPVLRHPLAWILLLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTI

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_770aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDTEEVIRLLEAKIT
ELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGR
SIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAP
KEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWIL
LLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPV

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_770aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDTEEVIRLLEAKIT
ELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGR
SIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAP
KEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWIL
LLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPV

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_770aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDTEEVIRLLEAKIT
ELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGR
SIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAP
KEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWIL
LLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPV

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_770aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDTEEVIRLLEAKIT
ELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGR
SIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAP
KEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWIL
LLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPV

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_770aa
MNKNTSTVVSPSLLEKDPAFQMITIAKETGLGLKVLGGINRNEGPLVTIQEIIPGGDCTKDGRLKPGDQLVSVNKESMIGVSFEEAKSII
TGAKLRLESAWEIAFIRQKSDNIQPENLSCTSLIEASGETGPQASTLSLFSSPPEILIPKTSSTPKTNNDILSSCEIKTGYNKTVQIPIT
SENSTVGLSNTDVASAWTENTGLQEKISLNPSVRFKAEKLEMALNTLGIQPTKEQHQALRQQVQADSKGTVSFGDFVQVARNLFCLQLDE
VNVGAHEISNILDSQLLPCDSSEADEMERLKCERDDALKEVNTLKEAKAVVEETRALRSRIHLAEAAQRQAHGMEMDTEEVIRLLEAKIT
ELKAQLADTSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQTSLTPLGRNGR
SIPATLALESKELVKSVRALLDMDLGAGEVANFAATAFAPATLVTPLGALSVLVSAILSSYFLNERLNLHGKIGCLLSILGSTVMVIHAP
KEEEIETLNEMSHKLGDPGFVVFATLVVIVALILIFVVGPRHGQTNILVYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWIL
LLSLIVCVSTQINYLNRALDIFNTSIVTPITTVFFTTSVLTCSAILFKEWQDMPVDDVIGTLSGFFTIIVGIFLLHAFKDVSFSLASLPV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_2376nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCAGATAAGCAAAGGAAACAATTGACAGAA
GAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAG
AGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGAT
TATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGA
AAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAAT
TTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTT
GAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTT
GCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAAT
CTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTA
AATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTG
GGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTG
GGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTG
AGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATATATTATGTATTCTTTACAACATCA
GTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATC
ATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCA
ATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAAT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_2376nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCAGATAAGCAAAGGAAACAATTGACAGAA
GAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAG
AGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGAT
TATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGA
AAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAAT
TTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTT
GAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTT
GCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAAT
CTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTA
AATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTG
GGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTG
GGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTG
AGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATATATTATGTATTCTTTACAACATCA
GTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATC
ATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCA
ATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAAT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_2376nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCAGATAAGCAAAGGAAACAATTGACAGAA
GAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAG
AGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGAT
TATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGA
AAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAAT
TTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTT
GAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTT
GCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAAT
CTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTA
AATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTG
GGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTG
GGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTG
AGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATATATTATGTATTCTTTACAACATCA
GTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATC
ATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCA
ATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAAT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_2376nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCAGATAAGCAAAGGAAACAATTGACAGAA
GAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAG
AGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGAT
TATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGA
AAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAAT
TTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTT
GAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTT
GCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAAT
CTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTA
AATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTG
GGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTG
GGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTG
AGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATATATTATGTATTCTTTACAACATCA
GTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATC
ATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCA
ATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAAT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_2376nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCAGATAAGCAAAGGAAACAATTGACAGAA
GAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAG
AGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGAT
TATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGA
AAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAAT
TTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTT
GAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTT
GCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAAT
CTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTA
AATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTG
GGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTG
GGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTG
AGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATATATTATGTATTCTTTACAACATCA
GTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATC
ATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCA
ATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAAT

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_2310nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGG
ATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACA
GAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAA
TTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCT
GATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGT
AGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTG
GCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCA
TACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCA
AAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTG
GCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTT
TCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTG
CTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATA
TATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGT
ACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTG
TCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGA

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_2310nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGG
ATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACA
GAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAA
TTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCT
GATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGT
AGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTG
GCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCA
TACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCA
AAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTG
GCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTT
TCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTG
CTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATA
TATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGT
ACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTG
TCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGA

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_2310nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGG
ATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACA
GAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAA
TTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCT
GATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGT
AGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTG
GCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCA
TACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCA
AAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTG
GCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTT
TCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTG
CTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATA
TATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGT
ACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTG
TCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGA

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_2310nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGG
ATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACA
GAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAA
TTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCT
GATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGT
AGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTG
GCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCA
TACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCA
AAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTG
GCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTT
TCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTG
CTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATA
TATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGT
ACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTG
TCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGA

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_2310nt
ATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAATTGCCAAGGAAACAGGC
CTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGGAGGAGACTGTTATAAG
GATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGAAGCAAAAAGCATAATT
ACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCCAGAAAATCTGTCATGT
ACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGAAATACTAATCCCAAAG
ACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGTACAGATTCCAATTACT
TCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGAAAAGATCTCCCTAAAT
CCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACAACACCAAGCCCTGAGA
CAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTGCTTGCAGTTGGATGAA
GTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGATGAAATGGAAAGGCTC
AAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGTCGG
ATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATTACA
GAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGCCAA
TTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTTTCT
GATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGACGT
AGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAGGTG
GCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCTTCA
TACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCTCCA
AAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATTGTG
GCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCGTTT
TCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATTCTG
CTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCAATA
TATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATTGGT
ACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCTGTG
TCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGTGGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_4120nt
AGGTGGCAGCGCTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAG
AGTAATATAGGATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGT
TAAATCCAAGGCTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAG
ATGATTACAATTGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAA
ATTATTCCTGGAGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTA
TCATTTGAAGAAGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGAC
AACATTCAGCCAGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCT
TCTCCTCCTGAAATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATAC
AACAAAACAGTACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTAT
GGGCTACAAGAAAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCC
ACAAAGGAACAACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGA
AACTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCT
TCAGAAGCAGATGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCA
GATAAGCAAAGGAAACAATTGACAGAAGAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGT
CGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATT
ACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGC
CAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTT
TCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGA
CGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAG
GTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCT
CCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATT
GTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCG
TTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATT
CTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATT
GGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCT
GTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGT
GGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTAAAGGTTAATCTGT
GATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGGCAATCTTTTTAAA
GATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAGCACATGACGATTT
CTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTTTTAAGTCTATGAA
AATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATGTAAGGCTTTTTTA
TTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGATGATGATTGGTTT
TATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGGCAGAAATCACCCC
AAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCATCAAGCCAGCACAT
CCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCGTTTTACATCAGCT
CTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACTAGGGTTGTTTCTT
AAATTTAGCTCATGTTATAATAAAAAGTTGAAATGAAGTTCTTATTCTAAAAGTCTGAATGCTTAGAACAAACTTAACATGTTTATAGAA
TATGGTCTCTTTGTACCAAGTACTTTGCTTAAGAGCTCCTTTGGGCCACTACATATTTTGGTTTCTAGAAAATGTTTGTTTATGAAGAAG
TCGATGGAAAACTGCAAACATATGCAGAAAAGGTAGAATAATAAAAAAGGTCTAATGAACTCCATTCAGCTTTGAACCTATCCACTCATA
ACCATTGACTGGCCTTTAAAAAAAAGTATTGGCAGAATTAATTTCCACCTAGGTGATGGGAAGAAAGTGTTCGCCTGTTCCAGCCTGTGG
CTCCTGCCTGGAGGTTACCCAGTGGTGCGCCAGCGCCAAGCCATCACTCCCCGAGGGCCTCCCCTGCCAATGGTGCTGGTATCCCATGCA
GCTCACCACTGGCTGCGTGGAAACTCCCTTTTTTCCAACTTTATTATTGGCCTTCTAAGGAGCTGTTTTAGATGTTTTTTCTAACTGCCT
