FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36607

FusionGeneSummary for STRN_HEATR5B

check button Fusion gene summary
Fusion gene informationFusion gene name: STRN_HEATR5B
Fusion gene ID: 36607
HgeneTgene
Gene symbol

STRN

HEATR5B

Gene ID

6801

54497

Gene namestriatinHEAT repeat containing 5B
SynonymsPPP2R6A|SG2NA|STRN1-
Cytomap

2p22.2

2p22.2

Type of geneprotein-codingprotein-coding
Descriptionstriatinprotein phosphatase 2 regulatory subunit B'''alphastriatin, calmodulin binding proteinHEAT repeat-containing protein 5B
Modification date2018052320180523
UniProtAcc

O43815

Q9P2D3

Ensembl transtripts involved in fusion geneENST00000263918, ENST00000379213, 
ENST00000233099, ENST00000354531, 
Fusion gene scores* DoF score5 X 6 X 7=2102 X 3 X 4=24
# samples 84
** MAII scorelog2(8/210*10)=-1.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: STRN [Title/Abstract] AND HEATR5B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCESCTCGA-HM-A6W2-01ASTRNchr2

37193373

-HEATR5Bchr2

37195744

-
TCGARVLUSCTCGA-94-8491-01ASTRNchr2

37096697

-HEATR5Bchr2

37208937

-
TCGARVSARCTCGA-KD-A5QS-01ASTRNchr2

37193373

-HEATR5Bchr2

37216002

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5CDS-intronENST00000263918ENST00000233099STRNchr2

37193373

-HEATR5Bchr2

37195744

-
5CDS-intronENST00000263918ENST00000354531STRNchr2

37193373

-HEATR5Bchr2

37195744

-
5CDS-intronENST00000379213ENST00000233099STRNchr2

37193373

-HEATR5Bchr2

37195744

-
5CDS-intronENST00000379213ENST00000354531STRNchr2

37193373

-HEATR5Bchr2

37195744

-
In-frameENST00000263918ENST00000233099STRNchr2

37096697

-HEATR5Bchr2

37208937

-
In-frameENST00000263918ENST00000354531STRNchr2

37096697

-HEATR5Bchr2

37208937

-
In-frameENST00000379213ENST00000233099STRNchr2

37096697

-HEATR5Bchr2

37208937

-
In-frameENST00000379213ENST00000354531STRNchr2

37096697

-HEATR5Bchr2

37208937

-
In-frameENST00000263918ENST00000233099STRNchr2

37193373

-HEATR5Bchr2

37216002

-
In-frameENST00000263918ENST00000354531STRNchr2

37193373

-HEATR5Bchr2

37216002

-
In-frameENST00000379213ENST00000233099STRNchr2

37193373

-HEATR5Bchr2

37216002

-
In-frameENST00000379213ENST00000354531STRNchr2

37193373

-HEATR5Bchr2

37216002

-

Top

FusionProtFeatures for STRN_HEATR5B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STRN

