FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35912

FusionGeneSummary for SRCAP_RPS4Y1

check button Fusion gene summary
Fusion gene informationFusion gene name: SRCAP_RPS4Y1
Fusion gene ID: 35912
HgeneTgene
Gene symbol

SRCAP

RPS4Y1

Gene ID

10847

6192

Gene nameSnf2 related CREBBP activator proteinribosomal protein S4 Y-linked 1
SynonymsDOMO1|EAF1|FLHS|SWR1RPS4Y|S4
Cytomap

16p11.2

Yp11.2

Type of geneprotein-codingprotein-coding
Descriptionhelicase SRCAPSnf2-related CBP activator proteinSwi2/Snf2-related ATPase homolog, domino homolog 1domino homolog 240S ribosomal protein S4, Y isoform 140S ribosomal protein S4, Yribosomal protein S4, Y-linkedribosomal protein S4Ysmall ribosomal subunit protein eS4
Modification date2018052320180523
UniProtAcc

Q6ZRS2

P22090

Ensembl transtripts involved in fusion geneENST00000344771, ENST00000395059, 
ENST00000262518, 
ENST00000250784, 
ENST00000477725, 
Fusion gene scores* DoF score7 X 9 X 4=2525 X 5 X 3=75
# samples 96
** MAII scorelog2(9/252*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SRCAP [Title/Abstract] AND RPS4Y1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-06-0132-01ASRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000344771ENST00000250784SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
5CDS-3UTRENST00000344771ENST00000477725SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
In-frameENST00000395059ENST00000250784SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
5CDS-3UTRENST00000395059ENST00000477725SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
In-frameENST00000262518ENST00000250784SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+
5CDS-3UTRENST00000262518ENST00000477725SRCAPchr16

30727800

+RPS4Y1chrY

2722641

+

Top

FusionProtFeatures for SRCAP_RPS4Y1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SRCAP

Q6ZRS2

RPS4Y1

P22090

Catalytic component of the SRCAP complex which mediatesthe ATP-dependent exchange of histone H2AZ/H2B dimers fornucleosomal H2A/H2B, leading to transcriptional regulation ofselected genes by chromatin remodeling. Acts as a coactivator forCREB-mediated transcription, steroid receptor-mediatedtranscription, and Notch-mediated transcription.{ECO:0000269|PubMed:10347196, ECO:0000269|PubMed:11522779,ECO:0000269|PubMed:14500758, ECO:0000269|PubMed:16024792,ECO:0000269|PubMed:16634648, ECO:0000269|PubMed:17617668}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834275_2789393231Compositional biasNote=Poly-Pro
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834293_5639393231Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832275_2789393073Compositional biasNote=Poly-Pro
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832293_5639393073Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833275_2789393169Compositional biasNote=Poly-Pro
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833293_5639393169Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834124_1969393231DomainHSA
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834630_7959393231DomainHelicase ATP-binding
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832124_1969393073DomainHSA
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832630_7959393073DomainHelicase ATP-binding
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833124_1969393169DomainHSA
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833630_7959393169DomainHelicase ATP-binding
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834643_6509393231Nucleotide bindingATP
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832643_6509393073Nucleotide bindingATP
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833643_6509393169Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18342227_23629393231Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18342426_30239393231Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18343179_31829393231Compositional biasNote=Poly-Glu
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+1834981_18839393231Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18322227_23629393073Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18322426_30239393073Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18323179_31829393073Compositional biasNote=Poly-Glu
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+1832981_18839393073Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18332227_23629393169Compositional biasNote=Glu-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18332426_30239393169Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18333179_31829393169Compositional biasNote=Poly-Glu
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+1833981_18839393169Compositional biasNote=Pro-rich
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18342857_28699393231DNA bindingNote=A.T hook 1
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18342936_29489393231DNA bindingNote=A.T hook 2
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18343004_30169393231DNA bindingNote=A.T hook 3
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18322857_28699393073DNA bindingNote=A.T hook 1
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18322936_29489393073DNA bindingNote=A.T hook 2
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18323004_30169393073DNA bindingNote=A.T hook 3
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18332857_28699393169DNA bindingNote=A.T hook 1
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18332936_29489393169DNA bindingNote=A.T hook 2
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18333004_30169393169DNA bindingNote=A.T hook 3
HgeneSRCAPchr16:30727800chrY:2722641ENST00000262518+18342044_21979393231DomainHelicase C-terminal
HgeneSRCAPchr16:30727800chrY:2722641ENST00000344771+18322044_21979393073DomainHelicase C-terminal
HgeneSRCAPchr16:30727800chrY:2722641ENST00000395059+18332044_21979393169DomainHelicase C-terminal
TgeneRPS4Y1chr16:30727800chrY:2722641ENST00000250784+3742_104120264DomainNote=S4 RNA-binding