CCTCCCATGCCATTTTAATACTACAGATGTACTACGTATCTGTTTATATACTGTACCTACATCTGTGCTTTGTACATAAAAGAACCAGTT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_4120nt
AGGTGGCAGCGCTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAG
AGTAATATAGGATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGT
TAAATCCAAGGCTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAG
ATGATTACAATTGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAA
ATTATTCCTGGAGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTA
TCATTTGAAGAAGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGAC
AACATTCAGCCAGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCT
TCTCCTCCTGAAATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATAC
AACAAAACAGTACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTAT
GGGCTACAAGAAAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCC
ACAAAGGAACAACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGA
AACTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCT
TCAGAAGCAGATGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCA
GATAAGCAAAGGAAACAATTGACAGAAGAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGT
CGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATT
ACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGC
CAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTT
TCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGA
CGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAG
GTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCT
CCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATT
GTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCG
TTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATT
CTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATT
GGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCT
GTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGT
GGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTAAAGGTTAATCTGT
GATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGGCAATCTTTTTAAA
GATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAGCACATGACGATTT
CTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTTTTAAGTCTATGAA
AATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATGTAAGGCTTTTTTA
TTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGATGATGATTGGTTT
TATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGGCAGAAATCACCCC
AAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCATCAAGCCAGCACAT
CCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCGTTTTACATCAGCT
CTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACTAGGGTTGTTTCTT
AAATTTAGCTCATGTTATAATAAAAAGTTGAAATGAAGTTCTTATTCTAAAAGTCTGAATGCTTAGAACAAACTTAACATGTTTATAGAA
TATGGTCTCTTTGTACCAAGTACTTTGCTTAAGAGCTCCTTTGGGCCACTACATATTTTGGTTTCTAGAAAATGTTTGTTTATGAAGAAG
TCGATGGAAAACTGCAAACATATGCAGAAAAGGTAGAATAATAAAAAAGGTCTAATGAACTCCATTCAGCTTTGAACCTATCCACTCATA
ACCATTGACTGGCCTTTAAAAAAAAGTATTGGCAGAATTAATTTCCACCTAGGTGATGGGAAGAAAGTGTTCGCCTGTTCCAGCCTGTGG
CTCCTGCCTGGAGGTTACCCAGTGGTGCGCCAGCGCCAAGCCATCACTCCCCGAGGGCCTCCCCTGCCAATGGTGCTGGTATCCCATGCA
GCTCACCACTGGCTGCGTGGAAACTCCCTTTTTTCCAACTTTATTATTGGCCTTCTAAGGAGCTGTTTTAGATGTTTTTTCTAACTGCCT
CCTCCCATGCCATTTTAATACTACAGATGTACTACGTATCTGTTTATATACTGTACCTACATCTGTGCTTTGTACATAAAAGAACCAGTT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_3452nt
AGGTGGCAGCGCTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAG
AGTAATATAGGATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGT
TAAATCCAAGGCTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAG
ATGATTACAATTGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAA
ATTATTCCTGGAGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTA
TCATTTGAAGAAGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGAC
AACATTCAGCCAGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCT
TCTCCTCCTGAAATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATAC
AACAAAACAGTACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTAT
GGGCTACAAGAAAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCC
ACAAAGGAACAACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGA
AACTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCT
TCAGAAGCAGATGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCA
GATAAGCAAAGGAAACAATTGACAGAAGAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGT
CGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATT
ACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGC
CAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTT
TCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGA
CGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAG
GTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCT
CCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATT
GTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCG
TTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATT
CTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATT
GGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCT
GTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGT
GGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTAAAGGTTAATCTGT
GATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGGCAATCTTTTTAAA
GATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAGCACATGACGATTT
CTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTTTTAAGTCTATGAA
AATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATGTAAGGCTTTTTTA
TTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGATGATGATTGGTTT
TATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGGCAGAAATCACCCC
AAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCATCAAGCCAGCACAT
CCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCGTTTTACATCAGCT
CTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACTAGGGTTGTTTCTT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_2652nt
AGGTGGCAGCGCTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAG
AGTAATATAGGATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGT
TAAATCCAAGGCTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAG
ATGATTACAATTGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAA
ATTATTCCTGGAGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTA
TCATTTGAAGAAGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGAC
AACATTCAGCCAGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCT
TCTCCTCCTGAAATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATAC
AACAAAACAGTACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTAT
GGGCTACAAGAAAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCC
ACAAAGGAACAACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGA
AACTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCT
TCAGAAGCAGATGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCA
GATAAGCAAAGGAAACAATTGACAGAAGAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGT
CGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATT
ACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGC
CAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTT
TCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGA
CGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAG
GTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCT
CCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATT
GTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCG
TTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATT
CTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATT
GGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCT
GTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGT
GGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTAAAGGTTAATCTGT

>In-frame_STXBP4_ENST00000376352_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_2583nt
AGGTGGCAGCGCTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAG
AGTAATATAGGATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGT
TAAATCCAAGGCTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAG
ATGATTACAATTGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAA
ATTATTCCTGGAGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTA
TCATTTGAAGAAGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGAC
AACATTCAGCCAGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCT
TCTCCTCCTGAAATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATAC
AACAAAACAGTACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTAT
GGGCTACAAGAAAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCC
ACAAAGGAACAACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGA
AACTTGTTTTGCTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCT
TCAGAAGCAGATGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAAAATTATTGGAATCA
GATAAGCAAAGGAAACAATTGACAGAAGAGCTCCAGAATGTGAAACAAGAAGCCAAAGCTGTAGTTGAAGAAACAAGAGCCCTGCGTAGT
CGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTTAGAGGCCAAGATT
ACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCATGGTACTCGACTGC
CAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTATTCAAGAAGTATTT
TCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACTGGGAAGGAATGGA
CGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTTGGGAGCTGGTGAG
GTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAGTGCCATTCTTTCT
TCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTATGGTCATTCATGCT
CCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAACCCTTGTGGTCATT
GTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTCTGTAATCGGCGCG
TTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCCCCTGGCTTGGATT
CTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTCCATTGTGACTCCA
ATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGTTGACGATGTCATT
GGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCTAGCAAGTCTGCCT
GTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGAAAGCTTAACCTGT

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000337451_chr15_23014528_+_4043nt
CTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAGAGTAATATAGG
ATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGTTAAATCCAAGG
CTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAAT
TGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGG
AGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGA
AGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCC
AGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGA
AATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGT
ACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGA
AAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACA
ACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTG
CTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGA
TGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAG
AGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTT
AGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCAT
GGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTAT
TCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACT
GGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTT
GGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAG
TGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTAT
GGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAAC
CCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTC
TGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCC
CCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTC
CATTGTGACTCCAATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGT
TGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCT
AGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGA
AAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTA
AAGGTTAATCTGTGATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGG
CAATCTTTTTAAAGATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAG
CACATGACGATTTCTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTT
TTAAGTCTATGAAAATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATG
TAAGGCTTTTTTATTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGA
TGATGATTGGTTTTATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGG
CAGAAATCACCCCAAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCAT
CAAGCCAGCACATCCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCG
TTTTACATCAGCTCTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACT
AGGGTTGTTTCTTAAATTTAGCTCATGTTATAATAAAAAGTTGAAATGAAGTTCTTATTCTAAAAGTCTGAATGCTTAGAACAAACTTAA
CATGTTTATAGAATATGGTCTCTTTGTACCAAGTACTTTGCTTAAGAGCTCCTTTGGGCCACTACATATTTTGGTTTCTAGAAAATGTTT
GTTTATGAAGAAGTCGATGGAAAACTGCAAACATATGCAGAAAAGGTAGAATAATAAAAAAGGTCTAATGAACTCCATTCAGCTTTGAAC
CTATCCACTCATAACCATTGACTGGCCTTTAAAAAAAAGTATTGGCAGAATTAATTTCCACCTAGGTGATGGGAAGAAAGTGTTCGCCTG
TTCCAGCCTGTGGCTCCTGCCTGGAGGTTACCCAGTGGTGCGCCAGCGCCAAGCCATCACTCCCCGAGGGCCTCCCCTGCCAATGGTGCT
GGTATCCCATGCAGCTCACCACTGGCTGCGTGGAAACTCCCTTTTTTCCAACTTTATTATTGGCCTTCTAAGGAGCTGTTTTAGATGTTT
TTTCTAACTGCCTCCTCCCATGCCATTTTAATACTACAGATGTACTACGTATCTGTTTATATACTGTACCTACATCTGTGCTTTGTACAT