O43815

HEATR5B

Q9P2D3

Calmodulin-binding protein which may function asscaffolding or signaling protein and may play a role in dendriticCa(2+) signaling.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-111853_120499781Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-111853_120450732Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118149_166499781RegionCalmodulin-binding
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-111855_63499781RegionCaveolin-binding
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118149_166450732RegionCalmodulin-binding
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-111855_63450732RegionCaveolin-binding
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-11855_6378781RegionCaveolin-binding
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-21855_6366732RegionCaveolin-binding
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118461_500499781RepeatNote=WD 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-11853_12078781Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-21853_12066732Coiled coilOntology_term=ECO:0000255
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118149_16678781RegionCalmodulin-binding
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218149_16666732RegionCalmodulin-binding
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118514_553499781RepeatNote=WD 2
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118567_606499781RepeatNote=WD 3
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118662_701499781RepeatNote=WD 4
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118704_743499781RepeatNote=WD 5
HgeneSTRNchr2:37096697chr2:37208937ENST00000263918-1118750_779499781RepeatNote=WD 6
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118461_500450732RepeatNote=WD 1
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118514_553450732RepeatNote=WD 2
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118567_606450732RepeatNote=WD 3
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118662_701450732RepeatNote=WD 4
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118704_743450732RepeatNote=WD 5
HgeneSTRNchr2:37096697chr2:37208937ENST00000379213-1118750_779450732RepeatNote=WD 6
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118461_50078781RepeatNote=WD 1
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118514_55378781RepeatNote=WD 2
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118567_60678781RepeatNote=WD 3
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118662_70178781RepeatNote=WD 4
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118704_74378781RepeatNote=WD 5
HgeneSTRNchr2:37193373chr2:37216002ENST00000263918-118750_77978781RepeatNote=WD 6
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218461_50066732RepeatNote=WD 1
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218514_55366732RepeatNote=WD 2
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218567_60666732RepeatNote=WD 3
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218662_70166732RepeatNote=WD 4
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218704_74366732RepeatNote=WD 5
HgeneSTRNchr2:37193373chr2:37216002ENST00000379213-218750_77966732RepeatNote=WD 6
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000233099-34361062_109919702072RepeatNote=HEAT 2
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000233099-34361290_132719702072RepeatNote=HEAT 3
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000233099-3436848_88519702072RepeatNote=HEAT 1
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000354531-33351062_109918811983RepeatNote=HEAT 2
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000354531-33351290_132718811983RepeatNote=HEAT 3
TgeneHEATR5Bchr2:37096697chr2:37208937ENST00000354531-3335848_88518811983RepeatNote=HEAT 1
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000233099-33361062_109918992072RepeatNote=HEAT 2
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000233099-33361290_132718992072RepeatNote=HEAT 3
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000233099-3336848_88518992072RepeatNote=HEAT 1
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000354531-32351062_109918101983RepeatNote=HEAT 2
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000354531-32351290_132718101983RepeatNote=HEAT 3
TgeneHEATR5Bchr2:37193373chr2:37216002ENST00000354531-3235848_88518101983RepeatNote=HEAT 1


Top

FusionGeneSequence for STRN_HEATR5B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_601aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKG
QENLKKDLVRRIKMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSDEGNETEVQPQQNSQLMWKQGRQLLRQTLQEVGTTDTILDVKS
KRVRALLGFSSDVTDREDDKNQDSVVNGTEAEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKK
ALPDSGEDRDTKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPNRSKLQDMLAN
LRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTTDIANNKDALR
KTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSPATCSFSSHFDILPAG_KFFCLSKFSFQRSS_VCTPEFN

>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_601aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKG
QENLKKDLVRRIKMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSDEGNETEVQPQQNSQLMWKQGRQLLRQTLQEVGTTDTILDVKS
KRVRALLGFSSDVTDREDDKNQDSVVNGTEAEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKK
ALPDSGEDRDTKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPNRSKLQDMLAN
LRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTTDIANNKDALR
KTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSPATCSFSSHFDILPAG_KFFCLSKFSFQRSS_VCTPEFN

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_552aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRI
KMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSDEGNETEVQPQQNSQLMWKQGRQLLRQTLQEVGTTDTILDVKSKRVRALLGFSSD
VTDREDDKNQDSVVNGTEAEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRDTK
EALKEFDFLVTSEEGDNESRSAGDGTDWGPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSF
IMGADEALESELGLGELAGLTVANEADSLTTDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAK
KSPATCSFSSHFDILPAG_KFFCLSKFSFQRSS_VCTPEFNATWTSVSTCFQDSNGGCS_VESASRNCRSSKPSEQS_SGCQTTSPRHTF

