FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3630

FusionGeneSummary for AUTS2_PNLIPRP3

check button Fusion gene summary
Fusion gene informationFusion gene name: AUTS2_PNLIPRP3
Fusion gene ID: 3630
HgeneTgene
Gene symbol

AUTS2

PNLIPRP3

Gene ID

26053

119548

Gene nameAUTS2, activator of transcription and developmental regulatorpancreatic lipase related protein 3
SynonymsFBRSL2|MRD26-
Cytomap

7q11.22

10q25.3

Type of geneprotein-codingprotein-coding
Descriptionautism susceptibility gene 2 proteinautism susceptibility candidate 2autism-related protein 1pancreatic lipase-related protein 3PL-RP3
Modification date2018051920180329
UniProtAcc

Q8WXX7

Q17RR3

Ensembl transtripts involved in fusion geneENST00000406775, ENST00000342771, 
ENST00000403018, ENST00000489774, 
ENST00000369230, 
Fusion gene scores* DoF score19 X 15 X 7=19952 X 2 X 2=8
# samples 192
** MAII scorelog2(19/1995*10)=-3.39231742277876
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: AUTS2 [Title/Abstract] AND PNLIPRP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneAUTS2

GO:0045944

positive regulation of transcription by RNA polymerase II

25519132

HgeneAUTS2

GO:0051571

positive regulation of histone H3-K4 methylation

25519132

HgeneAUTS2

GO:2000620

positive regulation of histone H4-K16 acetylation

25519132


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-13-0916-01AAUTS2chr7

69364484

+PNLIPRP3chr10

118215234

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000406775ENST00000369230AUTS2chr7

69364484

+PNLIPRP3chr10

118215234

+
In-frameENST00000342771ENST00000369230AUTS2chr7

69364484

+PNLIPRP3chr10

118215234

+
In-frameENST00000403018ENST00000369230AUTS2chr7

69364484

+PNLIPRP3chr10

118215234

+
intron-3CDSENST00000489774ENST00000369230AUTS2chr7

69364484

+PNLIPRP3chr10

118215234

+

Top

FusionProtFeatures for AUTS2_PNLIPRP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AUTS2

Q8WXX7

PNLIPRP3

Q17RR3

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility (PubMed:25519132). ThePRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP andAUTS2 has decreased histone H2A ubiquitination activity, due tothe phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As aconsequence, the complex mediates transcriptional activation(PubMed:25519132). In the cytoplasm, plays a role in axon anddendrite elongation and in neuronal migration during embryonicbrain development. Promotes reorganization of the actincytoskeleton, lamellipodia formation and neurite elongation viaits interaction with RAC guanine nucleotide exchange factors,which then leads to the activation of RAC1 (By similarity).{ECO:0000250|UniProtKB:A0A087WPF7, ECO:0000269|PubMed:25519132}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePNLIPRP3chr7:69364484chr10:118215234ENST00000369230+312355_467152468DomainNote=PLAT

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAUTS2chr7:69364484chr10:118215234ENST00000342771+2191122_11811741260Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000342771+219288_4711741260Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000342771+219525_5481741260Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000342771+219545_6461741260Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000403018+251122_1181174267Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000403018+25288_471174267Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000403018+25525_548174267Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000403018+25545_646174267Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000406775+2181122_11811741236Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000406775+218288_4711741236Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000406775+218525_5481741236Compositional biasHis-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000406775+218545_6461741236Compositional biasPro-rich
HgeneAUTS2chr7:69364484chr10:118215234ENST00000342771+219289_4721741260RegionImportant for regulation of lamellipodia formation
HgeneAUTS2chr7:69364484chr10:118215234ENST00000403018+25289_472174267RegionImportant for regulation of lamellipodia formation
HgeneAUTS2chr7:69364484chr10:118215234ENST00000406775+218289_4721741236RegionImportant for regulation of lamellipodia formation


Top

FusionGeneSequence for AUTS2_PNLIPRP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AUTS2_ENST00000406775_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_490aa
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNGKPPSSAPSRPRPPRRKRRESTSAEEDIIDG
FAMTSFVTFEALEKDVALKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQKKFETS
PSKVHLIGHSLGAHLAGEAGSRIPGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKH
MPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSTQFTAESILNPDAFIATPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTN
GSHTFLNTGSLSPFARWRHKLSVKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDS

>In-frame_AUTS2_ENST00000342771_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_490aa
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNGKPPSSAPSRPRPPRRKRRESTSAEEDIIDG
FAMTSFVTFEALEKDVALKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQKKFETS
PSKVHLIGHSLGAHLAGEAGSRIPGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKH
MPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSTQFTAESILNPDAFIATPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTN
GSHTFLNTGSLSPFARWRHKLSVKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDS

>In-frame_AUTS2_ENST00000403018_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_490aa
MDGPTRGHGLRKKRRSRSQRDRERRSRGGLGAGAAGGGGAGRTRALSLASSSGSDKEDNGKPPSSAPSRPRPPRRKRRESTSAEEDIIDG
FAMTSFVTFEALEKDVALKPQERVEKRQTPLTKKKREALTNGLSFHSKKSRLSHPHHYSSDRENDRNLCQHLGKRKKMPKALRQKKFETS
PSKVHLIGHSLGAHLAGEAGSRIPGLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGHLDFYPNGGKH
MPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSTQFTAESILNPDAFIATPCRSYTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTN
GSHTFLNTGSLSPFARWRHKLSVKLSGSEVTQGTVFLRVGGAVRKTGEFAIVSGKLEPGMTYTKLIDADVNVGNITSVQFIWKKHLFEDS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AUTS2_ENST00000406775_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_1470nt
ATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTCGCGGTCGCAGCGAGACCGGGAGAGGCGCTCCCGGGGCGGGCTG
GGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCTCTCACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGG
AAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCGCGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGA
TTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAGAAACGCCAGACGCCC
CTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCATTCAAAGAAGAGCAGACTCAGCCACCCACACCACTACAGCTCA
GATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGAAGAGAAAGAAAATGCCGAAGGCACTCAGACAGAAAAAATTTGAATATTCC
CCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCACACCTGGCTGGGGAAGCTGGGTCAAGGATACCAGGCCTTGGAAGAATAACT
GGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCAAAGGAAGTCAGGCTAGACCCCTCGGATGCCAACTTTGTTGACGTTATTCAT
ACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGAACCATTGATGCTTGTGGTCATCTTGACTTTTACCCAAATGGAGGGAAGCAC
ATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAATTTAACTTCAATGCTTACAAAAAAGAAATGGCTTCCTTCTTTGACTGTAAC
CATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTTAATCCTGATGCATTTATTGCTTATCCTTGTAGATCCTACACATCTTTTAAA
GCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCAACAATGGGTCATTTTGCTGATAGATTTCACTTCAAAAATATGAAGACTAAT
GGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCATTTGCCCGTTGGAGGCACAAATTGTCTGTTAAACTCAGTGGAAGCGAAGTC
ACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTTAGGAAAACTGGGGAGTTTGCCATTGTCAGTGGAAAACTTGAGCCAGGCATG
ACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGAAACATTACAAGTGTTCAGTTCATCTGGAAAAAACATTTGTTTGAAGATTCT
CAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCTGGGAAATATGGATATAAATCTACCTTCTGTAGCCAAGACATTATGGGACCT

>In-frame_AUTS2_ENST00000342771_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_1470nt
ATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTCGCGGTCGCAGCGAGACCGGGAGAGGCGCTCCCGGGGCGGGCTG
GGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCTCTCACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGG
AAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCGCGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGA
TTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAGAAACGCCAGACGCCC
CTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCATTCAAAGAAGAGCAGACTCAGCCACCCACACCACTACAGCTCA
GATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGAAGAGAAAGAAAATGCCGAAGGCACTCAGACAGAAAAAATTTGAATATTCC
CCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCACACCTGGCTGGGGAAGCTGGGTCAAGGATACCAGGCCTTGGAAGAATAACT
GGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCAAAGGAAGTCAGGCTAGACCCCTCGGATGCCAACTTTGTTGACGTTATTCAT
ACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGAACCATTGATGCTTGTGGTCATCTTGACTTTTACCCAAATGGAGGGAAGCAC
ATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAATTTAACTTCAATGCTTACAAAAAAGAAATGGCTTCCTTCTTTGACTGTAAC
CATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTTAATCCTGATGCATTTATTGCTTATCCTTGTAGATCCTACACATCTTTTAAA
GCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCAACAATGGGTCATTTTGCTGATAGATTTCACTTCAAAAATATGAAGACTAAT
GGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCATTTGCCCGTTGGAGGCACAAATTGTCTGTTAAACTCAGTGGAAGCGAAGTC
ACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTTAGGAAAACTGGGGAGTTTGCCATTGTCAGTGGAAAACTTGAGCCAGGCATG
ACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGAAACATTACAAGTGTTCAGTTCATCTGGAAAAAACATTTGTTTGAAGATTCT
CAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCTGGGAAATATGGATATAAATCTACCTTCTGTAGCCAAGACATTATGGGACCT

>In-frame_AUTS2_ENST00000403018_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_1470nt
ATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTCGCGGTCGCAGCGAGACCGGGAGAGGCGCTCCCGGGGCGGGCTG
GGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCTCTCACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGG
AAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCGCGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGA
TTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAGAAACGCCAGACGCCC
CTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCATTCAAAGAAGAGCAGACTCAGCCACCCACACCACTACAGCTCA
GATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGAAGAGAAAGAAAATGCCGAAGGCACTCAGACAGAAAAAATTTGAATATTCC
CCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCACACCTGGCTGGGGAAGCTGGGTCAAGGATACCAGGCCTTGGAAGAATAACT
GGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCAAAGGAAGTCAGGCTAGACCCCTCGGATGCCAACTTTGTTGACGTTATTCAT
ACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGAACCATTGATGCTTGTGGTCATCTTGACTTTTACCCAAATGGAGGGAAGCAC
ATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAATTTAACTTCAATGCTTACAAAAAAGAAATGGCTTCCTTCTTTGACTGTAAC
CATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTTAATCCTGATGCATTTATTGCTTATCCTTGTAGATCCTACACATCTTTTAAA
GCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCAACAATGGGTCATTTTGCTGATAGATTTCACTTCAAAAATATGAAGACTAAT
GGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCATTTGCCCGTTGGAGGCACAAATTGTCTGTTAAACTCAGTGGAAGCGAAGTC
ACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTTAGGAAAACTGGGGAGTTTGCCATTGTCAGTGGAAAACTTGAGCCAGGCATG
ACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGAAACATTACAAGTGTTCAGTTCATCTGGAAAAAACATTTGTTTGAAGATTCT
CAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCTGGGAAATATGGATATAAATCTACCTTCTGTAGCCAAGACATTATGGGACCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_AUTS2_ENST00000406775_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_3009nt
CGCTCGCAGTTTCGCCCTCTCTTCCGCTAATGATTGCATTATTATGCTCCCCTCTCTGGGGGGTCTCGCCCCTCTTGGGTCGCTCCGGAG
CCCCGGCCTCCCCTGGCTGCATTTCTTAAAAATTTGGGAGCCTGGGAGTGAGTTTTCTCCGAGGCGTGTGTGAGAGGCGGCGGGGGTGTT
TTCCTGCGCGAGGGGCGGGTGAAGTTCATTGCCCCCACTTTTCCCGCGACCTTTTTCGGACCCGATTTTGGATCGAGTTGAGGGGGGCGC
GGGCGTTTTCGGGGGGCGGGGGGCGCGGCGGAGAATGGCCGCGGGGAGGGCTCCCCGGAGCCTCCCAGTCTCTTGATCAAAGCATTCCGC
TATTCTGATTTATTGCTTGCTTGGTGAGTTATTTTTTTTTCCTCTAAAGGAGACCTGTGTGTTCAGCCATTACTTTGCTCGGCGCTGCTC
CCAGGCATCTCCGACCCTCGGTGCTGTGGGGAGCCCCACACTTGGGCTCCTCGCCTCTCGCCCTCGCTCCCCGTCCCTCCTCCCCTCTCT
CCGCCCCTTCCCCCTTTTCTTTCTCCTCTCTTTCTTCCCCTCTCTCCCTTCTTTCGGCCGCCGTCTCCCCCGCGCCCTCCTCGGGGCGGA
GGGAAGCCGTGAAGGGGGAGGGAGGGCTCGGTGTCAATTTTTTTTTGTGTGGCTGCGGCCGTAGCCTGTGGCGGGCAAGCGGGGAGACCC
CGGCGCAGCAGAACCATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTCGCGGTCGCAGCGAGACCGGGAGAGGCGC
TCCCGGGGCGGGCTGGGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCTCTCACTCGCCTCGTCGTCGGGCTCCGAC
AAGGAAGACAATGGGAAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCGCGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAG
GACATCATTGATGGATTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAG
AAACGCCAGACGCCCCTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCATTCAAAGAAGAGCAGACTCAGCCACCCA
CACCACTACAGCTCAGATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGAAGAGAAAGAAAATGCCGAAGGCACTCAGACAGAAA
AAATTTGAATATTCCCCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCACACCTGGCTGGGGAAGCTGGGTCAAGGATACCAGGC
CTTGGAAGAATAACTGGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCAAAGGAAGTCAGGCTAGACCCCTCGGATGCCAACTTT
GTTGACGTTATTCATACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGAACCATTGATGCTTGTGGTCATCTTGACTTTTACCCA
AATGGAGGGAAGCACATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAATTTAACTTCAATGCTTACAAAAAAGAAATGGCTTCC
TTCTTTGACTGTAACCATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTTAATCCTGATGCATTTATTGCTTATCCTTGTAGATCC
TACACATCTTTTAAAGCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCAACAATGGGTCATTTTGCTGATAGATTTCACTTCAAA
AATATGAAGACTAATGGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCATTTGCCCGTTGGAGGCACAAATTGTCTGTTAAACTC
AGTGGAAGCGAAGTCACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTTAGGAAAACTGGGGAGTTTGCCATTGTCAGTGGAAAA
CTTGAGCCAGGCATGACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGAAACATTACAAGTGTTCAGTTCATCTGGAAAAAACAT
TTGTTTGAAGATTCTCAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCTGGGAAATATGGATATAAATCTACCTTCTGTAGCCAA
GACATTATGGGACCTAATATTCTCCAGAACCTGAAACCATGCTAATCTCAGATACAGTCTTGATGGATTTCTTTAGTAGGAGCAATGAAG
AAAAGTGTCTCCTTCCACCTGGCATCCAGACCAAATTTGACCCTTGTAAATGACTTAGTCATTTACAAGGGTCTTACTCAGAGTCAAGTA
CGGGTTTGCTTTTTTTCTGTGTAGAATGTTCATCTAACTGCACCTTAAAAACACACTGAACCCTGGGACAAAAGATAATTACTATGATCT
GTAGGAATCTGGATATCATTGACAAAATAGAGCTGTTTTGGAATTTTCCTGAATAAGAGGAGGTGATGCAAATGTATGTTGAGTGTATAA
ACTCACTGGACAAAAGTAAGCCTCTGGCTTGCTGAGTTTTTGAAGTATATTTTCAGGTATAATAATCATTGTTCTAAAATTATATAAAAC
TATTTGTTATGTTGTTAAATCTTGCTGAGACAAATTATGACTATAGTGCATGATATATAGTAGATTATAACCTTGTGGGTTGATGTGTCT
ATCTAGTAATAATAAAAACTAATGAGATGGCACTAGTATTTCCAAGGTGTTCCTTGGTGTTCAGGGTGTGCACAAGAGAGATTTTGGAGC
TTATCTGTTATGTGTTCATCAGTTAGCAATGGGACCTGAAGTTCAACAACCCAGGGTATAGCCCCCTTCCTCCAAAGTCCCTGCCACAGG
AGAATTACTCCTCTCCCTGGGTCTTGAATGCTCTATGGTGAATTTGTATTTAGCCTCAAGGCAGCATTTCATTTGTAAAGCACTTGGGTA