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398014_chr15_23014528_+_4043nt
CTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAGAGTAATATAGG
ATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGTTAAATCCAAGG
CTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAAT
TGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGG
AGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGA
AGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCC
AGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGA
AATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGT
ACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGA
AAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACA
ACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTG
CTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGA
TGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAG
AGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTT
AGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCAT
GGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTAT
TCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACT
GGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTT
GGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAG
TGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTAT
GGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAAC
CCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTC
TGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCC
CCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTC
CATTGTGACTCCAATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGT
TGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCT
AGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGA
AAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTA
AAGGTTAATCTGTGATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGG
CAATCTTTTTAAAGATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAG
CACATGACGATTTCTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTT
TTAAGTCTATGAAAATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATG
TAAGGCTTTTTTATTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGA
TGATGATTGGTTTTATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGG
CAGAAATCACCCCAAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCAT
CAAGCCAGCACATCCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCG
TTTTACATCAGCTCTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACT
AGGGTTGTTTCTTAAATTTAGCTCATGTTATAATAAAAAGTTGAAATGAAGTTCTTATTCTAAAAGTCTGAATGCTTAGAACAAACTTAA
CATGTTTATAGAATATGGTCTCTTTGTACCAAGTACTTTGCTTAAGAGCTCCTTTGGGCCACTACATATTTTGGTTTCTAGAAAATGTTT
GTTTATGAAGAAGTCGATGGAAAACTGCAAACATATGCAGAAAAGGTAGAATAATAAAAAAGGTCTAATGAACTCCATTCAGCTTTGAAC
CTATCCACTCATAACCATTGACTGGCCTTTAAAAAAAAGTATTGGCAGAATTAATTTCCACCTAGGTGATGGGAAGAAAGTGTTCGCCTG
TTCCAGCCTGTGGCTCCTGCCTGGAGGTTACCCAGTGGTGCGCCAGCGCCAAGCCATCACTCCCCGAGGGCCTCCCCTGCCAATGGTGCT
GGTATCCCATGCAGCTCACCACTGGCTGCGTGGAAACTCCCTTTTTTCCAACTTTATTATTGGCCTTCTAAGGAGCTGTTTTAGATGTTT
TTTCTAACTGCCTCCTCCCATGCCATTTTAATACTACAGATGTACTACGTATCTGTTTATATACTGTACCTACATCTGTGCTTTGTACAT

