FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 36122

FusionGeneSummary for SSBP2_LGALS2

check button Fusion gene summary
Fusion gene informationFusion gene name: SSBP2_LGALS2
Fusion gene ID: 36122
HgeneTgene
Gene symbol

SSBP2

LGALS2

Gene ID

23635

3958

Gene namesingle stranded DNA binding protein 2galectin 3
SynonymsHSPC116|SOSS-B2CBP35|GAL3|GALBP|GALIG|L31|LGALS2|MAC2
Cytomap

5q14.1

14q22.3

Type of geneprotein-codingprotein-coding
Descriptionsingle-stranded DNA-binding protein 2sequence-specific single-stranded-DNA-binding protein 2galectin-335 kDa lectinIgE-binding proteinMAC-2 antigenadvanced glycation end-product receptor 3carbohydrate-binding protein 35galactose-specific lectin 3laminin-binding proteinlectin L-29lectin, galactoside-binding, soluble, 3
Modification date2018052320180527
UniProtAcc

P81877

P05162

Ensembl transtripts involved in fusion geneENST00000320672, ENST00000509053, 
ENST00000514493, ENST00000510060, 
ENST00000505980, ENST00000515395, 
ENST00000215886, 
Fusion gene scores* DoF score7 X 6 X 5=2104 X 1 X 4=16
# samples 74
** MAII scorelog2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/16*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SSBP2 [Title/Abstract] AND LGALS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneLGALS2

GO:0002548

monocyte chemotaxis

10925302

TgeneLGALS2

GO:0030593

neutrophil chemotaxis

10925302

TgeneLGALS2

GO:0045806

negative regulation of endocytosis

19706535

TgeneLGALS2

GO:0048245

eosinophil chemotaxis

10925302

TgeneLGALS2

GO:0048246

macrophage chemotaxis

10925302

TgeneLGALS2

GO:0050918

positive chemotaxis

10925302

TgeneLGALS2

GO:0070232

regulation of T cell apoptotic process

8692888

TgeneLGALS2

GO:0071674

mononuclear cell migration

10925302

TgeneLGALS2

GO:0071677

positive regulation of mononuclear cell migration

10925302

TgeneLGALS2

GO:0090280

positive regulation of calcium ion import

10925302

TgeneLGALS2

GO:2001200

positive regulation of dendritic cell differentiation

16116184

TgeneLGALS2

GO:2001237

negative regulation of extrinsic apoptotic signaling pathway

22761016


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-BF-A5EQ-01ASSBP2chr5

80911292

-LGALS2chr22

37967938

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000320672ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-
In-frameENST00000509053ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-
In-frameENST00000514493ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-
intron-3CDSENST00000510060ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-
In-frameENST00000505980ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-
In-frameENST00000515395ENST00000215886SSBP2chr5

80911292

-LGALS2chr22

37967938

-

Top

FusionProtFeatures for SSBP2_LGALS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SSBP2

P81877

LGALS2

P05162

This protein binds beta-galactoside. Its physiologicalfunction is not yet known.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSSBP2chr5:80911292chr22:37967938ENST00000320672-41718_5094362DomainLisH
HgeneSSBP2chr5:80911292chr22:37967938ENST00000505980-41618_5094342DomainLisH
HgeneSSBP2chr5:80911292chr22:37967938ENST00000509053-41518_5094299DomainLisH
HgeneSSBP2chr5:80911292chr22:37967938ENST00000514493-41618_5094332DomainLisH
HgeneSSBP2chr5:80911292chr22:37967938ENST00000515395-41618_5094340DomainLisH
TgeneLGALS2chr5:80911292chr22:37967938ENST00000215886-044_1312133DomainGalectin
TgeneLGALS2chr5:80911292chr22:37967938ENST00000215886-0465_712133RegionBeta-galactoside binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSSBP2chr5:80911292chr22:37967938ENST00000320672-417100_29394362Compositional biasNote=Pro-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000320672-417147_31294362Compositional biasNote=Gly-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000505980-416100_29394342Compositional biasNote=Pro-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000505980-416147_31294342Compositional biasNote=Gly-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000509053-415100_29394299Compositional biasNote=Pro-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000509053-415147_31294299Compositional biasNote=Gly-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000514493-416100_29394332Compositional biasNote=Pro-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000514493-416147_31294332Compositional biasNote=Gly-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000515395-416100_29394340Compositional biasNote=Pro-rich
HgeneSSBP2chr5:80911292chr22:37967938ENST00000515395-416147_31294340Compositional biasNote=Gly-rich


Top

FusionGeneSequence for SSBP2_LGALS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SSBP2_ENST00000320672_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_225aa
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHDYGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTF

>In-frame_SSBP2_ENST00000509053_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_225aa
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHDYGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTF

>In-frame_SSBP2_ENST00000514493_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_225aa
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHDYGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTF

>In-frame_SSBP2_ENST00000505980_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_225aa
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHDYGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTF

>In-frame_SSBP2_ENST00000515395_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_225aa
MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKA
FHDYGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SSBP2_ENST00000320672_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_675nt
ATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTG
CTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTC
TTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCC
TTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACT
GATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAAC
TCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTT
GAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGC

>In-frame_SSBP2_ENST00000509053_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_675nt
ATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTG
CTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTC
TTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCC
TTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACT
GATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAAC
TCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTT
GAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGC

>In-frame_SSBP2_ENST00000514493_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_675nt
ATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTG
CTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTC
TTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCC
TTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACT
GATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAAC
TCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTT
GAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGC

>In-frame_SSBP2_ENST00000505980_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_675nt
ATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTG
CTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTC
TTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCC
TTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACT
GATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAAC
TCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTT
GAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGC

>In-frame_SSBP2_ENST00000515395_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_675nt
ATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTG
CTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTC
TTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCC
TTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACT
GATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAAC
TCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTT
GAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SSBP2_ENST00000320672_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_901nt
GGCTTAGCCGCCACCGCGCGCTTCGGAAGGCCAGAGGGAGGGGGAGGCCTGTCAGTCTCGCGCGTTGCCTGGGCGAAGGGGGCGGAGCTT
TGGCGTGGGGCGGCCAATAGTGGGGGTGGCTGCGTGGGTCGCCATGGGGACGGGGCTGTTCCCGGGGAGGCTGTGATGGGTTGACAGGTG
CGTGACAGTGGGAGCTGCTCTCGGCACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGA
GAAGTTAGCACTCTACGTATATGAATATCTGCTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAA
AAACATCACATTGGGGGAACCACCAGGATTCTTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGA
AACATGTGAACACTCAAGTGAAGCAAAAGCCTTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCT
GAAGATCACAGGCAGCATCGCCGATGGCACTGATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCC
TCGCTTCAGCGAATCCACCATTGTCTGCAACTCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCC
AGGGTCAGAGGTCAAGTTCACAGTGACCTTTGAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAG
GCTGGGTCACAGCCACCTGAGCTACCTGAGCGTAAGGGGCGGGTTCAACATGTCCTCTTTCAAGTTAAAAGAATAAAAGACTTCCAGCCG

>In-frame_SSBP2_ENST00000509053_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_696nt
ACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAA
TATCTGCTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCA
GGATTCTTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCA
AAAGCCTTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGAT
GGCACTGATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTC
TGCAACTCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTG
ACCTTTGAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTAC

>In-frame_SSBP2_ENST00000514493_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_898nt
TTAGCCGCCACCGCGCGCTTCGGAAGGCCAGAGGGAGGGGGAGGCCTGTCAGTCTCGCGCGTTGCCTGGGCGAAGGGGGCGGAGCTTTGG
CGTGGGGCGGCCAATAGTGGGGGTGGCTGCGTGGGTCGCCATGGGGACGGGGCTGTTCCCGGGGAGGCTGTGATGGGTTGACAGGTGCGT
GACAGTGGGAGCTGCTCTCGGCACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAA
GTTAGCACTCTACGTATATGAATATCTGCTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAA
CATCACATTGGGGGAACCACCAGGATTCTTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAAC
ATGTGAACACTCAAGTGAAGCAAAAGCCTTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAA
GATCACAGGCAGCATCGCCGATGGCACTGATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCG
CTTCAGCGAATCCACCATTGTCTGCAACTCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGG
GTCAGAGGTCAAGTTCACAGTGACCTTTGAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCT

>In-frame_SSBP2_ENST00000505980_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_695nt
CAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGTCCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAAT
ATCTGCTCCATGTAGGAGCTCAGAAATCAGCTCAAACATTTTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAG
GATTCTTACATTCTTGGTGGTGTGTATTTTGGGATCTCTACTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAA
AAGCCTTCCATGATTACGGGGAACTTGAGGTTAAGAACATGGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATG
GCACTGATGGCTTTGTAATTAATCTGGGCCAGGGGACAGACAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCT
GCAACTCATTGGACGGCAGCAACTGGGGGCAAGAACAACGGGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGA
CCTTTGAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGGGCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACC

>In-frame_SSBP2_ENST00000515395_chr5_80911292_-_LGALS2_ENST00000215886_chr22_37967938_-_745nt
GAGGCTGTGATGGGTTGACAGGTGCGTGACAGTGGGAGCTGCTCTCGGCACAAGCATGTACGGCAAAGGCAAGAGTAACAGCAGCGCCGT
CCCGTCCGACAGCCAGGCCCGGGAGAAGTTAGCACTCTACGTATATGAATATCTGCTCCATGTAGGAGCTCAGAAATCAGCTCAAACATT
TTTATCAGAGATAAGATGGGAAAAAAACATCACATTGGGGGAACCACCAGGATTCTTACATTCTTGGTGGTGTGTATTTTGGGATCTCTA
CTGTGCAGCTCCAGAGAGACGTGAAACATGTGAACACTCAAGTGAAGCAAAAGCCTTCCATGATTACGGGGAACTTGAGGTTAAGAACAT
GGACATGAAGCCGGGGTCAACCCTGAAGATCACAGGCAGCATCGCCGATGGCACTGATGGCTTTGTAATTAATCTGGGCCAGGGGACAGA
CAAGCTGAACCTGCATTTCAACCCTCGCTTCAGCGAATCCACCATTGTCTGCAACTCATTGGACGGCAGCAACTGGGGGCAAGAACAACG
GGAAGATCACCTGTGCTTCAGCCCAGGGTCAGAGGTCAAGTTCACAGTGACCTTTGAGAGTGACAAATTCAAGGTGAAGCTGCCAGATGG
GCACGAGCTGACTTTTCCCAACAGGCTGGGTCACAGCCACCTGAGCTACCTGAGCGTAAGGGGCGGGTTCAACATGTCCTCTTTCAAGTT


Top

FusionGenePPI for SSBP2_LGALS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SSBP2EWSR1, LDB1, IL36RN, TAL1, LMO2, TRIM33, DYRK2, CDK6, BAG3, TOM1, LDB2, LMX1B, IDI2, ISL2, ISL1, SSBP4, SSBP3, CLEC18A, LMO4, LHX4, LHX6, PIN1, ARHGAP22, ARHGEF10, CAMK2ALGALS2IKBKG, APP, LTA, TUBA1B, TUBB, SDCBP, SDCBP2, TRIM16


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SSBP2_LGALS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SSBP2_LGALS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSSBP2C0033578Prostatic Neoplasms1CTD_human
TgeneLGALS2C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneLGALS2C0027051Myocardial Infarction1CTD_human
TgeneLGALS2C0520459Necrotizing Enterocolitis1CTD_human