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_552aa
MDEQAGPGVFFSNNHPGAGGAKGLGPLAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRI
KMLETALKQERAKYHKLKYGTELNQGDMKPPSTDSDEGNETEVQPQQNSQLMWKQGRQLLRQTLQEVGTTDTILDVKSKRVRALLGFSSD
VTDREDDKNQDSVVNGTEAEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRDTK
EALKEFDFLVTSEEGDNESRSAGDGTDWGPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSF
IMGADEALESELGLGELAGLTVANEADSLTTDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAK
KSPATCSFSSHFDILPAG_KFFCLSKFSFQRSS_VCTPEFNATWTSVSTCFQDSNGGCS_VESASRNCRSSKPSEQS_SGCQTTSPRHTF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_1804nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGAGGCT
GCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGG
GCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGC
CAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAA
TACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAAC
AGCCAGTTAATGTGGAAACAAGGTCGACAACTACTCAGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCT
AAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGATGTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAG
GCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCTGAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCA
GCTGCAGATTTCAGTGATGAAGATGAAGATGATGATGTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAA
GCATTGCCTGACAGCGGTGAAGATCGAGATACAAAAGAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAA
TCTAGAAGTGCAGGCGATGGAACAGACTGGGAAAAGGAAGACCAGTGTCTCATGCCTGAAGCCTGGAATGTGGACCAGGGAGTAATTACC
AAACTCAAGGAACAATACAAAAAGGAGAGAAAGGGGAAAAAGGGGGTGAAGAGGCCCAATAGGTCAAAACTACAAGATATGCTTGCTAAT
TTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGACCCAGCAGCTCCAGGCTTCCTGAACATGAAATT
AATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTCATCATGGGAGCAGATGAAGCCCTTGAAAGTGAA
CTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACTTATGATATAGCAAACAATAAAGATGCATTGAGG
AAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTTGCTTTCCATCCCATTGAGCCTGTTTTGATAACA
GCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAAAAGAGTCCAGCTACTTGCTCTTTTAGTTCCCAC
TTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAAAGATCTTCATGAGTTTGCACTCCAGAATTTAAT
GCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGAGTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGC
AAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTCTGCACCAACAATTAAGCTAAAAACAAGTTTTTT

>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_1804nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGAGGCT
GCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGG
GCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGC
CAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAA
TACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAAC
AGCCAGTTAATGTGGAAACAAGGTCGACAACTACTCAGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCT
AAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGATGTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAG
GCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCTGAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCA
GCTGCAGATTTCAGTGATGAAGATGAAGATGATGATGTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAA
GCATTGCCTGACAGCGGTGAAGATCGAGATACAAAAGAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAA
TCTAGAAGTGCAGGCGATGGAACAGACTGGGAAAAGGAAGACCAGTGTCTCATGCCTGAAGCCTGGAATGTGGACCAGGGAGTAATTACC
AAACTCAAGGAACAATACAAAAAGGAGAGAAAGGGGAAAAAGGGGGTGAAGAGGCCCAATAGGTCAAAACTACAAGATATGCTTGCTAAT
TTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGACCCAGCAGCTCCAGGCTTCCTGAACATGAAATT
AATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTCATCATGGGAGCAGATGAAGCCCTTGAAAGTGAA
CTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACTTATGATATAGCAAACAATAAAGATGCATTGAGG
AAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTTGCTTTCCATCCCATTGAGCCTGTTTTGATAACA
GCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAAAAGAGTCCAGCTACTTGCTCTTTTAGTTCCCAC
TTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAAAGATCTTCATGAGTTTGCACTCCAGAATTTAAT
GCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGAGTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGC
AAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTCTGCACCAACAATTAAGCTAAAAACAAGTTTTTT

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_1657nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTC
AGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGAT
GTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCT
GAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGAT
GTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAA
GAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGGGCCC
AATAGGTCAAAACTACAAGATATGCTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGA
CCCAGCAGCTCCAGGCTTCCTGAACATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTC
ATCATGGGAGCAGATGAAGCCCTTGAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACT
TATGATATAGCAAACAATAAAGATGCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTT
GCTTTCCATCCCATTGAGCCTGTTTTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAA
AAGAGTCCAGCTACTTGCTCTTTTAGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAA
AGATCTTCATGAGTTTGCACTCCAGAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGA
GTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTC

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_1657nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTC
AGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGAT
GTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCT
GAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGAT
GTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAA
GAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGGGCCC
AATAGGTCAAAACTACAAGATATGCTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGA
CCCAGCAGCTCCAGGCTTCCTGAACATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTC
ATCATGGGAGCAGATGAAGCCCTTGAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACT
TATGATATAGCAAACAATAAAGATGCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTT
GCTTTCCATCCCATTGAGCCTGTTTTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAA
AAGAGTCCAGCTACTTGCTCTTTTAGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAA
AGATCTTCATGAGTTTGCACTCCAGAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGA
GTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_2406nt
GCGGCCGCCATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTG
GCGGAGGCTGCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAG
CACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAA
AGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCAC
AAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCA
CAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTCAGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGAT
GTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGATGTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAAT
GGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCTGAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTT
GAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGATGTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTT
AGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAAGAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGA
GACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGAAAAGGAAGACCAGTGTCTCATGCCTGAAGCCTGGAATGTGGACCAGGGA
GTAATTACCAAACTCAAGGAACAATACAAAAAGGAGAGAAAGGGGAAAAAGGGGGTGAAGAGGCCCAATAGGTCAAAACTACAAGATATG
CTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGACCCAGCAGCTCCAGGCTTCCTGAA
CATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTCATCATGGGAGCAGATGAAGCCCTT
GAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACTTATGATATAGCAAACAATAAAGAT
GCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTTGCTTTCCATCCCATTGAGCCTGTT
TTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAAAAGAGTCCAGCTACTTGCTCTTTT
AGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAAAGATCTTCATGAGTTTGCACTCCA
GAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGAGTTGAAAGTGCGTCTAGAAACTGC
CGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTCTGCACCAACAATTAAGCTAAAAAC
AAGTTTTTTTTAATTTGTAATTTCATTTATTTGTATTTATGTTGTCAACTAGCCCCTAATTAGTGATGGCCACTGTATCATTCCAGGCTA
CCTATGGGTTCTGTTTTATTTGTATATTGGTATTATAGTGCTTCCAAGTAGGTTAAGTGAAATAATGCTCACACCACTTATTGATTTTTA
AGGAGTGATTTTTTTTATCATGTGGTGAATATGTTTTCATTTTCCTCCTAATAATGTTTCTCTTTTGTTAACTTATTTATTTTTCAAACA
CTGAGCCATAGTCTTAAATTTAAATGCTAAAAACAATTGTATCATGTAGTCGGGCAGCCTATTGATACTGTCAGGGGAAAAAAATGGGTC
AGAACTCAGCATCTGTCATGAAAAAAATCAATTGAAAAACAAGCAGATTTTAAATTTTGAAGTAATCAAAATAATGGAAAGTGTCTGTTT
TGTGGTGTATATACTATGAATAAAATCACAGCATTTTCTAAGCATTTCCCAAAATGTCCTTATCTTTCTGATGGATCTTTTAGCTTTCAT

>In-frame_STRN_ENST00000263918_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_2293nt
GCGGCCGCCATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTG
GCGGAGGCTGCCGCGGCCGGCGACGGGGCGGCTGCGGCGGGGGCGGCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAG
CACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTGGAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAA
AGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATCAAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCAC
AAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCTCCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCA
CAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTCAGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGAT
GTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGATGTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAAT
GGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCTGAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTT
GAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGATGTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTT
AGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAAGAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGA
GACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGAAAAGGAAGACCAGTGTCTCATGCCTGAAGCCTGGAATGTGGACCAGGGA
GTAATTACCAAACTCAAGGAACAATACAAAAAGGAGAGAAAGGGGAAAAAGGGGGTGAAGAGGCCCAATAGGTCAAAACTACAAGATATG
CTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGACCCAGCAGCTCCAGGCTTCCTGAA
CATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTCATCATGGGAGCAGATGAAGCCCTT
GAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACTTATGATATAGCAAACAATAAAGAT
GCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTTGCTTTCCATCCCATTGAGCCTGTT
TTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAAAAGAGTCCAGCTACTTGCTCTTTT
AGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAAAGATCTTCATGAGTTTGCACTCCA
GAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGAGTTGAAAGTGCGTCTAGAAACTGC
CGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTCTGCACCAACAATTAAGCTAAAAAC
AAGTTTTTTTTAATTTGTAATTTCATTTATTTGTATTTATGTTGTCAACTAGCCCCTAATTAGTGATGGCCACTGTATCATTCCAGGCTA
CCTATGGGTTCTGTTTTATTTGTATATTGGTATTATAGTGCTTCCAAGTAGGTTAAGTGAAATAATGCTCACACCACTTATTGATTTTTA
AGGAGTGATTTTTTTTATCATGTGGTGAATATGTTTTCATTTTCCTCCTAATAATGTTTCTCTTTTGTTAACTTATTTATTTTTCAAACA
CTGAGCCATAGTCTTAAATTTAAATGCTAAAAACAATTGTATCATGTAGTCGGGCAGCCTATTGATACTGTCAGGGGAAAAAAATGGGTC
AGAACTCAGCATCTGTCATGAAAAAAATCAATTGAAAAACAAGCAGATTTTAAATTTTGAAGTAATCAAAATAATGGAAAGTGTCTGTTT

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000233099_chr2_37208937_-_2250nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTC
AGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGAT
GTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCT
GAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGAT
GTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAA
GAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGGGCCC
AATAGGTCAAAACTACAAGATATGCTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGA
CCCAGCAGCTCCAGGCTTCCTGAACATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTC
ATCATGGGAGCAGATGAAGCCCTTGAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACT
TATGATATAGCAAACAATAAAGATGCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTT
GCTTTCCATCCCATTGAGCCTGTTTTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAA
AAGAGTCCAGCTACTTGCTCTTTTAGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAA
AGATCTTCATGAGTTTGCACTCCAGAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGA
GTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTC
TGCACCAACAATTAAGCTAAAAACAAGTTTTTTTTAATTTGTAATTTCATTTATTTGTATTTATGTTGTCAACTAGCCCCTAATTAGTGA
TGGCCACTGTATCATTCCAGGCTACCTATGGGTTCTGTTTTATTTGTATATTGGTATTATAGTGCTTCCAAGTAGGTTAAGTGAAATAAT
GCTCACACCACTTATTGATTTTTAAGGAGTGATTTTTTTTATCATGTGGTGAATATGTTTTCATTTTCCTCCTAATAATGTTTCTCTTTT
GTTAACTTATTTATTTTTCAAACACTGAGCCATAGTCTTAAATTTAAATGCTAAAAACAATTGTATCATGTAGTCGGGCAGCCTATTGAT
ACTGTCAGGGGAAAAAAATGGGTCAGAACTCAGCATCTGTCATGAAAAAAATCAATTGAAAAACAAGCAGATTTTAAATTTTGAAGTAAT
CAAAATAATGGAAAGTGTCTGTTTTGTGGTGTATATACTATGAATAAAATCACAGCATTTTCTAAGCATTTCCCAAAATGTCCTTATCTT
TCTGATGGATCTTTTAGCTTTCATATCAAATTACTAAATTATGCTATGTATATTTTAGTTGGTAACAATTAAAATTCTCATTTAAAGGTT