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000398013_chr15_23014528_+_3375nt
CTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAGAGTAATATAGG
ATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGTTAAATCCAAGG
CTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAAT
TGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGG
AGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGA
AGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCC
AGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGA
AATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGT
ACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGA
AAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACA
ACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTG
CTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGA
TGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAG
AGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTT
AGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCAT
GGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTAT
TCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACT
GGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTT
GGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAG
TGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTAT
GGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAAC
CCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTC
TGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCC
CCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTC
CATTGTGACTCCAATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGT
TGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCT
AGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGA
AAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTA
AAGGTTAATCTGTGATTGTTATGAAGTGAATTTGAATATCATCAGAATGTGTCTGAAAAAACATTGTCCTCAAATAATGTTCTTTAAAGG
CAATCTTTTTAAAGATTTCACTAATTTGGACCAAGAAATTACTTTTCTTGTATTTAAACAAACAATGGTAGCTCACTAAAATGACCTCAG
CACATGACGATTTCTATTAACATTTTATTGTTGTAGAAGTATTTTACATTTTCATCCCTTCTCCAAAAGCCGAATGCACTAATGACAGTT
TTAAGTCTATGAAAATGCTTTATTTTTTCATTGGTGATGAAAGTCTGAAATGTGCATTTGTCATCCCCACTCCATCAATCCCTGACCATG
TAAGGCTTTTTTATTTTAAAAAAACAGAGTTATCCCAATACATTATCCTGTGATTTACCTTACCTACAAAAGTGGCTCCTGTTTGTTTGA
TGATGATTGGTTTTATTTTTGAAATATTTATTAAGGGAAAACTAAGTTACTGAATGAAGGAACCTCTTTCTTACAAAACAAAAAAAAGGG
CAGAAATCACCCCAAGGAACGATTTCTCAGGTTGAGATGATCACCGTGAATCCGGCTTCCTCTGAGCATTCGATGGCCTTAGCACCTCAT
CAAGCCAGCACATCCTGCCTGCTGTTGCAGCCTGGCTGGGTTTATTCTTCAGTTACCCTAATCCCATGATGCCTGGAACCTTGATTACCG
TTTTACATCAGCTCTTGTACTTTTCAGTATATTTTCATAATGAGTTATATTGTCATTTAGACTTTGAACAGCTCTGGGAAATAGAAGACT

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000539711_chr15_23014528_+_2575nt
CTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAGAGTAATATAGG
ATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGTTAAATCCAAGG
CTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAAT
TGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGG
AGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGA
AGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCC
AGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGA
AATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGT
ACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGA
AAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACA
ACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTG
CTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGA
TGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAG
AGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTT
AGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCAT
GGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTAT
TCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACT
GGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTT
GGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAG
TGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTAT
GGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAAC
CCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTC
TGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCC
CCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTC
CATTGTGACTCCAATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGT
TGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCT
AGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGA
AAGCTTAACCTGTGGAATCGAACAACACACTGGTGAAAATGTCTCCCGAAGAAATGGAAATCTGACAGCTTTTTAAGAAAGGTGTAATTA