>In-frame_AUTS2_ENST00000342771_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_2595nt
CTGTGTGTTCAGCCATTACTTTGCTCGGCGCTGCTCCCAGGCATCTCCGACCCTCGGTGCTGTGGGGAGCCCCACACTTGGGCTCCTCGC
CTCTCGCCCTCGCTCCCCGTCCCTCCTCCCCTCTCTCCGCCCCTTCCCCCTTTTCTTTCTCCTCTCTTTCTTCCCCTCTCTCCCTTCTTT
CGGCCGCCGTCTCCCCCGCGCCCTCCTCGGGGCGGAGGGAAGCCGTGAAGGGGGAGGGAGGGCTCGGTGTCAATTTTTTTTTGTGTGGCT
GCGGCCGTAGCCTGTGGCGGGCAAGCGGGGAGACCCCGGCGCAGCAGAACCATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAG
CGGCGGTCGCGGTCGCAGCGAGACCGGGAGAGGCGCTCCCGGGGCGGGCTGGGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACC
CGGGCGCTCTCACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGGAAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCG
CGGAGGAAGCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGATTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAG
AAAGATGTAGCACTTAAGCCTCAGGAACGTGTGGAGAAACGCCAGACGCCCCTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTG
TCCTTTCATTCAAAGAAGAGCAGACTCAGCCACCCACACCACTACAGCTCAGATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGG
AAGAGAAAGAAAATGCCGAAGGCACTCAGACAGAAAAAATTTGAATATTCCCCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCA
CACCTGGCTGGGGAAGCTGGGTCAAGGATACCAGGCCTTGGAAGAATAACTGGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCA
AAGGAAGTCAGGCTAGACCCCTCGGATGCCAACTTTGTTGACGTTATTCATACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGA
ACCATTGATGCTTGTGGTCATCTTGACTTTTACCCAAATGGAGGGAAGCACATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAA
TTTAACTTCAATGCTTACAAAAAAGAAATGGCTTCCTTCTTTGACTGTAACCATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTT
AATCCTGATGCATTTATTGCTTATCCTTGTAGATCCTACACATCTTTTAAAGCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCA
ACAATGGGTCATTTTGCTGATAGATTTCACTTCAAAAATATGAAGACTAATGGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCA
TTTGCCCGTTGGAGGCACAAATTGTCTGTTAAACTCAGTGGAAGCGAAGTCACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTT
AGGAAAACTGGGGAGTTTGCCATTGTCAGTGGAAAACTTGAGCCAGGCATGACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGA
AACATTACAAGTGTTCAGTTCATCTGGAAAAAACATTTGTTTGAAGATTCTCAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCT
GGGAAATATGGATATAAATCTACCTTCTGTAGCCAAGACATTATGGGACCTAATATTCTCCAGAACCTGAAACCATGCTAATCTCAGATA
CAGTCTTGATGGATTTCTTTAGTAGGAGCAATGAAGAAAAGTGTCTCCTTCCACCTGGCATCCAGACCAAATTTGACCCTTGTAAATGAC
TTAGTCATTTACAAGGGTCTTACTCAGAGTCAAGTACGGGTTTGCTTTTTTTCTGTGTAGAATGTTCATCTAACTGCACCTTAAAAACAC
ACTGAACCCTGGGACAAAAGATAATTACTATGATCTGTAGGAATCTGGATATCATTGACAAAATAGAGCTGTTTTGGAATTTTCCTGAAT
AAGAGGAGGTGATGCAAATGTATGTTGAGTGTATAAACTCACTGGACAAAAGTAAGCCTCTGGCTTGCTGAGTTTTTGAAGTATATTTTC
AGGTATAATAATCATTGTTCTAAAATTATATAAAACTATTTGTTATGTTGTTAAATCTTGCTGAGACAAATTATGACTATAGTGCATGAT
ATATAGTAGATTATAACCTTGTGGGTTGATGTGTCTATCTAGTAATAATAAAAACTAATGAGATGGCACTAGTATTTCCAAGGTGTTCCT
TGGTGTTCAGGGTGTGCACAAGAGAGATTTTGGAGCTTATCTGTTATGTGTTCATCAGTTAGCAATGGGACCTGAAGTTCAACAACCCAG
GGTATAGCCCCCTTCCTCCAAAGTCCCTGCCACAGGAGAATTACTCCTCTCCCTGGGTCTTGAATGCTCTATGGTGAATTTGTATTTAGC

>In-frame_AUTS2_ENST00000403018_chr7_69364484_+_PNLIPRP3_ENST00000369230_chr10_118215234_+_2317nt
AGCCTGTGGCGGGCAAGCGGGGAGACCCCGGCGCAGCAGAACCATGGATGGCCCGACGCGGGGCCATGGACTCCGCAAAAAGCGGCGGTC
GCGGTCGCAGCGAGACCGGGAGAGGCGCTCCCGGGGCGGGCTGGGGGCCGGCGCGGCCGGCGGCGGCGGGGCTGGCCGGACCCGGGCGCT
CTCACTCGCCTCGTCGTCGGGCTCCGACAAGGAAGACAATGGGAAGCCCCCGTCCTCCGCCCCGTCCCGGCCCAGACCCCCGCGGAGGAA
GCGGAGAGAGTCCACCTCGGCAGAAGAGGACATCATTGATGGATTTGCCATGACCAGCTTTGTCACTTTTGAAGCGCTGGAGAAAGATGT
AGCACTTAAGCCTCAGGAACGTGTGGAGAAACGCCAGACGCCCCTGACCAAGAAGAAACGAGAAGCACTTACCAATGGCTTGTCCTTTCA
TTCAAAGAAGAGCAGACTCAGCCACCCACACCACTACAGCTCAGATCGAGAAAATGACCGCAATCTCTGCCAGCACCTTGGGAAGAGAAA
GAAAATGCCGAAGGCACTCAGACAGAAAAAATTTGAATATTCCCCTTCTAAAGTGCACTTGATTGGCCACAGCTTGGGAGCACACCTGGC
TGGGGAAGCTGGGTCAAGGATACCAGGCCTTGGAAGAATAACTGGGTTGGACCCAGCTGGGCCATTTTTCCACAACACTCCAAAGGAAGT
CAGGCTAGACCCCTCGGATGCCAACTTTGTTGACGTTATTCATACAAATGCAGCTCGCATCCTCTTTGAGCTTGGTGTTGGAACCATTGA
TGCTTGTGGTCATCTTGACTTTTACCCAAATGGAGGGAAGCACATGCCAGGATGTGAAGACTTAATTACACCTTTACTGAAATTTAACTT
CAATGCTTACAAAAAAGAAATGGCTTCCTTCTTTGACTGTAACCATGCCCGAAGTTATCAATTTTATGCTGAAAGCATTCTTAATCCTGA
TGCATTTATTGCTTATCCTTGTAGATCCTACACATCTTTTAAAGCAGGAAATTGCTTCTTTTGTTCCAAAGAAGGTTGCCCAACAATGGG
TCATTTTGCTGATAGATTTCACTTCAAAAATATGAAGACTAATGGATCACATTATTTTTTAAACACAGGGTCCCTTTCCCCATTTGCCCG
TTGGAGGCACAAATTGTCTGTTAAACTCAGTGGAAGCGAAGTCACTCAAGGAACTGTCTTTCTTCGTGTAGGCGGGGCAGTTAGGAAAAC
TGGGGAGTTTGCCATTGTCAGTGGAAAACTTGAGCCAGGCATGACTTACACAAAATTAATCGATGCAGATGTTAACGTTGGAAACATTAC
AAGTGTTCAGTTCATCTGGAAAAAACATTTGTTTGAAGATTCTCAGAATAAGTTGGGAGCAGAAATGGTGATAAATACATCTGGGAAATA
TGGATATAAATCTACCTTCTGTAGCCAAGACATTATGGGACCTAATATTCTCCAGAACCTGAAACCATGCTAATCTCAGATACAGTCTTG
ATGGATTTCTTTAGTAGGAGCAATGAAGAAAAGTGTCTCCTTCCACCTGGCATCCAGACCAAATTTGACCCTTGTAAATGACTTAGTCAT
TTACAAGGGTCTTACTCAGAGTCAAGTACGGGTTTGCTTTTTTTCTGTGTAGAATGTTCATCTAACTGCACCTTAAAAACACACTGAACC
CTGGGACAAAAGATAATTACTATGATCTGTAGGAATCTGGATATCATTGACAAAATAGAGCTGTTTTGGAATTTTCCTGAATAAGAGGAG
GTGATGCAAATGTATGTTGAGTGTATAAACTCACTGGACAAAAGTAAGCCTCTGGCTTGCTGAGTTTTTGAAGTATATTTTCAGGTATAA
TAATCATTGTTCTAAAATTATATAAAACTATTTGTTATGTTGTTAAATCTTGCTGAGACAAATTATGACTATAGTGCATGATATATAGTA
GATTATAACCTTGTGGGTTGATGTGTCTATCTAGTAATAATAAAAACTAATGAGATGGCACTAGTATTTCCAAGGTGTTCCTTGGTGTTC
AGGGTGTGCACAAGAGAGATTTTGGAGCTTATCTGTTATGTGTTCATCAGTTAGCAATGGGACCTGAAGTTCAACAACCCAGGGTATAGC
CCCCTTCCTCCAAAGTCCCTGCCACAGGAGAATTACTCCTCTCCCTGGGTCTTGAATGCTCTATGGTGAATTTGTATTTAGCCTCAAGGC


Top

FusionGenePPI for AUTS2_PNLIPRP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AUTS2PCGF3, PCGF5, RNF2, CSNK2A2, RYBP, RING1, YAF2, CSNK2A1, CSNK2B, DCAF7, FBRS, EP300, RERE, RBM14, ZNF608, ZNF609, TLE3, WDR5, PCGF6, ATN1PNLIPRP3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AUTS2_PNLIPRP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AUTS2_PNLIPRP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAUTS2C0036341Schizophrenia2PSYGENET
HgeneAUTS2C0014544Epilepsy1CTD_human