FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36176

FusionGeneSummary for SSR1_FARS2

check button Fusion gene summary
Fusion gene informationFusion gene name: SSR1_FARS2
Fusion gene ID: 36176
HgeneTgene
Gene symbol

SSR1

FARS2

Gene ID

6745

10667

Gene namesignal sequence receptor subunit 1phenylalanyl-tRNA synthetase 2, mitochondrial
SynonymsTRAPACOXPD14|FARS1|HSPC320|PheRS|SPG77
Cytomap

6p24.3

6p25.1

Type of geneprotein-codingprotein-coding
Descriptiontranslocon-associated protein subunit alphaSSR alpha subunitSSR-alphaTRAP alphasignal sequence receptor subunit alphasignal sequence receptor, alphatranslocon-associated protein alpha subunitphenylalanine--tRNA ligase, mitochondrialdJ236A3.1 (phenylalanine-tRNA synthetase)dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase))mitochondrial PHERSphenylalanine tRNA ligase 2, mitochondrialphenylalanine translasephenylalanine-tRNA synthetase 1 (
Modification date2018052320180523
UniProtAcc

P43307

O95363

Ensembl transtripts involved in fusion geneENST00000488834, ENST00000474597, 
ENST00000244763, ENST00000397511, 
ENST00000534851, ENST00000489567, 
ENST00000479365, ENST00000462112, 
ENST00000324331, ENST00000274680, 
Fusion gene scores* DoF score10 X 11 X 4=4409 X 7 X 7=441
# samples 1111
** MAII scorelog2(11/440*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(11/441*10)=-2.00327513203286
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SSR1 [Title/Abstract] AND FARS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneFARS2

GO:0006432

phenylalanyl-tRNA aminoacylation

10329163

TgeneFARS2

GO:0008033

tRNA processing

10329163


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-62-A46S-01ASSR1chr6

7303783

-FARS2chr6

5545413

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
5UTR-3CDSENST00000488834ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
5UTR-3CDSENST00000488834ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000474597ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000474597ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000244763ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000244763ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000397511ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000397511ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
intron-3CDSENST00000534851ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
intron-3CDSENST00000534851ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000489567ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000489567ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000479365ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000479365ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000462112ENST00000324331SSR1chr6

7303783

-FARS2chr6

5545413

+
In-frameENST00000462112ENST00000274680SSR1chr6

7303783

-FARS2chr6

5545413

+

Top

FusionProtFeatures for SSR1_FARS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SSR1

P43307

FARS2

O95363

Is responsible for the charging of tRNA(Phe) withphenylalanine in mitochondrial translation. To a lesser extent,also catalyzes direct attachment of m-Tyr (an oxidized version ofPhe) to tRNA(Phe), thereby opening the way for delivery of themisacylated tRNA to the ribosome and incorporation of ROS-damagedamino acid into proteins. {ECO:0000269|PubMed:19549855,ECO:0000269|PubMed:22833457}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SSR1_FARS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_244aa
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFV
KGEAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAENDFYDLVRTI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_732nt
ATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCA
GTGGCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAA
CCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTA
AAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGAT
ATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGC
AAATATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATT
GGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTAC
CGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_819nt
CGGAGCCCGGATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATG
AGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTG
GCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCC
ACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAA
GGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATC
CGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAA
TATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGA
GGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGC
CACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGC

>In-frame_SSR1_ENST00000474597_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_970nt
CGGAGCCCGGATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATG
AGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTG
GCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCC
ACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAA
GGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATC
CGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAA
TATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGA
GGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGC
CACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGC
AGGTTCTGATGTCACCACTTCACTCAGGCTGCAGCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGG

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_819nt
CGGAGCCCGGATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATG
AGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTG
GCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCC
ACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAA
GGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATC
CGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAA
TATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGA
GGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGC
CACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGC

>In-frame_SSR1_ENST00000244763_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_970nt
CGGAGCCCGGATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATG
AGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTG
GCACAAGATCTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCC
ACAGATTTGGTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAA
GGAGAAGCTGGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATC
CGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAA
TATCCGGCTGTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGA
GGAGACCTGGTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGC
CACATGGAACGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGC
AGGTTCTGATGTCACCACTTCACTCAGGCTGCAGCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGG

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_810nt
GATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTC
CCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGAT
CTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTG
GTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCT
GGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTC
TGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCT
GTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTG
GTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAA
CGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGA

>In-frame_SSR1_ENST00000397511_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_961nt
GATGAAGAGTAACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTC
CCCCGCTTGCTGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGAT
CTTACAGAGGATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTG
GTAGAAGATAAAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCT
GGTGCTCAAGACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTC
TGGTGTGAGGACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCT
GTGATCAATGATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTG
GTGGAAAAGGTTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAA
CGGACTCTGTCCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGA
TGTCACCACTTCACTCAGGCTGCAGCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGGGGCATCAAT

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_786nt
CGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTA
CTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGGATGAAGAAACAGTA
GAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGAT
GTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGG
GCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTG
AAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTTCATTCTGG
TTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGAC
AAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTC

>In-frame_SSR1_ENST00000489567_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_937nt
CGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGCTGCTGCTTCTCTTA
CTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGGATGAAGAAACAGTA
GAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATAAAGAGGAAGAAGAT
GTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAGACCGAATCGGCTGG
GCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGCGCTTCCTG
AAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTTCATTCTGG
TTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATCTCATAGAC
AAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGAGAGAGGTC
AGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGATGTCACCACTTCACTCAGGCTGCA
GCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGGGGCATCAATCATCTTTTGATAAATGGATCAGTT

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_794nt
ATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGCTGCTGC
TTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGGATGAAG
AAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATAAAGAGG
AAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAGACCGAA
TCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGC
GCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTT
CATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATC
TCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGA

>In-frame_SSR1_ENST00000479365_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_945nt
ATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGCTGCTGC
TTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGGATGAAG
AAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATAAAGAGG
AAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAGACCGAA
TCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGGACGAGC
GCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATGATATTT
CATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGGTTGATC
TCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGTCCCAGA
GAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGATGTCACCACTTCACTC
AGGCTGCAGCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGGGGCATCAATCATCTTTTGATAAATG

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000324331_chr6_5545413_+_800nt
AACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGC
TGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGG
ATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATA
AAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAG
ACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGG
ACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATG
ATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGG
TTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGT

>In-frame_SSR1_ENST00000462112_chr6_7303783_-_FARS2_ENST00000274680_chr6_5545413_+_951nt
AACGCCATTACCGCCGGAGCCGCCGAGAGCCTTAGCCGACGGAAACTGGACACTGGACCGGCAGCGCCATGAGACTCCTCCCCCGCTTGC
TGCTGCTTCTCTTACTCGTGTTCCCTGCCACTGTCTTGTTCCGAGGCGGCCCCAGAGGCTTGTTAGCAGTGGCACAAGATCTTACAGAGG
ATGAAGAAACAGTAGAAGATTCCATAATTGAGGATGAAGATGATGAAGCCGAGGTAGAAGAAGATGAACCCACAGATTTGGTAGAAGATA
AAGAGGAAGAAGATGTGTCTGGTGAACCTGAAGCTTCACCGAGTGCAGATACAACTATACTGTTTGTAAAAGGAGAAGCTGGTGCTCAAG
ACCGAATCGGCTGGGCTTTTGGCCTAGGATTAGAAAGGCTAGCCATGATCCTCTACGACATCCCTGATATCCGTCTCTTCTGGTGTGAGG
ACGAGCGCTTCCTGAAGCAGTTCTGTGTATCCAACATTAATCAGAAGGTGAAGTTTCAGCCTCTTAGCAAATATCCGGCTGTGATCAATG
ATATTTCATTCTGGTTGCCCTCTGAGAATTACGCAGAAAATGATTTCTATGACTTAGTCCGAACAATTGGAGGAGACCTGGTGGAAAAGG
TTGATCTCATAGACAAGTTTGTACATCCAAAGACGCACAAGACCAGCCACTGCTACCGCATCACGTACCGCCACATGGAACGGACTCTGT
CCCAGAGAGAGGTCAGGCACATCCACCAGGCCTTGCAGGAGGCTGCAGTCCAGCTGTTGGGTGTGGAGGGCAGGTTCTGATGTCACCACT
TCACTCAGGCTGCAGCCCTCTTGGGGCTCCAGGATTTGCTGAAAGAGAAAAAGATATGGTTTGTGAACTGGGGCATCAATCATCTTTTGA


Top

FusionGenePPI for SSR1_FARS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SSR1DKC1, UTP14A, EEF1A1, PTN, HSPA13, HDGF, ELAVL1, CUL3, CAND1, FBXO6, ACAD9, FLOT2, CCT2, ABCC2, SFXN1, ILF3, FKBP8, HNRNPM, TCP1, CCT5, ATP6V1C1, CCT4, SRSF1, PSAP, HM13, MDC1, SERPINA1, EDEM1, HSPA5, MYC, ODC1, SERPINF2, ILK, HUWE1, RPS6KB2, NTRK1, ATP5C1, CYC1, DDOST, PHB, ATAD3A, ATAD3B, ATP5L, ATP6V0D1, LMAN1, MAGT1, COX2, NDUFA9, NDUFB8, PHB2, RPN1, SSR3, TECR, TMX1, VDAC3, SSR4, UQCRC2, MED23, TCTN3, TMEM216, EZH2, SORT1, SEC61B, LTN1, ERBB3, ESRRB, DUSP23, ERGIC3, EDEM3FARS2USP45, G3BP2, ICT1, ISG15, CUL3, RCBTB2, KRT13, KRT31, TRIM27, TADA2A, TFCP2, MKRN3, STX11, CALCOCO2, MID2, IKZF3, APPL1, ADAMTSL4, AGTRAP, TRIM54, HMBOX1, CMTM5, KRT40, KRTAP10-7, KRTAP10-9, KRTAP10-5, KRTAP10-3, NOTCH2NL, ENO1, SHMT2, NXF1, HIST1H1A, ZC3H3, HNRNPA1, GAMT, STAT5A, TOMM40, CHST15, NEDD1, CHCHD2, MRPL38, HIST1H1E, HIST1H1T, ZCRB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SSR1_FARS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SSR1_FARS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneFARS2C3554168COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 142ORPHANET;UNIPROT