>In-frame_STXBP4_ENST00000434978_chr17_53158544_+_NIPA2_ENST00000359727_chr15_23014528_+_2506nt
CTTGCAGTCGGGCTACGGAGGCCGGGTTGCCAGATTACGGGAAAGCCATTTAAGAAGTTCCTGGAATAATATTAGTCAGAGTAATATAGG
ATCTGCAGGAAGTGTCTCAAGATAGTTGGAAAAGAAGAATTTCTAGACTCTTCATCAAGATCTTCATTTATACAGCTGTTAAATCCAAGG
CTACTTTGGTGAAAGCATGAATAAAAATACATCTACTGTAGTATCACCCAGTCTACTTGAAAAGGATCCTGCCTTTCAGATGATTACAAT
TGCCAAGGAAACAGGCCTTGGCCTGAAGGTACTAGGAGGAATTAACCGGAATGAAGGCCCATTGGTATATATTCAGGAAATTATTCCTGG
AGGAGACTGTTATAAGGATGGTCGTTTGAAGCCAGGAGATCAACTTGTCTCAGTCAACAAGGAATCTATGATTGGTGTATCATTTGAAGA
AGCAAAAAGCATAATTACCGGAGCCAAGTTGAGGTTAGAATCTGCTTGGGAGATAGCATTCATAAGACAAAAATCCGACAACATTCAGCC
AGAAAATCTGTCATGTACATCACTTATAGAAGCTTCAGGAGAATATGGACCTCAAGCCTCAACATTAAGTCTTTTTTCTTCTCCTCCTGA
AATACTAATCCCAAAGACCTCATCCACTCCCAAAACAAATAATGACATTTTATCTTCTTGTGAGATAAAAACTGGATACAACAAAACAGT
ACAGATTCCAATTACTTCAGAAAACAGTACTGTGGGTTTGTCTAATACAGATGTTGCTTCTGCCTGGACTGAAAATTATGGGCTACAAGA
AAAGATCTCCCTAAATCCCTCTGTTCGCTTTAAGGCAGAGAAACTGGAAATGGCTCTAAATTATCTTGGTATTCAGCCCACAAAGGAACA
ACACCAAGCCCTGAGACAGCAAGTACAAGCAGACTCAAAAGGGACAGTGTCTTTTGGAGATTTTGTCCAGGTTGCCAGAAACTTGTTTTG
CTTGCAGTTGGATGAAGTAAATGTTGGTGCACATGAAATTTCCAATATATTAGATTCACAGCTTCTTCCTTGTGATTCTTCAGAAGCAGA
TGAAATGGAAAGGCTCAAGTGTGAAAGAGATGATGCCTTGAAAGAAGTAAATACACTTAAGGAAGCCAAAGCTGTAGTTGAAGAAACAAG
AGCCCTGCGTAGTCGGATTCATCTTGCTGAAGCTGCTCAGAGACAGGCACATGGAATGGAAATGGACTATGAAGAAGTGATCCGTCTGTT
AGAGGCCAAGATTACAGAGCTAAAGGCTCAGCTTGCTGATTATTCTGACCAAAATAAAGAAAGTGTTCAGGATTTAAAAAAGAGAATCAT
GGTACTCGACTGCCAATTACGAAAATCAGAAATGGCTCGAAAAACTTTTGAGGCATCCACTGAAAAGCTTCTTCATTTTGTAGAGGCTAT
TCAAGAAGTATTTTCTGATAATTCTACTCCTTTATCAAATTTAAGTGAAAGAAGAGCTGTGTTAGCTTCTCAGACTTCCCTCACACCACT
GGGAAGGAATGGACGTAGCATCCCAGCAACGCTGGCGCTTGAATCTAAGGAACTTGTTAAATCTGTTCGTGCCTTACTTGATATGGATTT
GGGAGCTGGTGAGGTGGCCAACTTCGCTGCGTATGCGTTTGCACCAGCCACTCTAGTGACTCCACTAGGAGCTCTCAGCGTGCTAGTAAG
TGCCATTCTTTCTTCATACTTTCTCAATGAAAGACTTAATCTTCATGGGAAAATTGGGTGTTTGCTAAGTATTCTAGGATCTACAGTTAT
GGTCATTCATGCTCCAAAGGAAGAGGAGATTGAGACTTTAAATGAAATGTCTCACAAGCTAGGTGATCCAGGTTTTGTGGTCTTTGCAAC
CCTTGTGGTCATTGTGGCCTTGATATTAATCTTCGTGGTGGGTCCTCGCCATGGACAGACAAACATTCTTGTGTACATAACAATCTGCTC
TGTAATCGGCGCGTTTTCAGTCTCCTGTGTGAAGGGCCTGGGCATTGCTATCAAGGAGCTGTTTGCAGGGAAGCCTGTGCTGCGGCATCC
CCTGGCTTGGATTCTGCTGCTGAGCCTCATCGTCTGTGTGAGCACACAGATTAATTACCTAAATAGGGCCCTGGATATATTCAACACTTC
CATTGTGACTCCAATATATTATGTATTCTTTACAACATCAGTTTTAACTTGTTCAGCTATTCTTTTTAAGGAGTGGCAAGATATGCCTGT
TGACGATGTCATTGGTACTTTGAGTGGCTTCTTTACAATCATTGTGGGGATATTCTTGTTGCATGCCTTTAAAGACGTCAGCTTTAGTCT
AGCAAGTCTGCCTGTGTCTTTTCGAAAAGACGAGAAAGCAATGAATGGCAATCTCTCTAATATGTATGAAGTTCTTAATAATAATGAAGA


Top

FusionGenePPI for STXBP4_NIPA2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STXBP4ATN1, LATS2, KLHL42, PRRG4, TMEM171, C20orf195, SUSD6, MBIP, FAM189A2, VPS28, LDLRAD4, TP53, OFD1, CNTROB, CEP128, PTPN13, ERP44, PTPN14, WDTC1, CDR2, ARRDC3, RGS2, CCDC120, PLK1, PMF1, MPP5, PTPN21NIPA2YIPF3, FPR2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STXBP4_NIPA2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STXBP4_NIPA2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource