FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36478

FusionGeneSummary for STK11_BSG

check button Fusion gene summary
Fusion gene informationFusion gene name: STK11_BSG
Fusion gene ID: 36478
HgeneTgene
Gene symbol

STK11

BSG

Gene ID

6794

682

Gene nameserine/threonine kinase 11basigin (Ok blood group)
SynonymsLKB1|PJS|hLKB15F7|CD147|EMMPRIN|EMPRIN|OK|TCSF
Cytomap

19p13.3

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionserine/threonine-protein kinase STK11liver kinase B1polarization-related protein LKB1renal carcinoma antigen NY-REN-19serine/threonine-protein kinase 11serine/threonine-protein kinase LKB1basiginOK blood group antigencollagenase stimulatory factorextracellular matrix metalloproteinase inducerleukocyte activation antigen M6tumor cell-derived collagenase stimulatory factor
Modification date2018052220180522
UniProtAcc

Q15831

P35613

Ensembl transtripts involved in fusion geneENST00000585748, ENST00000326873, 
ENST00000346916, ENST00000545507, 
ENST00000333511, ENST00000353555, 
ENST00000574970, 
Fusion gene scores* DoF score9 X 2 X 5=904 X 7 X 3=84
# samples 910
** MAII scorelog2(9/90*10)=0log2(10/84*10)=0.251538766995964
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: STK11 [Title/Abstract] AND BSG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSTK11

GO:0006468

protein phosphorylation

12805220|25329316

HgeneSTK11

GO:0007050

cell cycle arrest

12805220|17216128

HgeneSTK11

GO:0046777

protein autophosphorylation

11430832

HgeneSTK11

GO:0071493

cellular response to UV-B

25329316

HgeneSTK11

GO:0072332

intrinsic apoptotic signaling pathway by p53 class mediator

11430832


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSTADTCGA-BR-8289-01ASTK11chr19

1207202

+BSGchr19

580379

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000585748ENST00000346916STK11chr19

1207202

+BSGchr19

580379

+
intron-5UTRENST00000585748ENST00000545507STK11chr19

1207202

+BSGchr19

580379

+
intron-5UTRENST00000585748ENST00000333511STK11chr19

1207202

+BSGchr19

580379

+
intron-5UTRENST00000585748ENST00000353555STK11chr19

1207202

+BSGchr19

580379

+
intron-intronENST00000585748ENST00000574970STK11chr19

1207202

+BSGchr19

580379

+
In-frameENST00000326873ENST00000346916STK11chr19

1207202

+BSGchr19

580379

+
5CDS-5UTRENST00000326873ENST00000545507STK11chr19

1207202

+BSGchr19

580379

+
5CDS-5UTRENST00000326873ENST00000333511STK11chr19

1207202

+BSGchr19

580379

+
5CDS-5UTRENST00000326873ENST00000353555STK11chr19

1207202

+BSGchr19

580379

+
5CDS-intronENST00000326873ENST00000574970STK11chr19

1207202

+BSGchr19

580379

+

Top

FusionProtFeatures for STK11_BSG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
STK11

Q15831

BSG

P35613

Tumor suppressor serine/threonine-protein kinase thatcontrols the activity of AMP-activated protein kinase (AMPK)family members, thereby playing a role in various processes suchas cell metabolism, cell polarity, apoptosis and DNA damageresponse. Acts by phosphorylating the T-loop of AMPK familyproteins, thus promoting their activity: phosphorylates PRKAA1,PRKAA2, BRSK1, BRSK2, MARK1, MARK2, MARK3, MARK4, NUAK1, NUAK2,SIK1, SIK2, SIK3 and SNRK but not MELK. Also phosphorylates non-AMPK family proteins such as STRADA, PTEN and possibly p53/TP53.Acts as a key upstream regulator of AMPK by mediatingphosphorylation and activation of AMPK catalytic subunits PRKAA1and PRKAA2 and thereby regulates processes including: inhibitionof signaling pathways that promote cell growth and proliferationwhen energy levels are low, glucose homeostasis in liver,activation of autophagy when cells undergo nutrient deprivation,and B-cell differentiation in the germinal center in response toDNA damage. Also acts as a regulator of cellular polarity byremodeling the actin cytoskeleton. Required for cortical neuronpolarization by mediating phosphorylation and activation of BRSK1and BRSK2, leading to axon initiation and specification. Involvedin DNA damage response: interacts with p53/TP53 and recruited tothe CDKN1A/WAF1 promoter to participate in transcriptionactivation. Able to phosphorylate p53/TP53; the relevance of suchresult in vivo is however unclear and phosphorylation may beindirect and mediated by downstream STK11/LKB1 kinase NUAK1. Alsoacts as a mediator of p53/TP53-dependent apoptosis via interactionwith p53/TP53: translocates to the mitochondrion during apoptosisand regulates p53/TP53-dependent apoptosis pathways. In veinendothelial cells, inhibits PI3K/Akt signaling activity and thusinduces apoptosis in response to the oxidant peroxynitrite (invitro). Regulates UV radiation-induced DNA damage responsemediated by CDKN1A. In association with NUAK1, phosphorylatesCDKN1A in response to UV radiation and contributes to itsdegradation which is necessary for optimal DNA repair(PubMed:25329316). {ECO:0000269|PubMed:11430832,ECO:0000269|PubMed:12805220, ECO:0000269|PubMed:14517248,ECO:0000269|PubMed:14976552, ECO:0000269|PubMed:15016379,ECO:0000269|PubMed:15733851, ECO:0000269|PubMed:15987703,ECO:0000269|PubMed:17108107, ECO:0000269|PubMed:18321849,ECO:0000269|PubMed:21317932, ECO:0000269|PubMed:25329316}. Isoform 2: Has a role in spermiogenesis. {ECO:0000250}. Plays an important role in targeting the monocarboxylatetransporters SLC16A1, SLC16A3, SLC16A8 and SLC16A11 to the plasmamembrane. Plays pivotal roles in spermatogenesis, embryoimplantation, neural network formation and tumor progression.Stimulates adjacent fibroblasts to produce matrixmetalloproteinases (MMPS). Seems to be a receptor foroligomannosidic glycans. In vitro, promotes outgrowth ofastrocytic processes. {ECO:0000269|PubMed:17127621,ECO:0000269|PubMed:28666119}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for STK11_BSG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_STK11_ENST00000326873_chr19_1207202_+_BSG_ENST00000346916_chr19_580379_+_292aa
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPN
GEANVKKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRF
FVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDAGSAP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_STK11_ENST00000326873_chr19_1207202_+_BSG_ENST00000346916_chr19_580379_+_876nt
ATGGAGGTGGTGGACCCGCAGCAGCTGGGCATGTTCACGGAGGGCGAGCTGATGTCGGTGGGTATGGACACGTTCATCCACCGCATCGAC
TCCACCGAGGTCATCTACCAGCCGCGCCGCAAGCGGGCCAAGCTCATCGGCAAGTACCTGATGGGGGACCTGCTGGGGGAAGGCTCTTAC
GGCAAGGTGAAGGAGGTGCTGGACTCGGAGACGCTGTGCAGGAGGGCCGTCAAGATCCTCAAGAAGAAGAAGTTGCGAAGGATCCCCAAC
GGGGAGGCCAACGTGAAGAAGGTGGACTCCGACGACCAGTGGGGAGAGTACTCCTGCGTCTTCCTCCCCGAGCCCATGGGCACGGCCAAC
ATCCAGCTCCACGGGCCTCCCAGAGTGAAGGCTGTGAAGTCGTCAGAACACATCAACGAGGGGGAGACGGCCATGCTGGTCTGCAAGTCA
GAGTCCGTGCCACCTGTCACTGACTGGGCCTGGTACAAGATCACTGACTCTGAGGACAAGGCCCTCATGAACGGCTCCGAGAGCAGGTTC
TTCGTGAGTTCCTCGCAGGGCCGGTCAGAGCTACACATTGAGAACCTGAACATGGAGGCCGACCCCGGCCAGTACCGGTGCAACGGCACC
AGCTCCAAGGGCTCCGACCAGGCCATCATCACGCTCCGCGTGCGCAGCCACCTGGCCGCCCTCTGGCCCTTCCTGGGCATCGTGGCTGAG
GTGCTGGTGCTGGTCACCATCATCTTCATCTACGAGAAGCGCCGGAAGCCCGAGGACGTCCTGGATGATGACGACGCCGGCTCTGCACCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_STK11_ENST00000326873_chr19_1207202_+_BSG_ENST00000346916_chr19_580379_+_2798nt
GGCGTGCGGTGTCCGCGGCGGCGCAGGGAGGGGGAGGGAGGTAAACAAGATGGCGGCGGCGTGTCGGGCGCGGAAGGGGGAGGCGGCCCG
GGGCGCCCGCGAGTGAGGCGCGGGGCGGCGAAGGGAGCGCGGGTGGCGGCACTTGCTGCCGCGGCCTTGGATGGGCTGGGCCCCCCTCGC
CGCTCCGCCTCCTCCACACGCGCGGCGGCCGCGGCGAGGGGGACGCGCCGCCCGGGGCCCGGCACCTTCGGGAACCCCCCGGCCCGGAGC
CTGCGGCCTGCGCCGCCTCGGCCGCCGGGAGCCCCGTGGAGCCCCCGCCGCCGCGCCGCCCCGCGGACCGGACGCTGAGGGCACTCGGGG
CGGGGCGCGCGCTCGGGCAGACGTTTGCGGGGAGGGGGGCGCCTGCCGGGCCCCGGCGACCACCTTGGGGGTCGCGGGCCGGCTCGGGGG
GCGCCCAGTGCGGGCCCTCGCGGGCGCCGGGCAGCGACCAGCCCTGAGCGGAGCTGTTGGCCGCGGCGGGAGGCCTCCCGGACGCCCCCA
GCCCCCCGAACGCTCGCCCGGGCCGGCGGGAGTCGGCGCCCCCCGGGAGGTCCGCTCGGTCGTCCGCGGCGGAGCGTTTGCTCCTGGGAC
AGGCGGTGGGACCGGGGCGTCGCCGGAGACGCCCCCAGCGAAGTTGGGCTCTCCAGGTGTGGGGGTCCCGGGGGGTAGCGACGTCGCGGA
CCCGGCCTGTGGGATGGGCGGCCCGGAGAAGACTGCGCTCGGCCGTGTTCATACTTGTCCGTGGGCCTGAGGTCCCCGGAGGATGACCTA
GCACTGAAAAGCCCCGGCCGGCCTCCCCAGGGTCCCCGAGGACGAAGTTGACCCTGACCGGGCCGTCTCCCAGTTCTGAGGCCCGGGTCC
CACTGGAACTCGCGTCTGAGCCGCCGTCCCGGACCCCCGGTGCCCGCCGGTCCGCAGACCCTGCACCGGGCTTGGACTCGCAGCCGGGAC
TGACGTGTAGAACAATCGTTTCTGTTGGAAGAAGGGTTTTTCCCTTCCTTTTGGGGTTTTTGTTGCCTTTTTTTTTTCTTTTTTCTTTGT
AAAATTTTGGAGAAGGGAAGTCGGAACACAAGGAAGGACCGCTCACCCGCGGACTCAGGGCTGGCGGCGGGACTCCAGGACCCTGGGTCC
AGCATGGAGGTGGTGGACCCGCAGCAGCTGGGCATGTTCACGGAGGGCGAGCTGATGTCGGTGGGTATGGACACGTTCATCCACCGCATC
GACTCCACCGAGGTCATCTACCAGCCGCGCCGCAAGCGGGCCAAGCTCATCGGCAAGTACCTGATGGGGGACCTGCTGGGGGAAGGCTCT
TACGGCAAGGTGAAGGAGGTGCTGGACTCGGAGACGCTGTGCAGGAGGGCCGTCAAGATCCTCAAGAAGAAGAAGTTGCGAAGGATCCCC
AACGGGGAGGCCAACGTGAAGAAGGTGGACTCCGACGACCAGTGGGGAGAGTACTCCTGCGTCTTCCTCCCCGAGCCCATGGGCACGGCC
AACATCCAGCTCCACGGGCCTCCCAGAGTGAAGGCTGTGAAGTCGTCAGAACACATCAACGAGGGGGAGACGGCCATGCTGGTCTGCAAG
TCAGAGTCCGTGCCACCTGTCACTGACTGGGCCTGGTACAAGATCACTGACTCTGAGGACAAGGCCCTCATGAACGGCTCCGAGAGCAGG
TTCTTCGTGAGTTCCTCGCAGGGCCGGTCAGAGCTACACATTGAGAACCTGAACATGGAGGCCGACCCCGGCCAGTACCGGTGCAACGGC
ACCAGCTCCAAGGGCTCCGACCAGGCCATCATCACGCTCCGCGTGCGCAGCCACCTGGCCGCCCTCTGGCCCTTCCTGGGCATCGTGGCT
GAGGTGCTGGTGCTGGTCACCATCATCTTCATCTACGAGAAGCGCCGGAAGCCCGAGGACGTCCTGGATGATGACGACGCCGGCTCTGCA
CCCCTGAAGAGCAGCGGGCAGCACCAGAATGACAAAGGCAAGAACGTCCGCCAGAGGAACTCTTCCTGAGGCAGGTGGCCCGAGGACGCT
CCCTGCTCCACGTCTGCGCCGCCGCCGGAGTCCACTCCCAGTGCTTGCAAGATTCCAAGTTCTCACCTCTTAAAGAAAACCCACCCCGTA
GATTCCCATCATACACTTCCTTCTTTTTTAAAAAAGTTGGGTTTTCTCCATTCAGGATTCTGTTCCTTAGGTTTTTTTCCTTCTGAAGTG
TTTCACGAGAGCCCGGGAGCTGCTGCCCTGCGGCCCCGTCTGTGGCTTTCAGCCTCTGGGTCTGAGTCATGGCCGGGTGGGCGGCACAGC
CTTCTCCACTGGCCGGAGTCAGTGCCAGGTCCTTGCCCTTTGTGGAAAGTCACAGGTCACACGAGGGGCCCCGTGTCCTGCCTGTCTGAA
GCCAATGCTGTCTGGTTGCGCCATTTTTGTGCTTTTATGTTTAATTTTATGAGGGCCACGGGTCTGTGTTCGACTCAGCCTCAGGGACGA
CTCTGACCTCTTGGCCACAGAGGACTCACTTGCCCACACCGAGGGCGACCCCGTCACAGCCTCAAGTCACTCCCAAGCCCCCTCCTTGTC
TGTGCATCCGGGGGCAGCTCTGGAGGGGGTTTGCTGGGGAACTGGCGCCATCGCCGGGACTCCAGAACCGCAGAAGCCTCCCCAGCTCAC
CCCTGGAGGACGGCCGGCTCTCTATAGCACCAGGGCTCACGTGGGAACCCCCCTCCCACCCACCGCCACAATAAAGATCGCCCCCACCTC


Top

FusionGenePPI for STK11_BSG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
STK11CAB39, STRADA, SMARCA4, STK11IP, TP53, WDR48, FKBP5, STRADB, CAB39L, CDC37, HSP90AA1, MARK4, HSPA1A, RPAP3, USP11, LIMS1, KIF23, SMARCC1, GSK3B, MARK2, SIK1, STUB1, UBE2D2, TNIP2, APP, SNRK, AP2M1, EIF2B1, ETV4, TP63, SIRT1, PRKAA1, SPDEF, MAPRE1, CCDC136, COPS3, COPS4, H2AFX, WDR6, BCAS3, CYP17A1, KLK7, LYPD3, NAT2, RHOBTB2, S100A14, SERPINB5, ST14, THRSP, TRIM25, PRSS50, ADIPOR1, ARG2, CALM2, CFL2, CRY2, CTSB, D2HGDH, EEF1A2, ERLEC1, FAIM2, GNPDA1, ND2, MOCS2, PDXP, PHF23, PLD3, SEPT9, STK24, THOP1, TSG101, TUBA1A, TUBB4A, VPS72, TBC1D23, RPS6KB1, PRKAA2, HERC2, KDM4A, HSP90AA4P, HSP90AB3P, PIP4K2A, HSP90AB4P, C5orf24, HSP90AA5P, HSP90AB1, FAM175B, DVL2, IVD, NEMF, CSNK2A1, MAP2K1BSGPDLIM7, RFXANK, RANBP3, ATXN10, MMP1, SLC16A4, SLC16A1, HGS, USP50, PCK1, VHL, SLC2A4, CUL3, CAND1, PPIL2, OS9, SEL1L, SYVN1, VCP, ATF2, FLNA, ATP4A, FBXO6, ASB1, ASB5, ATP2B4, PRPF8, MDN1, INTS5, ATR, C16orf62, FANCA, EXOC4, CCDC132, TARBP1, GPD1L, INTS12, TELO2, DNM3, MYBBP1A, ATM, ZW10, LARS2, HEATR6, NOP56, DDX23, TBRG4, MTOR, IPO8, DNAAF5, PDS5B, EXOC3, RINT1, IPO11, AGPAT5, VPS52, FAM162A, XPO4, KIAA0368, SLC25A24, PDS5A, C3orf33, HSPA12B, HSPA12A, DDC, TBCD, COG2, EXOC1, COG3, NOP9, VPS51, COG7, GNPAT, STEAP3, FASTKD1, ACAD10, EDC4, IQCB1, EARS2, FASTKD3, KNTC1, MTX1, NLRX1, COG1, SYMPK, DYNC2LI1, TTC28, XPO7, COG4, RAD51C, FAM118B, UFL1, COMMD3, COG8, METAP2, GCFC2, COG5, METTL15, PARL, SAMD1, SLC25A30, ABCD1, RSAD1, C19orf25, PTPMT1, GNL3L, MAP2K7, VPS53, BTAF1, CAND2, GCN1L1, UTP20, TTI2, PRPF6, EXOC2, VAC14, LGALS3, NTRK1, SLC3A2, EWSR1, MAD2L1, NCSTN, APOL2, TUBA1C, OTUB1, TRAF6, CRBN, CDH1, CTDSP2, SUGCT, CLASP1, DSTYK, RIF1, CDYL, UBC, CYLD, HSD17B10, SOAT1, VDAC1, TRIM25, RING1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for STK11_BSG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for STK11_BSG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSTK11C0031269Peutz-Jeghers Syndrome7CTD_human;ORPHANET;UNIPROT
HgeneSTK11C1336708Testicular Germ Cell Tumor3CTD_human;UNIPROT
HgeneSTK11C0001418Adenocarcinoma1CTD_human
HgeneSTK11C0007137Squamous cell carcinoma1CTD_human
HgeneSTK11C0020538Hypertensive disease1CTD_human
HgeneSTK11C0024121Lung Neoplasms1CTD_human
HgeneSTK11C0030297Pancreatic Neoplasm1CTD_human;HPO
HgeneSTK11C0149721Left Ventricular Hypertrophy1CTD_human
HgeneSTK11C0152013Adenocarcinoma of lung (disorder)1CTD_human
HgeneSTK11C1257915Intestinal Polyposis1CTD_human
TgeneBSGC0027626Neoplasm Invasiveness1CTD_human
TgeneBSGC0027627Neoplasm Metastasis1CTD_human
TgeneBSGC0027659Neoplasms, Experimental1CTD_human
TgeneBSGC0036341Schizophrenia1PSYGENET
TgeneBSGC1862939AMYOTROPHIC LATERAL SCLEROSIS 11CTD_human
TgeneBSGC2936350Plaque, Atherosclerotic1CTD_human