>In-frame_STRN_ENST00000379213_chr2_37096697_-_HEATR5B_ENST00000354531_chr2_37208937_-_2137nt
ATGGACGAGCAGGCGGGTCCCGGCGTCTTCTTCAGCAACAACCACCCGGGCGCCGGCGGTGCCAAGGGGCTCGGGCCTCTGGCGGGGGCG
GCCCGAGCCCAGTACAGTCTCCCGGGGATCCTGCACTTCCTGCAGCACGAGTGGGCCCGCTTCGAGGTGGAGAGAGCCCAGTGGGAGGTG
GAGCGGGCGGAGCTGCAGGCCCAGATTGCCTTCCTGCAGGGAGAAAGGAAGGGCCAAGAAAATTTGAAGAAGGATCTTGTGAGGAGGATC
AAAATGTTGGAGTATGCTCTTAAACAGGAAAGAGCCAAATACCACAAGTTGAAATACGGGACAGAATTGAATCAGGGAGATATGAAGCCT
CCAAGCTATGATTCTGATGAAGGTAATGAAACAGAAGTGCAGCCACAACAAAACAGCCAGTTAATGTGGAAACAAGGTCGACAACTACTC
AGACAGTATCTACAGGAGGTGGGTTATACAGATACTATTCTAGATGTGAAATCTAAACGAGTGCGAGCTTTGTTGGGCTTTTCAAGTGAT
GTCACGGACAGGGAAGATGACAAAAATCAGGACTCAGTTGTAAATGGCACAGAGGCTGAAGTTAAAGAGACAGCAATGATTGCAAAATCT
GAGTTAACAGATTCTGCCTCCGTGCTGGATAATTTCAAATTCCTTGAAAGTGCAGCTGCAGATTTCAGTGATGAAGATGAAGATGATGAT
GTTGATGGAAGAGAGAAAAGCGTCATTGATACTTCAACAATTGTTAGGAAAAAAGCATTGCCTGACAGCGGTGAAGATCGAGATACAAAA
GAAGCTCTAAAGGAGTTTGACTTCTTGGTTACATCAGAGGAAGGAGACAATGAATCTAGAAGTGCAGGCGATGGAACAGACTGGGGGCCC
AATAGGTCAAAACTACAAGATATGCTTGCTAATTTGAGAGATGTTGATGAACTTCCTTCATTGCAGCCATCTGTGGGTTCACCTTCCAGA
CCCAGCAGCTCCAGGCTTCCTGAACATGAAATTAATAGGGCAGATGAAGTGGAAGCATTGACATTTCCTCCTTCTTCTGGAAAGTCATTC
ATCATGGGAGCAGATGAAGCCCTTGAAAGTGAACTGGGACTTGGAGAACTAGCAGGCCTTACGGTGGCCAATGAAGCAGACTCACTAACT
TATGATATAGCAAACAATAAAGATGCATTGAGGAAGACATGGAACCCTAAGTTTACATTGAGAAGTCACTTTGATGGCATCCGAGCCCTT
GCTTTCCATCCCATTGAGCCTGTTTTGATAACAGCATCAGAGGATCACACATTAAAAATGTGGAATTTACAGAAAACAGCCCCAGCCAAA
AAGAGTCCAGCTACTTGCTCTTTTAGTTCCCACTTTGATATCTTACCTGCTGGATGAAAATTCTTTTGCCTCAGCAAGTTCAGCTTCCAA
AGATCTTCATGAGTTTGCACTCCAGAATTTAATGCATATTGGACCTCTGTATCCACATGCTTTCAAGACAGTAATGGGGGCTGCTCCTGA
GTTGAAAGTGCGTCTAGAAACTGCCGTTCGAGCAAGCCAAGCGAGCAAAGCTAAAGCGGCTGCCAGACAACCAGCCCCCGCCATACATTC
TGCACCAACAATTAAGCTAAAAACAAGTTTTTTTTAATTTGTAATTTCATTTATTTGTATTTATGTTGTCAACTAGCCCCTAATTAGTGA
TGGCCACTGTATCATTCCAGGCTACCTATGGGTTCTGTTTTATTTGTATATTGGTATTATAGTGCTTCCAAGTAGGTTAAGTGAAATAAT
GCTCACACCACTTATTGATTTTTAAGGAGTGATTTTTTTTATCATGTGGTGAATATGTTTTCATTTTCCTCCTAATAATGTTTCTCTTTT
GTTAACTTATTTATTTTTCAAACACTGAGCCATAGTCTTAAATTTAAATGCTAAAAACAATTGTATCATGTAGTCGGGCAGCCTATTGAT
ACTGTCAGGGGAAAAAAATGGGTCAGAACTCAGCATCTGTCATGAAAAAAATCAATTGAAAAACAAGCAGATTTTAAATTTTGAAGTAAT


Top

FusionGenePPI for STRN_HEATR5B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STRNSTK24, MCC, CTTNBP2, CTTNBP2NL, STRIP1, MOB4, PDCD10, PPP2CA, PPP2R1A, STK26, SIKE1, STK25, STRN3, PPP2R1B, STRN4, STRIP2, SLMAP, CCT2, CCT8, CCT3, TCP1, CCT5, FGFR1OP2, CCT6A, CCT7, CCT4, CCT6B, TRAF3IP3, PPP2CB, ZRANB1, ELAVL1, LNX1, APC, TJP1, DDX1, DYNC1H1, CPSF6, EIF2S1, SF3B5, BRCA1, ECT2, PAXIP1, STK3, STK4, TFIP11, RINT1, PCOLCE2, LYPD3, NR1H3, PPP2R2C, RASSF3, PGAM5, NTRK1, HSPB1, DYNLL1, MAP4K4, EEF1E1, BAG2, SLC43A3, AHNAK, PRDM14, TNFRSF1A, NHSL2, PSMC5, PLP1, ZNF550, SNX24, LRRCC1, ZNF331, PRPF19, SPINK2, EXOC1, PKN3, NCKAP5L, TFPT, CCHCR1, YEATS4, TUFT1, RABGAP1L, GOLGA5HEATR5BELAVL1, CCDC8, MLF1, AP1M2, VAPB, AURKA, NTRK1, XPO1, AP1S2, VAPA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STRN_HEATR5B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STRN_HEATR5B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource