FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3639

FusionGeneSummary for AVEN_SCG5

check button Fusion gene summary
Fusion gene informationFusion gene name: AVEN_SCG5
Fusion gene ID: 3639
HgeneTgene
Gene symbol

AVEN

SCG5

Gene ID

57099

6447

Gene nameapoptosis and caspase activation inhibitorsecretogranin V
SynonymsPDCD127B2|P7B2|SGNE1|SgV
Cytomap

15q14

15q13.3

Type of geneprotein-codingprotein-coding
Descriptioncell death regulator Avenapoptosis, caspase activation inhibitorprogrammed cell death 12neuroendocrine protein 7B2pituitary polypeptideprohormone convertase chaperonesecretogranin-5secretory granule endocrine protein Isecretory granule, neuroendocrine protein 1 (7B2 protein)
Modification date2018051920180519
UniProtAcc

Q9NQS1

P05408

Ensembl transtripts involved in fusion geneENST00000306730, ENST00000558136, 
ENST00000413748, ENST00000300175, 
ENST00000494364, ENST00000497208, 
ENST00000498069, 
Fusion gene scores* DoF score2 X 1 X 2=43 X 1 X 3=9
# samples 23
** MAII scorelog2(2/4*10)=2.32192809488736log2(3/9*10)=1.73696559416621
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: AVEN [Title/Abstract] AND SCG5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAVEN

GO:0043066

negative regulation of apoptotic process

10949025


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDUCECTCGA-AJ-A2QM-01AAVENchr15

34295233

-SCG5chr15

32971967

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000306730ENST00000413748AVENchr15

34295233

-SCG5chr15

32971967

+
In-frameENST00000306730ENST00000300175AVENchr15

34295233

-SCG5chr15

32971967

+
In-frameENST00000306730ENST00000494364AVENchr15

34295233

-SCG5chr15

32971967

+
In-frameENST00000306730ENST00000497208AVENchr15

34295233

-SCG5chr15

32971967

+
5CDS-3UTRENST00000306730ENST00000498069AVENchr15

34295233

-SCG5chr15

32971967

+
intron-3CDSENST00000558136ENST00000413748AVENchr15

34295233

-SCG5chr15

32971967

+
intron-3CDSENST00000558136ENST00000300175AVENchr15

34295233

-SCG5chr15

32971967

+
intron-3CDSENST00000558136ENST00000494364AVENchr15

34295233

-SCG5chr15

32971967

+
intron-3CDSENST00000558136ENST00000497208AVENchr15

34295233

-SCG5chr15

32971967

+
intron-3UTRENST00000558136ENST00000498069AVENchr15

34295233

-SCG5chr15

32971967

+

Top

FusionProtFeatures for AVEN_SCG5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AVEN

Q9NQS1

SCG5

P05408

Protects against apoptosis mediated by Apaf-1. Acts as a molecular chaperone for PCSK2/PC2, preventingits premature activation in the regulated secretory pathway. Bindsto inactive PCSK2 in the endoplasmic reticulum and facilitates itstransport from there to later compartments of the secretorypathway where it is proteolytically matured and activated. Alsorequired for cleavage of PCSK2 but does not appear to be involvedin its folding. Plays a role in regulating pituitary hormonesecretion. The C-terminal peptide inhibits PCSK2 in vitro.{ECO:0000269|PubMed:7913882}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAVENchr15:34295233chr15:32971967ENST00000306730-265_85148363Compositional biasNote=Ala/Gly-rich

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for AVEN_SCG5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000413748_chr15_32971967_+_285aa
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPV
EDDSDAETTGEENDEQGNTSKRKIVSNWDRTQDIEKEVNNESGESQRGTDFSVLLSSAGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDF
SEDQGYPDPPNPCPVGKTDDGCLENTPDTAEFSREFQLHQHLFDPEHDTPGLGKWNKKLLYEKMKGGERRKRRSVNPTLQGQRLDNVVAK

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000300175_chr15_32971967_+_286aa
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPV
EDDSDAETTGEENDEQGNTSKRKIVSNWDRTQDIEKEVNNESGESQRGTDFSVLLSSAGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDF
SEDQGYPDPPNPCPVGKTADDGCLENTPDTAEFSREFQLHQHLFDPEHDTPGLGKWNKKLLYEKMKGGERRKRRSVNPTLQGQRLDNVVA

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000494364_chr15_32971967_+_267aa
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPV
EDDSDAETTGEENDEQGNTSKRKIVSNWDRTQDIEKEVNNESGESQRGTDFSVLLSSAGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDF

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000497208_chr15_32971967_+_268aa
MQAERGARGGRGRRPGRGRPGGDRHSERPGAAAAVARGGGGGGGGDGGGRRGRGRGRGFRGARGGRGGGGAPRGSRREPGGWGAGASAPV
EDDSDAETTGEENDEQGNTSKRKIVSNWDRTQDIEKEVNNESGESQRGTDFSVLLSSAGGAHEGLQHLGPFGNIPNIVAELTGDNIPKDF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000413748_chr15_32971967_+_855nt
ATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCGCGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGA
GCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGGAGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGC
GGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCGGGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTT
GAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGGAAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGA
TATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAGGGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGA
GCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACATCGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTT
AGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAAAACAGATGATGGATGTCTAGAAAACACCCCTGACACTGCA
GAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACATGACTATCCAGGCTTGGGCAAGTGGAACAAGAAACTCCTT
TACGAGAAGATGAAGGGAGGAGAGAGACGAAAGCGGAGGAGTGTCAATCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAG

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000300175_chr15_32971967_+_858nt
ATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCGCGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGA
GCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGGAGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGC
GGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCGGGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTT
GAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGGAAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGA
TATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAGGGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGA
GCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACATCGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTT
AGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAAAACAGCAGATGATGGATGTCTAGAAAACACCCCTGACACT
GCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACATGACTATCCAGGCTTGGGCAAGTGGAACAAGAAACTC
CTTTACGAGAAGATGAAGGGAGGAGAGAGACGAAAGCGGAGGAGTGTCAATCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCA

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000494364_chr15_32971967_+_801nt
ATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCGCGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGA
GCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGGAGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGC
GGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCGGGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTT
GAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGGAAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGA
TATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAGGGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGA
GCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACATCGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTT
AGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAAAACAGATGATGGATGTCTAGAAAACACCCCTGACACTGCA
GAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACATGACTATCCAGGCTTGGGCAAGTGGAGTGTCAATCCATAT

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000497208_chr15_32971967_+_804nt
ATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCGCGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGA
GCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGGAGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGC
GGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCGGGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTT
GAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGGAAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGA
TATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAGGGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGA
GCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACATCGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTT
AGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAAAACAGCAGATGATGGATGTCTAGAAAACACCCCTGACACT
GCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACATGACTATCCAGGCTTGGGCAAGTGGAGTGTCAATCCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000413748_chr15_32971967_+_1474nt
GCACCCCGCGCCTCGCTGCTACCGGGCGCCTTTCGCTCGCGGCTCCTCCGTGCGGCCCGCTTCCGGTGGGGCCAGGGCGTCTCCGCCGCA
GCTCGGCTCCCGCGCGCTCAGCACCGCCAGCGGCGGCCAGATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCG
CGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGAGCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGG
AGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGCGGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCG
GGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTTGAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGG
AAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGATATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAG
GGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGAGCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACAT
CGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTTAGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAA
AACAGATGATGGATGTCTAGAAAACACCCCTGACACTGCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACA
TGACTATCCAGGCTTGGGCAAGTGGAACAAGAAACTCCTTTACGAGAAGATGAAGGGAGGAGAGAGACGAAAGCGGAGGAGTGTCAATCC
ATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAGAAGTCTGTCCCCCATTTTTCAGATGAGGATAAGGATCCAGAGTAAAGAGA
AGATGCTAGACGAAAACCCACATTACCTGTTAGGCCTCAGCATGGCTTATGTGCACGTGTAAATGGAGTCCCTGTGAATGACAGCATGTT
TCTTACATAGATAATTATGGATACAAAGCAGCTGTATGTAGATAGTGTATTGTCTTCACACCGATGATTCTGCTTTTTGCTAAATTAGAA
TAAGAGCTTTTTTGTTTCTTGGGTTTTTAAAATGTGAATCTGCAATGATCATAAAAATTAAAATGTGAATGTCAACAATAAAAAGCAAGA
CTATGAAAGGCTCAGATTTCTTGCAGTTTAAAATGGTGTCTGAGGTTGTACTATTTTGGCCAAGTCTGTAGAAAGCTGTCATTTGATTTT
GATTATGTAGTTCATCCAGCCCTTGGGCATTGTTATACACCAGTAAAGAAGGCTGTACTCAAGAGGAGGAGCTGACACATTTCACTTGGC

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000300175_chr15_32971967_+_1477nt
GCACCCCGCGCCTCGCTGCTACCGGGCGCCTTTCGCTCGCGGCTCCTCCGTGCGGCCCGCTTCCGGTGGGGCCAGGGCGTCTCCGCCGCA
GCTCGGCTCCCGCGCGCTCAGCACCGCCAGCGGCGGCCAGATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCG
CGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGAGCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGG
AGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGCGGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCG
GGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTTGAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGG
AAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGATATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAG
GGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGAGCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACAT
CGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTTAGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAA
AACAGCAGATGATGGATGTCTAGAAAACACCCCTGACACTGCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGA
ACATGACTATCCAGGCTTGGGCAAGTGGAACAAGAAACTCCTTTACGAGAAGATGAAGGGAGGAGAGAGACGAAAGCGGAGGAGTGTCAA
TCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAGAAGTCTGTCCCCCATTTTTCAGATGAGGATAAGGATCCAGAGTAAAG
AGAAGATGCTAGACGAAAACCCACATTACCTGTTAGGCCTCAGCATGGCTTATGTGCACGTGTAAATGGAGTCCCTGTGAATGACAGCAT
GTTTCTTACATAGATAATTATGGATACAAAGCAGCTGTATGTAGATAGTGTATTGTCTTCACACCGATGATTCTGCTTTTTGCTAAATTA
GAATAAGAGCTTTTTTGTTTCTTGGGTTTTTAAAATGTGAATCTGCAATGATCATAAAAATTAAAATGTGAATGTCAACAATAAAAAGCA
AGACTATGAAAGGCTCAGATTTCTTGCAGTTTAAAATGGTGTCTGAGGTTGTACTATTTTGGCCAAGTCTGTAGAAAGCTGTCATTTGAT
TTTGATTATGTAGTTCATCCAGCCCTTGGGCATTGTTATACACCAGTAAAGAAGGCTGTACTCAAGAGGAGGAGCTGACACATTTCACTT

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000494364_chr15_32971967_+_1410nt
GCACCCCGCGCCTCGCTGCTACCGGGCGCCTTTCGCTCGCGGCTCCTCCGTGCGGCCCGCTTCCGGTGGGGCCAGGGCGTCTCCGCCGCA
GCTCGGCTCCCGCGCGCTCAGCACCGCCAGCGGCGGCCAGATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCG
CGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGAGCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGG
AGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGCGGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCG
GGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTTGAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGG
AAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGATATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAG
GGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGAGCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACAT
CGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTTAGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAA
AACAGATGATGGATGTCTAGAAAACACCCCTGACACTGCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGAACA
TGACTATCCAGGCTTGGGCAAGTGGAGTGTCAATCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAGAAGTCTGTCCCCCA
TTTTTCAGATGAGGATAAGGATCCAGAGTAAAGAGAAGATGCTAGACGAAAACCCACATTACCTGTTAGGCCTCAGCATGGCTTATGTGC
ACGTGTAAATGGAGTCCCTGTGAATGACAGCATGTTTCTTACATAGATAATTATGGATACAAAGCAGCTGTATGTAGATAGTGTATTGTC
TTCACACCGATGATTCTGCTTTTTGCTAAATTAGAATAAGAGCTTTTTTGTTTCTTGGGTTTTTAAAATGTGAATCTGCAATGATCATAA
AAATTAAAATGTGAATGTCAACAATAAAAAGCAAGACTATGAAAGGCTCAGATTTCTTGCAGTTTAAAATGGTGTCTGAGGTTGTACTAT
TTTGGCCAAGTCTGTAGAAAGCTGTCATTTGATTTTGATTATGTAGTTCATCCAGCCCTTGGGCATTGTTATACACCAGTAAAGAAGGCT

>In-frame_AVEN_ENST00000306730_chr15_34295233_-_SCG5_ENST00000497208_chr15_32971967_+_1214nt
GCACCCCGCGCCTCGCTGCTACCGGGCGCCTTTCGCTCGCGGCTCCTCCGTGCGGCCCGCTTCCGGTGGGGCCAGGGCGTCTCCGCCGCA
GCTCGGCTCCCGCGCGCTCAGCACCGCCAGCGGCGGCCAGATGCAGGCGGAGCGAGGAGCTCGGGGAGGCCGTGGGCGGCGGCCAGGCCG
CGGCCGGCCTGGCGGAGATCGCCACAGCGAGCGGCCCGGAGCCGCAGCGGCGGTAGCCAGAGGCGGCGGCGGAGGCGGCGGCGGGGACGG
AGGCGGACGCCGGGGCCGTGGCCGTGGCCGGGGCTTCCGCGGCGCTCGCGGAGGCCGAGGAGGAGGAGGCGCCCCGCGAGGCAGCCGCCG
GGAGCCGGGAGGCTGGGGCGCAGGGGCCAGCGCGCCGGTTGAAGATGACAGCGATGCAGAGACCTATGGAGAAGAGAATGATGAACAGGG
AAATTATTCTAAAAGAAAGATTGTCTCTAACTGGGATCGATATCAAGATATTGAAAAAGAGGTCAATAATGAAAGTGGAGAGTCACAGAG
GGGAACAGATTTCAGTGTCCTCCTTAGCTCTGCAGGTGGAGCTCATGAAGGACTTCAGCATTTGGGTCCTTTTGGCAACATCCCCAACAT
CGTGGCAGAGTTGACTGGAGACAACATTCCTAAGGACTTTAGTGAGGATCAGGGGTACCCAGACCCTCCAAATCCCTGTCCTGTTGGAAA
AACAGCAGATGATGGATGTCTAGAAAACACCCCTGACACTGCAGAGTTCAGTCGAGAGTTCCAGTTGCACCAGCATCTCTTTGATCCGGA
ACATGACTATCCAGGCTTGGGCAAGTGGAGTGTCAATCCATATCTACAAGGACAGAGACTGGATAATGTTGTTGCAAAGAAGTCTGTCCC
CCATTTTTCAGATGAGGATAAGGATCCAGAGTAAAGAGAAGATGCTAGACGAAAACCCACATTACCTGTTAGGCCTCAGCATGGCTTATG
TGCACGTGTAAATGGAGTCCCTGTGAATGACAGCATGTTTCTTACATAGATAATTATGGATACAAAGCAGCTGTATGTAGATAGTGTATT
GTCTTCACACCGATGATTCTGCTTTTTGCTAAATTAGAATAAGAGCTTTTTTGTTTCTTGGGTTTTTAAAATGTGAATCTGCAATGATCA


Top

FusionGenePPI for AVEN_SCG5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AVENBCL2L1, BCL2, APAF1, MOV10, NXF1, XPO1, HNRNPU, RPL10SCG5UBQLN4, NR1H2, KHDRBS1, UBQLN1, CSH2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AVEN_SCG5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AVEN_SCG5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAVENC0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneSCG5C0009404Colorectal Neoplasms1CTD_human
TgeneSCG5C0025149Medulloblastoma1CTD_human