FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36667

FusionGeneSummary for STX8_RTN1

check button Fusion gene summary
Fusion gene informationFusion gene name: STX8_RTN1
Fusion gene ID: 36667
HgeneTgene
Gene symbol

STX8

RTN1

Gene ID

9482

6252

Gene namesyntaxin 8reticulon 1
SynonymsCARBNSP
Cytomap

17p13.1

14q23.1

Type of geneprotein-codingprotein-coding
Descriptionsyntaxin-8CIP-1-associated regulator of cyclin Breticulon-1neuroendocrine-specific protein
Modification date2018052320180522
UniProtAcc

Q9UNK0

Q16799

Ensembl transtripts involved in fusion geneENST00000306357, ENST00000574431, 
ENST00000573373, 
ENST00000267484, 
ENST00000395090, ENST00000342503, 
ENST00000557422, 
Fusion gene scores* DoF score6 X 5 X 5=1504 X 3 X 4=48
# samples 64
** MAII scorelog2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: STX8 [Title/Abstract] AND RTN1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTX8

GO:0045022

early endosome to late endosome transport

10564279

HgeneSTX8

GO:1903076

regulation of protein localization to plasma membrane

18570918


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPAADTCGA-3A-A9J0-01ASTX8chr17

9281869

-RTN1chr14

60074210

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000306357ENST00000267484STX8chr17

9281869

-RTN1chr14

60074210

-
In-frameENST00000306357ENST00000395090STX8chr17

9281869

-RTN1chr14

60074210

-
In-frameENST00000306357ENST00000342503STX8chr17

9281869

-RTN1chr14

60074210

-
5CDS-5UTRENST00000306357ENST00000557422STX8chr17

9281869

-RTN1chr14

60074210

-
Frame-shitENST00000574431ENST00000267484STX8chr17

9281869

-RTN1chr14

60074210

-
Frame-shitENST00000574431ENST00000395090STX8chr17

9281869

-RTN1chr14

60074210

-
Frame-shitENST00000574431ENST00000342503STX8chr17

9281869

-RTN1chr14

60074210

-
5CDS-5UTRENST00000574431ENST00000557422STX8chr17

9281869

-RTN1chr14

60074210

-
intron-3CDSENST00000573373ENST00000267484STX8chr17

9281869

-RTN1chr14

60074210

-
intron-3CDSENST00000573373ENST00000395090STX8chr17

9281869

-RTN1chr14

60074210

-
intron-3CDSENST00000573373ENST00000342503STX8chr17

9281869

-RTN1chr14

60074210

-
intron-5UTRENST00000573373ENST00000557422STX8chr17

9281869

-RTN1chr14

60074210

-

Top

FusionProtFeatures for STX8_RTN1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STX8

Q9UNK0

RTN1

Q16799

Vesicle trafficking protein that functions in the earlysecretory pathway, possibly by mediating retrograde transport fromcis-Golgi membranes to the ER. May be involved in neuroendocrine secretion or inmembrane trafficking in neuroendocrine cells.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTX8chr17:9281869chr14:60074210ENST00000306357-7842_65214237Coiled coilOntology_term=ECO:0000255
HgeneSTX8chr17:9281869chr14:60074210ENST00000306357-78145_207214237Domaint-SNARE coiled-coil homology
HgeneSTX8chr17:9281869chr14:60074210ENST00000306357-781_215214237Topological domainCytoplasmic
TgeneRTN1chr17:9281869chr14:60074210ENST00000267484-29609_612588777Compositional biasNote=Poly-Leu
TgeneRTN1chr17:9281869chr14:60074210ENST00000342503-07609_61220209Compositional biasNote=Poly-Leu
TgeneRTN1chr17:9281869chr14:60074210ENST00000267484-29589_776588777DomainReticulon
TgeneRTN1chr17:9281869chr14:60074210ENST00000342503-07589_77620209DomainReticulon
TgeneRTN1chr17:9281869chr14:60074210ENST00000267484-29603_623588777TransmembraneHelical
TgeneRTN1chr17:9281869chr14:60074210ENST00000267484-29705_725588777TransmembraneHelical
TgeneRTN1chr17:9281869chr14:60074210ENST00000342503-07603_62320209TransmembraneHelical
TgeneRTN1chr17:9281869chr14:60074210ENST00000342503-07705_72520209TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTX8chr17:9281869chr14:60074210ENST00000306357-78233_236214237Topological domainVesicular
HgeneSTX8chr17:9281869chr14:60074210ENST00000306357-78216_232214237TransmembraneHelical%3B Anchor for type IV membrane protein


Top

FusionGeneSequence for STX8_RTN1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000267484_chr14_60074210_-_403aa
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQTERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRE
RLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLRNETRRVNMVDRKSASCAIDLLTWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSV
LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000395090_chr14_60074210_-_403aa
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQTERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRE
RLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLRNETRRVNMVDRKSASCAIDLLTWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSV
LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000342503_chr14_60074210_-_403aa
MAPDPWFSTYDSTCQIAQEIAEKIQQRNQTERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRE
RLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQN
EIIDDLANLVENTDEKLRNETRRVNMVDRKSASCAIDLLTWRDIKQTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSV
LQAVQKTDEGHPFKAYLELEITLSQEQIQKYTDCLQFYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALFNGLTLLLMAVVSMFT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000267484_chr14_60074210_-_1209nt
ATGGCACCGGACCCCTGGTTCTCCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATAT
GAAAGAAAAGGTGAAAAGGCACCAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGAC
TTATTGCTAAGAGCTGTGTCAACACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAG
AGACTACTTCTGGCATCCTTTAAGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCA
CCCAACCCTTGGCTCTTTGAGGAGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAA
CAGGACGCAGGCCTTGATGCCCTTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAAT
GAGATAATTGACGACCTTGCCAACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAG
TCAGCCTCTTGTGCTATTGACCTGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCC
CTGACCCAGTTCAGCGTGGTGAGCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTT
TTACAAGCAGTGCAGAAAACCGACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAG
TACACGGACTGCCTGCAGTTCTACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAA
TTTGCAGTCCTGATGTGGCTCCTGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACT
CTACCTGTAGTGTATGTTAAGCACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000395090_chr14_60074210_-_1209nt
ATGGCACCGGACCCCTGGTTCTCCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATAT
GAAAGAAAAGGTGAAAAGGCACCAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGAC
TTATTGCTAAGAGCTGTGTCAACACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAG
AGACTACTTCTGGCATCCTTTAAGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCA
CCCAACCCTTGGCTCTTTGAGGAGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAA
CAGGACGCAGGCCTTGATGCCCTTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAAT
GAGATAATTGACGACCTTGCCAACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAG
TCAGCCTCTTGTGCTATTGACCTGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCC
CTGACCCAGTTCAGCGTGGTGAGCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTT
TTACAAGCAGTGCAGAAAACCGACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAG
TACACGGACTGCCTGCAGTTCTACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAA
TTTGCAGTCCTGATGTGGCTCCTGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACT
CTACCTGTAGTGTATGTTAAGCACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000342503_chr14_60074210_-_1209nt
ATGGCACCGGACCCCTGGTTCTCCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATAT
GAAAGAAAAGGTGAAAAGGCACCAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGAC
TTATTGCTAAGAGCTGTGTCAACACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAG
AGACTACTTCTGGCATCCTTTAAGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCA
CCCAACCCTTGGCTCTTTGAGGAGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAA
CAGGACGCAGGCCTTGATGCCCTTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAAT
GAGATAATTGACGACCTTGCCAACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAG
TCAGCCTCTTGTGCTATTGACCTGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCC
CTGACCCAGTTCAGCGTGGTGAGCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTT
TTACAAGCAGTGCAGAAAACCGACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAG
TACACGGACTGCCTGCAGTTCTACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAA
TTTGCAGTCCTGATGTGGCTCCTGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACT
CTACCTGTAGTGTATGTTAAGCACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATT


* Fusion transcript sequences (Full-length transcript).
>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000267484_chr14_60074210_-_2405nt
GGTATAATTTACATATCATAAAGTTAACTTAAAGTAGGTTGTAGTGAGTTTACGCAGCGTGCAAGTCTCACCGCAATCTAGTGTTTTGTT
TATTGTTTTGTTTTTGAAGCAGGATAAATTTTTAAGTAACTGCTACAGAGAGGTCTTGCAGCGCTCCCACCTTCCTGGGAAAATGCTTTG
TTTCTATTTAACAATTTTAACTGAGCTTAGCAGTTCGCGTCTCTTGGTGGGAGTAGATTGCTCCAGTGTACTGTCCGCAGGGGAGCGCTT
TGCTTTCTCTGATTATAGTTCTGAGGCCCTAGCTACTCACTTTGCAAACTCCAGGCTCCGGTCGCGCACGGGACGAACTGCGGGGAGTGA
GCCGCGCGGGCCGCCGTAGTCAGCTGCTAAGAGCAGGAAGAGTCCGAGCGGCGGGCGGAGTCTGCAGGATGGCACCGGACCCCTGGTTCT
CCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATATGAAAGAAAAGGTGAAAAGGCAC
CAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGACTTATTGCTAAGAGCTGTGTCAA
CACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAGAGACTACTTCTGGCATCCTTTA
AGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCACCCAACCCTTGGCTCTTTGAGG
AGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAACAGGACGCAGGCCTTGATGCCC
TTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAATGAGATAATTGACGACCTTGCCA
ACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAGTCAGCCTCTTGTGCTATTGACC
TGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCCCTGACCCAGTTCAGCGTGGTGA
GCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTTTTACAAGCAGTGCAGAAAACCG
ACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAGTACACGGACTGCCTGCAGTTCT
ACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAATTTGCAGTCCTGATGTGGCTCC
TGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACTCTACCTGTAGTGTATGTTAAGC
ACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATTCAGGCTAAAATCCCAGGCGCTA
AGAGGCATGCTGAGTAAACTGATTTCCCACCGGGGACTGGACACAAACAGGAATGTCTGGAGTGGTAACAGCTCTCTTCTTACTCATTAC
TGCAAATTGATTGTCTTTCCCCCCTCCCTCCAGTACCATAATCTTAGAGACAAACCTTAAAACAGCTGTTTTTAGGCTGTTCCTTGTACT
CTTAGGATATTTGAGTCACTTGTGTCAACCACTAAAGTATAGAGAAAAGTGTATTAGATGTGGTTTTTAATTTTGTGTTGCTAAAAAAAG
TGCATGATGGTGAGAGCCCAAGTTATCTTTCCCTCTTCGGTGTTCTTCTTCTCTTCTCTGCAATGCTTCTGTAGCTTCTAATGTTCCCCG
TGGCTAGGCCTTTCCTGCCGAGTGCTCTGATGCAATAGTGGAAATCGCTTATATGTCCTTGGGTTGCTGGTTGGATTAATCTTTAATAAC
AATATATAGAATTGTAGACTGATGTTTTAGCATTTTTCCAACACACACAACGTAAAAATAAAAGCAGTCGACCGCACTTATGGTAATCAG
TTTTGTATAACTTAAAATAATTAAATAAATGAATAAATCCAAAACAAACATGCAGTACTTTTGTTGTATGGGATTGGTGGGCTGATTTAC
ATGTATGGTTACTAAAAAGTACCAGCATGTTAACTTTATTACAATTTGTATTACTTTCTCTGTAGTTCCTAATGGATTCAATTACGGACT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000395090_chr14_60074210_-_2405nt
GGTATAATTTACATATCATAAAGTTAACTTAAAGTAGGTTGTAGTGAGTTTACGCAGCGTGCAAGTCTCACCGCAATCTAGTGTTTTGTT
TATTGTTTTGTTTTTGAAGCAGGATAAATTTTTAAGTAACTGCTACAGAGAGGTCTTGCAGCGCTCCCACCTTCCTGGGAAAATGCTTTG
TTTCTATTTAACAATTTTAACTGAGCTTAGCAGTTCGCGTCTCTTGGTGGGAGTAGATTGCTCCAGTGTACTGTCCGCAGGGGAGCGCTT
TGCTTTCTCTGATTATAGTTCTGAGGCCCTAGCTACTCACTTTGCAAACTCCAGGCTCCGGTCGCGCACGGGACGAACTGCGGGGAGTGA
GCCGCGCGGGCCGCCGTAGTCAGCTGCTAAGAGCAGGAAGAGTCCGAGCGGCGGGCGGAGTCTGCAGGATGGCACCGGACCCCTGGTTCT
CCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATATGAAAGAAAAGGTGAAAAGGCAC
CAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGACTTATTGCTAAGAGCTGTGTCAA
CACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAGAGACTACTTCTGGCATCCTTTA
AGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCACCCAACCCTTGGCTCTTTGAGG
AGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAACAGGACGCAGGCCTTGATGCCC
TTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAATGAGATAATTGACGACCTTGCCA
ACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAGTCAGCCTCTTGTGCTATTGACC
TGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCCCTGACCCAGTTCAGCGTGGTGA
GCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTTTTACAAGCAGTGCAGAAAACCG
ACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAGTACACGGACTGCCTGCAGTTCT
ACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAATTTGCAGTCCTGATGTGGCTCC
TGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACTCTACCTGTAGTGTATGTTAAGC
ACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATTCAGGCTAAAATCCCAGGCGCTA
AGAGGCATGCTGAGTAAACTGATTTCCCACCGGGGACTGGACACAAACAGGAATGTCTGGAGTGGTAACAGCTCTCTTCTTACTCATTAC
TGCAAATTGATTGTCTTTCCCCCCTCCCTCCAGTACCATAATCTTAGAGACAAACCTTAAAACAGCTGTTTTTAGGCTGTTCCTTGTACT
CTTAGGATATTTGAGTCACTTGTGTCAACCACTAAAGTATAGAGAAAAGTGTATTAGATGTGGTTTTTAATTTTGTGTTGCTAAAAAAAG
TGCATGATGGTGAGAGCCCAAGTTATCTTTCCCTCTTCGGTGTTCTTCTTCTCTTCTCTGCAATGCTTCTGTAGCTTCTAATGTTCCCCG
TGGCTAGGCCTTTCCTGCCGAGTGCTCTGATGCAATAGTGGAAATCGCTTATATGTCCTTGGGTTGCTGGTTGGATTAATCTTTAATAAC
AATATATAGAATTGTAGACTGATGTTTTAGCATTTTTCCAACACACACAACGTAAAAATAAAAGCAGTCGACCGCACTTATGGTAATCAG
TTTTGTATAACTTAAAATAATTAAATAAATGAATAAATCCAAAACAAACATGCAGTACTTTTGTTGTATGGGATTGGTGGGCTGATTTAC
ATGTATGGTTACTAAAAAGTACCAGCATGTTAACTTTATTACAATTTGTATTACTTTCTCTGTAGTTCCTAATGGATTCAATTACGGACT

>In-frame_STX8_ENST00000306357_chr17_9281869_-_RTN1_ENST00000342503_chr14_60074210_-_2405nt
GGTATAATTTACATATCATAAAGTTAACTTAAAGTAGGTTGTAGTGAGTTTACGCAGCGTGCAAGTCTCACCGCAATCTAGTGTTTTGTT
TATTGTTTTGTTTTTGAAGCAGGATAAATTTTTAAGTAACTGCTACAGAGAGGTCTTGCAGCGCTCCCACCTTCCTGGGAAAATGCTTTG
TTTCTATTTAACAATTTTAACTGAGCTTAGCAGTTCGCGTCTCTTGGTGGGAGTAGATTGCTCCAGTGTACTGTCCGCAGGGGAGCGCTT
TGCTTTCTCTGATTATAGTTCTGAGGCCCTAGCTACTCACTTTGCAAACTCCAGGCTCCGGTCGCGCACGGGACGAACTGCGGGGAGTGA
GCCGCGCGGGCCGCCGTAGTCAGCTGCTAAGAGCAGGAAGAGTCCGAGCGGCGGGCGGAGTCTGCAGGATGGCACCGGACCCCTGGTTCT
CCACATACGATTCTACTTGTCAAATTGCCCAAGAAATTGCTGAGAAAATTCAACAACGAAATCAATATGAAAGAAAAGGTGAAAAGGCAC
CAAAGCTTACCGTGACAATCAGAGCTTTGTTGCAGAACCTGAAGGAAAAGATCGCCCTTTTGAAGGACTTATTGCTAAGAGCTGTGTCAA
CACATCAGATAACACAGCTTGAAGGGGACCGAAGACAGAACCTCTTGGATGATCTTGTAACTCGAGAGAGACTACTTCTGGCATCCTTTA
AGAATGAGGGTGCCGAACCAGATCTAATCAGGTCCAGCCTGATGAGTGAAGAGGCTAAGCGAGGAGCACCCAACCCTTGGCTCTTTGAGG
AGCCAGAGGAGACCAGAGGCTTGGGTTTTGATGAAATCCGGCAACAGCAGCAGAAAATTATCCAAGAACAGGACGCAGGCCTTGATGCCC
TTTCCTCTATCATAAGTCGCCAAAAACAAATGGGGCAGGAAATTGGGAATGAATTGGATGAACAAAATGAGATAATTGACGACCTTGCCA
ACCTAGTGGAGAACACAGATGAAAAACTTCGCAATGAAACCAGGCGGGTAAACATGGTGGACAGAAAGTCAGCCTCTTGTGCTATTGACC
TGTTGTATTGGCGGGACATCAAGCAGACGGGCATCGTGTTTGGGAGTTTCCTGCTGCTGCTCTTCTCCCTGACCCAGTTCAGCGTGGTGA
GCGTCGTGGCCTACCTGGCCCTGGCCGCACTCTCAGCCACCATCAGTTTCCGCATCTACAAGTCTGTTTTACAAGCAGTGCAGAAAACCG
ACGAAGGCCACCCTTTCAAGGCCTACTTGGAGCTTGAGATCACCCTTTCTCAGGAGCAGATTCAGAAGTACACGGACTGCCTGCAGTTCT
ACGTGAACAGCACACTTAAGGAACTGAGGAGGCTCTTCCTTGTCCAGGACCTGGTGGATTCCTTAAAATTTGCAGTCCTGATGTGGCTCC
TGACCTACGTTGGCGCTCTCTTCAATGGCCTGACCCTGCTGCTCATGGCTGTGGTTTCAATGTTTACTCTACCTGTAGTGTATGTTAAGC
ACCAGGCACAGATTGACCAATATCTGGGACTTGTGAGGACTCACATAAATGCTGTTGTGGCAAAGATTCAGGCTAAAATCCCAGGCGCTA
AGAGGCATGCTGAGTAAACTGATTTCCCACCGGGGACTGGACACAAACAGGAATGTCTGGAGTGGTAACAGCTCTCTTCTTACTCATTAC
TGCAAATTGATTGTCTTTCCCCCCTCCCTCCAGTACCATAATCTTAGAGACAAACCTTAAAACAGCTGTTTTTAGGCTGTTCCTTGTACT
CTTAGGATATTTGAGTCACTTGTGTCAACCACTAAAGTATAGAGAAAAGTGTATTAGATGTGGTTTTTAATTTTGTGTTGCTAAAAAAAG
TGCATGATGGTGAGAGCCCAAGTTATCTTTCCCTCTTCGGTGTTCTTCTTCTCTTCTCTGCAATGCTTCTGTAGCTTCTAATGTTCCCCG
TGGCTAGGCCTTTCCTGCCGAGTGCTCTGATGCAATAGTGGAAATCGCTTATATGTCCTTGGGTTGCTGGTTGGATTAATCTTTAATAAC
AATATATAGAATTGTAGACTGATGTTTTAGCATTTTTCCAACACACACAACGTAAAAATAAAAGCAGTCGACCGCACTTATGGTAATCAG
TTTTGTATAACTTAAAATAATTAAATAAATGAATAAATCCAAAACAAACATGCAGTACTTTTGTTGTATGGGATTGGTGGGCTGATTTAC
ATGTATGGTTACTAAAAAGTACCAGCATGTTAACTTTATTACAATTTGTATTACTTTCTCTGTAGTTCCTAATGGATTCAATTACGGACT


Top

FusionGenePPI for STX8_RTN1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STX8VTI1B, CREB3, NAPA, VTI1A, STX7, VAMP8, HECTD3, NSF, CALM1, ATP6V1B1, CLN8, STX4, VAMP4, VAMP3, VAMP7, STX6, SRPRB, STX12, CLEC12A, STX3, CEP170, NAPG, TMEM171, STX18, DTNBP1, AP2M1, LPAR1, CEP164, TMEM17, TMEM216, ERRFI1, SEC22B, STX11, STXBP6, CLINT1, STAMBPL1, AP1S2, IPPK, GDPD5, ASPH, MED21, MAP7D2, GPR156, TRDN, LMNARTN1BCL2L1, UGCG, FAM160A2, PLEKHF2, HDAC8, SDCBP, RTN4, FGFR1, DYRK2, RTN2, PLSCR1, FAM210B, METTL7A, C4orf32, GYPB, SERPINE2, CYB5R3, TMEM43, TMEM70, SIGMAR1, SLC7A3, TMEM120B, TYMS, ARL6IP5, DERL2, NRAS, FAM213A, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STX8_RTN1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STX8_RTN1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRTN1C0151744Myocardial Ischemia1CTD_human