Top

FusionGeneSequence for SRCAP_RPS4Y1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SRCAP_ENST00000344771_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_1083aa
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWE
KSHAEIAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDTLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQSLNQPLTSSKAGSSPCLGSSS
AASSPPPPASRLDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD
TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAREGELSMEELLQQ
TAGATAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLV
TMTEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYTGAQKERKLKRQGWTKPNAFHV
CITSYKLVLQDHQAFRRKNWRTLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNP
LTGMIEGSQETNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIRCRLSKRQRCLTDDFMAQTTTKETLATGHFMSVINILMQLRKV
CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIIN
FIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQS

>In-frame_SRCAP_ENST00000395059_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_1083aa
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWE
KSHAEIAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDTLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQSLNQPLTSSKAGSSPCLGSSS
AASSPPPPASRLDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD
TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAREGELSMEELLQQ
TAGATAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLV
TMTEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYTGAQKERKLKRQGWTKPNAFHV
CITSYKLVLQDHQAFRRKNWRTLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNP
LTGMIEGSQETNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIRCRLSKRQRCLTDDFMAQTTTKETLATGHFMSVINILMQLRKV
CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIIN
FIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQS

>In-frame_SRCAP_ENST00000262518_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_1083aa
MQSSPSPAHPQLPVLQTQMVSDGMTGSNPVSPASSSSPASSGAGGISPQHIAQDSSLDGPPGPPDGATVPLEGFSLSQAADLANKGPKWE
KSHAEIAEQAKHEAEIETRIAELRKEGFWSLKRLPKVPEPPRPKGHWDTLCEEMQWLSADFAQERRWKRGVARKVVRMVIRHHEEQRQKE
ERARREEQAKLRRIASTMAKDVRQFWSNVEKVVQFKQQSRLEEKRKKALDLHLDFIVGQTEKYSDLLSQSLNQPLTSSKAGSSPCLGSSS
AASSPPPPASRLDDEDGDFQPQEDEEEDDEETIEVEEQQEGNDAEAQRREIELLRREGELPLEELLRSLPPQLLEGPSSPSQTPSSHDSD
TRDGPEEGAEEEPPQVLEIKPPPSAVTQRNKQPWHPDEDDEEFTANEEEAEDEEDTIAAEEQLEGEVDHAMELSELAREGELSMEELLQQ
TAGATAPGSGSSEDEDEDEVDANSSDCEPEGPVEAEEPPQEDSSSQSDSVEDRSEDEEDEHSEEEETSGSSASEESESEESEDAQSQSQA
DEEEEDDDFGVEYLLARDEEQSEADAGSGPPTPGPTTLGPKKEITDIAAAAESLQPKGYTLATTQVKTPIPLLLRGQLREYQHIGLDWLV
TMTEKKLNGILADEMGLGKTIQTISLLAHLACEKGNWGPHLIIVPTSVMLNWEMELKRWCPSFKILTYTGAQKERKLKRQGWTKPNAFHV
CITSYKLVLQDHQAFRRKNWRTLILDEAQNIKNFKSQRWQSLLNFNSQRRLLLTGTPLQNSLMELWSLMHFLMPHVFQSHREFKEWFSNP
LTGMIEGSQETNEGLVKRLHKVLRPFLLRRVKVDVEKQMPKKYEHVIRCRLSKRQRCLTDDFMAQTTTKETLATGHFMSVINILMQLRKV
CNHPNLFDPRPVTSPFITPGICFSTASLVLRATDVHPLQYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIIN
FIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SRCAP_ENST00000344771_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_3249nt
ATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGACGGCATGACAGGCAGCAATCCTGTG
TCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGCTCAAGATTCCTCACTGGATGGACCT
CCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCTGGCTAACAAGGGCCCGAAGTGGGAG
AAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGAGCTGCGGAAGGAGGGTTTCTGGTCA
CTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGAAGAGATGCAGTGGCTCTCTGCTGAC
TTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCACCACGAGGAGCAGCGGCAGAAAGAG
GAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGTCAGGCAGTTCTGGAGCAATGTGGAG
AAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCATTTGGACTTCATTGTGGGGCAAACT
GAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTCTTCCCCTTGCCTCGGCTCTTCCTCA
GCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCAAGAGGATGAGGAAGAGGATGATGAG
GAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGAGCTGCTTCGCCGTGAGGGAGAATTG
CCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCAAACCCCCTCATCTCATGATAGTGAC
ACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCCACCCTCTGCTGTCACACAGCGCAAC
AAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGATGAAGAGGATACTATAGCAGCTGAG
GAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCTTTCCATGGAGGAGCTATTGCAGCAG
TATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGCTAATAGCTCTGACTGTGAACCAGAG
GGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGACCGGAGTGAGGATGAGGAAGATGAA
CATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGAGGATGCCCAATCACAGAGCCAAGCA
GATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAGTGAGGCAGATGCAGGCAGTGGGCCT
CCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGAAAGTCTCCAGCCCAAGGGTTACACG
CTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCAGCACATTGGGCTAGACTGGCTGGTT
ACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCAGACCATCTCTCTGCTTGCCCACTTG
GCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTGGGAGATGGAGTTGAAACGGTGGTGC
CCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTGGACCAAGCCCAATGCCTTTCATGTG
TGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTATCTCATTCTGGATGAGGCGCAGAAC
ATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCTCCTGACAGGAACTCCCTTGCAGAAC
AGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGAGTTCAAGGAGTGGTTCTCTAATCCC
CTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGTTTTGAGGCCTTTTTTACTGCGCCGA
GTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTCCAAGCGTCAACGCTGTCTCTATGAT
GACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAACATTTTGATGCAGCTGAGAAAAGTT
TGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTGCTTCAGCACCGCCTCTCTGGTGCTA
AGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGTGAAGGGAATCCCTCACCTGGTGACT
CATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGATTTAGGGACTGGCAAGATAATCAAC
TTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGGGAAAGACAT
CCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATTGGCAATGGC
AATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACCAAACAGAGC

>In-frame_SRCAP_ENST00000395059_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_3249nt
ATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGACGGCATGACAGGCAGCAATCCTGTG
TCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGCTCAAGATTCCTCACTGGATGGACCT
CCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCTGGCTAACAAGGGCCCGAAGTGGGAG
AAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGAGCTGCGGAAGGAGGGTTTCTGGTCA
CTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGAAGAGATGCAGTGGCTCTCTGCTGAC
TTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCACCACGAGGAGCAGCGGCAGAAAGAG
GAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGTCAGGCAGTTCTGGAGCAATGTGGAG
AAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCATTTGGACTTCATTGTGGGGCAAACT
GAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTCTTCCCCTTGCCTCGGCTCTTCCTCA
GCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCAAGAGGATGAGGAAGAGGATGATGAG
GAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGAGCTGCTTCGCCGTGAGGGAGAATTG
CCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCAAACCCCCTCATCTCATGATAGTGAC
ACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCCACCCTCTGCTGTCACACAGCGCAAC
AAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGATGAAGAGGATACTATAGCAGCTGAG
GAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCTTTCCATGGAGGAGCTATTGCAGCAG
TATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGCTAATAGCTCTGACTGTGAACCAGAG
GGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGACCGGAGTGAGGATGAGGAAGATGAA
CATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGAGGATGCCCAATCACAGAGCCAAGCA
GATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAGTGAGGCAGATGCAGGCAGTGGGCCT
CCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGAAAGTCTCCAGCCCAAGGGTTACACG
CTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCAGCACATTGGGCTAGACTGGCTGGTT
ACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCAGACCATCTCTCTGCTTGCCCACTTG
GCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTGGGAGATGGAGTTGAAACGGTGGTGC
CCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTGGACCAAGCCCAATGCCTTTCATGTG
TGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTATCTCATTCTGGATGAGGCGCAGAAC
ATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCTCCTGACAGGAACTCCCTTGCAGAAC
AGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGAGTTCAAGGAGTGGTTCTCTAATCCC
CTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGTTTTGAGGCCTTTTTTACTGCGCCGA
GTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTCCAAGCGTCAACGCTGTCTCTATGAT
GACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAACATTTTGATGCAGCTGAGAAAAGTT
TGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTGCTTCAGCACCGCCTCTCTGGTGCTA
AGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGTGAAGGGAATCCCTCACCTGGTGACT
CATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGATTTAGGGACTGGCAAGATAATCAAC
TTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGGGAAAGACAT
CCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATTGGCAATGGC
AATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACCAAACAGAGC

>In-frame_SRCAP_ENST00000262518_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_3249nt
ATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGACGGCATGACAGGCAGCAATCCTGTG
TCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGCTCAAGATTCCTCACTGGATGGACCT
CCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCTGGCTAACAAGGGCCCGAAGTGGGAG
AAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGAGCTGCGGAAGGAGGGTTTCTGGTCA
CTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGAAGAGATGCAGTGGCTCTCTGCTGAC
TTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCACCACGAGGAGCAGCGGCAGAAAGAG
GAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGTCAGGCAGTTCTGGAGCAATGTGGAG
AAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCATTTGGACTTCATTGTGGGGCAAACT
GAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTCTTCCCCTTGCCTCGGCTCTTCCTCA
GCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCAAGAGGATGAGGAAGAGGATGATGAG
GAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGAGCTGCTTCGCCGTGAGGGAGAATTG
CCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCAAACCCCCTCATCTCATGATAGTGAC
ACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCCACCCTCTGCTGTCACACAGCGCAAC
AAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGATGAAGAGGATACTATAGCAGCTGAG
GAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCTTTCCATGGAGGAGCTATTGCAGCAG
TATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGCTAATAGCTCTGACTGTGAACCAGAG
GGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGACCGGAGTGAGGATGAGGAAGATGAA
CATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGAGGATGCCCAATCACAGAGCCAAGCA
GATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAGTGAGGCAGATGCAGGCAGTGGGCCT
CCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGAAAGTCTCCAGCCCAAGGGTTACACG
CTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCAGCACATTGGGCTAGACTGGCTGGTT
ACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCAGACCATCTCTCTGCTTGCCCACTTG
GCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTGGGAGATGGAGTTGAAACGGTGGTGC
CCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTGGACCAAGCCCAATGCCTTTCATGTG
TGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTATCTCATTCTGGATGAGGCGCAGAAC
ATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCTCCTGACAGGAACTCCCTTGCAGAAC
AGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGAGTTCAAGGAGTGGTTCTCTAATCCC
CTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGTTTTGAGGCCTTTTTTACTGCGCCGA
GTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTCCAAGCGTCAACGCTGTCTCTATGAT
GACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAACATTTTGATGCAGCTGAGAAAAGTT
TGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTGCTTCAGCACCGCCTCTCTGGTGCTA
AGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGTGAAGGGAATCCCTCACCTGGTGACT
CATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGATTTAGGGACTGGCAAGATAATCAAC
TTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGGTGTGATCACCAACAGGGAAAGACAT
CCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTCCAACATTTTTGTCATTGGCAATGGC
AATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGATAAGAGGCTGGCCACCAAACAGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SRCAP_ENST00000344771_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_4008nt
AACTTGGGCAGAGGTCAGGGGTCACGCGAGGTCAGTCCGTCGGGAGGGCTAGGGAGATGGTCACGAAACCTGAAGTCAAGAGTTAAGGCT
TGTTGGCTTCTGGTGTGATTCCCTTCAGTACGGCGGCACCGTGGAAGTGCAGACTTTCACAGGGGGTGTGGTCTCAGCTCACACAGGTGC
TCCAGAGGCTGGTGGACCTGAGCGGAGGCTGGGACGCCCTGGTGGGCCCCGGGCCCTGGAAGGCGGGTCCCGGTGGCCGGTGGCCCAGAA
TGAGGCCAGCTCCCAGCATGCCCTGCAGCCGGACGCCAGCCCCTCGGCCAGCAGTACTGGTGATAACAACCCAGTCATTCTTCAGGCATC
CAAGGGGGAGCCTGGGAGTGGGACCATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGA
CGGCATGACAGGCAGCAATCCTGTGTCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGC
TCAAGATTCCTCACTGGATGGACCTCCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCT
GGCTAACAAGGGCCCGAAGTGGGAGAAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGA
GCTGCGGAAGGAGGGTTTCTGGTCACTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGA
AGAGATGCAGTGGCTCTCTGCTGACTTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCA
CCACGAGGAGCAGCGGCAGAAAGAGGAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGT
CAGGCAGTTCTGGAGCAATGTGGAGAAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCA
TTTGGACTTCATTGTGGGGCAAACTGAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTC
TTCCCCTTGCCTCGGCTCTTCCTCAGCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCA
AGAGGATGAGGAAGAGGATGATGAGGAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGA
GCTGCTTCGCCGTGAGGGAGAATTGCCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCA
AACCCCCTCATCTCATGATAGTGACACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCC
ACCCTCTGCTGTCACACAGCGCAACAAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGA
TGAAGAGGATACTATAGCAGCTGAGGAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCT
TTCCATGGAGGAGCTATTGCAGCAGTATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGC
TAATAGCTCTGACTGTGAACCAGAGGGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGA
CCGGAGTGAGGATGAGGAAGATGAACATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGA
GGATGCCCAATCACAGAGCCAAGCAGATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAG
TGAGGCAGATGCAGGCAGTGGGCCTCCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGA
AAGTCTCCAGCCCAAGGGTTACACGCTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCA
GCACATTGGGCTAGACTGGCTGGTTACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCA
GACCATCTCTCTGCTTGCCCACTTGGCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTG
GGAGATGGAGTTGAAACGGTGGTGCCCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTG
GACCAAGCCCAATGCCTTTCATGTGTGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTA
TCTCATTCTGGATGAGGCGCAGAACATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCT
CCTGACAGGAACTCCCTTGCAGAACAGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGA
GTTCAAGGAGTGGTTCTCTAATCCCCTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGT
TTTGAGGCCTTTTTTACTGCGCCGAGTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTC
CAAGCGTCAACGCTGTCTCTATGATGACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAA
CATTTTGATGCAGCTGAGAAAAGTTTGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTG
CTTCAGCACCGCCTCTCTGGTGCTAAGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGT
GAAGGGAATCCCTCACCTGGTGACTCATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGA
TTTAGGGACTGGCAAGATAATCAACTTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGG
TGTGATCACCAACAGGGAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTC
CAACATTTTTGTCATTGGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGA
TAAGAGGCTGGCCACCAAACAGAGCAGTGGCTAAATTGCAGTAGCAGCATATCTTTTTTTCTTTGCACAAATAAACAGTGAATTCTCGTT
TCTTAATGTGTTTTTTCCCCCTTGTGGATAATAGTAGGGTTTGAATTTGCTCATGATTTTGGCACTGTCTTAAGATCTCTAGGAATACCA
CCTATACTTCCTCTGACCCTCCAGTAAATAAACCTTTGCTTCCCTCATACATGTTACCCACACCATCTCTGTGGGCAGAGTGATGGAGTA
GCATTCCAAAACGAAGTACAAAAAACGTATGACATTTCAGAAAGGACGGCATTCTTTTGTGGAAGCTATGGGAGATGGTCTTAGTTTTCT

>In-frame_SRCAP_ENST00000395059_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_4008nt
AACTTGGGCAGAGGTCAGGGGTCACGCGAGGTCAGTCCGTCGGGAGGGCTAGGGAGATGGTCACGAAACCTGAAGTCAAGAGTTAAGGCT
TGTTGGCTTCTGGTGTGATTCCCTTCAGTACGGCGGCACCGTGGAAGTGCAGACTTTCACAGGGGGTGTGGTCTCAGCTCACACAGGTGC
TCCAGAGGCTGGTGGACCTGAGCGGAGGCTGGGACGCCCTGGTGGGCCCCGGGCCCTGGAAGGCGGGTCCCGGTGGCCGGTGGCCCAGAA
TGAGGCCAGCTCCCAGCATGCCCTGCAGCCGGACGCCAGCCCCTCGGCCAGCAGTACTGGTGATAACAACCCAGTCATTCTTCAGGCATC
CAAGGGGGAGCCTGGGAGTGGGACCATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGA
CGGCATGACAGGCAGCAATCCTGTGTCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGC
TCAAGATTCCTCACTGGATGGACCTCCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCT
GGCTAACAAGGGCCCGAAGTGGGAGAAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGA
GCTGCGGAAGGAGGGTTTCTGGTCACTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGA
AGAGATGCAGTGGCTCTCTGCTGACTTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCA
CCACGAGGAGCAGCGGCAGAAAGAGGAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGT
CAGGCAGTTCTGGAGCAATGTGGAGAAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCA
TTTGGACTTCATTGTGGGGCAAACTGAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTC
TTCCCCTTGCCTCGGCTCTTCCTCAGCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCA
AGAGGATGAGGAAGAGGATGATGAGGAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGA
GCTGCTTCGCCGTGAGGGAGAATTGCCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCA
AACCCCCTCATCTCATGATAGTGACACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCC
ACCCTCTGCTGTCACACAGCGCAACAAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGA
TGAAGAGGATACTATAGCAGCTGAGGAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCT
TTCCATGGAGGAGCTATTGCAGCAGTATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGC
TAATAGCTCTGACTGTGAACCAGAGGGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGA
CCGGAGTGAGGATGAGGAAGATGAACATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGA
GGATGCCCAATCACAGAGCCAAGCAGATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAG
TGAGGCAGATGCAGGCAGTGGGCCTCCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGA
AAGTCTCCAGCCCAAGGGTTACACGCTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCA
GCACATTGGGCTAGACTGGCTGGTTACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCA
GACCATCTCTCTGCTTGCCCACTTGGCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTG
GGAGATGGAGTTGAAACGGTGGTGCCCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTG
GACCAAGCCCAATGCCTTTCATGTGTGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTA
TCTCATTCTGGATGAGGCGCAGAACATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCT
CCTGACAGGAACTCCCTTGCAGAACAGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGA
GTTCAAGGAGTGGTTCTCTAATCCCCTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGT
TTTGAGGCCTTTTTTACTGCGCCGAGTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTC
CAAGCGTCAACGCTGTCTCTATGATGACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAA
CATTTTGATGCAGCTGAGAAAAGTTTGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTG
CTTCAGCACCGCCTCTCTGGTGCTAAGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGT
GAAGGGAATCCCTCACCTGGTGACTCATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGA
TTTAGGGACTGGCAAGATAATCAACTTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGG
TGTGATCACCAACAGGGAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTC
CAACATTTTTGTCATTGGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGA
TAAGAGGCTGGCCACCAAACAGAGCAGTGGCTAAATTGCAGTAGCAGCATATCTTTTTTTCTTTGCACAAATAAACAGTGAATTCTCGTT
TCTTAATGTGTTTTTTCCCCCTTGTGGATAATAGTAGGGTTTGAATTTGCTCATGATTTTGGCACTGTCTTAAGATCTCTAGGAATACCA
CCTATACTTCCTCTGACCCTCCAGTAAATAAACCTTTGCTTCCCTCATACATGTTACCCACACCATCTCTGTGGGCAGAGTGATGGAGTA
GCATTCCAAAACGAAGTACAAAAAACGTATGACATTTCAGAAAGGACGGCATTCTTTTGTGGAAGCTATGGGAGATGGTCTTAGTTTTCT

>In-frame_SRCAP_ENST00000262518_chr16_30727800_+_RPS4Y1_ENST00000250784_chrY_2722641_+_4008nt
AACTTGGGCAGAGGTCAGGGGTCACGCGAGGTCAGTCCGTCGGGAGGGCTAGGGAGATGGTCACGAAACCTGAAGTCAAGAGTTAAGGCT
TGTTGGCTTCTGGTGTGATTCCCTTCAGTACGGCGGCACCGTGGAAGTGCAGACTTTCACAGGGGGTGTGGTCTCAGCTCACACAGGTGC
TCCAGAGGCTGGTGGACCTGAGCGGAGGCTGGGACGCCCTGGTGGGCCCCGGGCCCTGGAAGGCGGGTCCCGGTGGCCGGTGGCCCAGAA
TGAGGCCAGCTCCCAGCATGCCCTGCAGCCGGACGCCAGCCCCTCGGCCAGCAGTACTGGTGATAACAACCCAGTCATTCTTCAGGCATC
CAAGGGGGAGCCTGGGAGTGGGACCATGCAGAGCAGCCCCTCCCCTGCTCACCCTCAGCTCCCAGTCCTACAGACACAGATGGTGTCGGA
CGGCATGACAGGCAGCAATCCTGTGTCCCCTGCCTCATCCAGTTCCCCAGCCTCTAGTGGGGCAGGCGGCATCTCCCCGCAGCACATAGC
TCAAGATTCCTCACTGGATGGACCTCCAGGCCCCCCAGATGGTGCCACAGTGCCCCTGGAGGGGTTCAGCTTATCCCAGGCTGCTGACCT
GGCTAACAAGGGCCCGAAGTGGGAGAAGAGCCATGCCGAAATTGCAGAACAGGCCAAGCATGAGGCCGAGATCGAGACTCGGATTGCTGA
GCTGCGGAAGGAGGGTTTCTGGTCACTGAAGAGGCTGCCTAAGGTGCCAGAGCCCCCTCGCCCCAAAGGTCACTGGGACTATTTGTGCGA
AGAGATGCAGTGGCTCTCTGCTGACTTTGCTCAGGAGCGCCGTTGGAAACGGGGTGTGGCCCGGAAGGTGGTGCGCATGGTGATCCGGCA
CCACGAGGAGCAGCGGCAGAAAGAGGAACGGGCCCGGAGGGAGGAGCAGGCCAAGCTGCGTCGAATTGCTTCCACCATGGCCAAGGATGT
CAGGCAGTTCTGGAGCAATGTGGAGAAGGTGGTGCAATTCAAGCAACAGTCCCGGCTTGAGGAAAAGCGCAAAAAAGCCCTGGACCTGCA
TTTGGACTTCATTGTGGGGCAAACTGAAAAGTACTCGGACCTTCTGTCTCAGAGCCTCAACCAGCCATTAACCTCCAGCAAAGCAGGCTC
TTCCCCTTGCCTCGGCTCTTCCTCAGCTGCCTCCAGTCCTCCACCCCCTGCTTCTCGCCTGGATGATGAAGATGGGGACTTTCAACCCCA
AGAGGATGAGGAAGAGGATGATGAGGAAACGATTGAAGTTGAAGAACAACAGGAAGGCAATGATGCAGAGGCCCAGAGGCGTGAGATTGA
GCTGCTTCGCCGTGAGGGAGAATTGCCACTGGAAGAGCTGCTCCGTTCCCTTCCCCCTCAGCTGTTGGAAGGGCCTTCCAGCCCCTCTCA
AACCCCCTCATCTCATGATAGTGACACCCGAGATGGGCCTGAAGAAGGTGCTGAAGAAGAGCCCCCTCAGGTGTTGGAGATAAAGCCCCC
ACCCTCTGCTGTCACACAGCGCAACAAACAGCCTTGGCATCCAGATGAAGATGATGAAGAGTTTACTGCCAACGAAGAGGAAGCGGAGGA
TGAAGAGGATACTATAGCAGCTGAGGAACAGTTGGAAGGGGAGGTGGATCATGCCATGGAGCTGAGCGAGTTGGCTCGAGAAGGTGAGCT
TTCCATGGAGGAGCTATTGCAGCAGTATGCAGGAGCCTATGCCCCAGGCTCTGGGAGCAGTGAAGATGAGGATGAAGATGAGGTTGATGC
TAATAGCTCTGACTGTGAACCAGAGGGGCCCGTGGAAGCGGAAGAGCCTCCTCAGGAGGATAGTAGCAGTCAGTCAGACTCTGTGGAGGA
CCGGAGTGAGGATGAGGAAGATGAACATTCAGAGGAGGAAGAAACAAGTGGAAGTTCAGCATCAGAGGAATCTGAGTCTGAAGAGTCTGA
GGATGCCCAATCACAGAGCCAAGCAGATGAAGAGGAGGAAGATGATGATTTTGGGGTGGAGTACTTGCTTGCCAGGGATGAAGAGCAGAG
TGAGGCAGATGCAGGCAGTGGGCCTCCTACTCCAGGGCCCACTACTCTAGGTCCAAAGAAAGAAATTACTGACATTGCTGCAGCAGCTGA
AAGTCTCCAGCCCAAGGGTTACACGCTGGCCACGACCCAGGTAAAGACGCCCATTCCCCTGCTTCTGCGGGGCCAGCTCCGGGAGTACCA
GCACATTGGGCTAGACTGGCTGGTTACCATGTATGAGAAGAAGCTTAATGGCATTCTTGCTGATGAGATGGGGCTTGGGAAGACCATCCA
GACCATCTCTCTGCTTGCCCACTTGGCTTGTGAGAAAGGTAACTGGGGTCCCCATTTAATCATTGTTCCCACCAGCGTGATGTTGAACTG
GGAGATGGAGTTGAAACGGTGGTGCCCCAGCTTTAAAATCCTCACTTACTATGGAGCCCAGAAAGAGAGGAAGCTCAAGCGGCAGGGCTG
GACCAAGCCCAATGCCTTTCATGTGTGTATCACATCTTACAAGCTGGTGCTGCAGGACCACCAGGCCTTCCGTCGCAAGAACTGGCGCTA
TCTCATTCTGGATGAGGCGCAGAACATCAAGAACTTCAAGTCACAGCGCTGGCAGTCACTCCTCAACTTCAACAGCCAGAGACGCCTGCT
CCTGACAGGAACTCCCTTGCAGAACAGCCTCATGGAGCTGTGGTCCTTGATGCACTTTTTGATGCCCCATGTCTTCCAGTCTCATCGCGA
GTTCAAGGAGTGGTTCTCTAATCCCCTAACTGGCATGATTGAGGGCAGCCAAGAGTATAATGAAGGTCTAGTCAAACGCCTCCACAAGGT
TTTGAGGCCTTTTTTACTGCGCCGAGTTAAGGTGGATGTTGAGAAGCAGATGCCCAAAAAGTACGAGCATGTTATCCGCTGCAGGCTCTC
CAAGCGTCAACGCTGTCTCTATGATGACTTCATGGCACAGACCACAACTAAGGAGACACTAGCCACAGGCCATTTCATGAGCGTCATCAA
CATTTTGATGCAGCTGAGAAAAGTTTGCAATCATCCAAATCTGTTCGACCCTCGACCGGTTACCTCCCCTTTCATCACCCCAGGCATCTG
CTTCAGCACCGCCTCTCTGGTGCTAAGGGCCACGGATGTCCATCCCCTCCAGTACAAGTTGTGCAAAGTGAGGAAGATTACTGTGGGAGT
GAAGGGAATCCCTCACCTGGTGACTCATGATGCTCGAACCATCCGCTACCCAGATCCTGTCATCAAGGTGAACGATACTGTGCAGATTGA
TTTAGGGACTGGCAAGATAATCAACTTTATCAAATTTGATACAGGCAATTTGTGTATGGTGATTGGTGGAGCCAACCTCGGTCGTGTTGG
TGTGATCACCAACAGGGAAAGACATCCTGGTTCTTTTGATGTGGTGCATGTGAAGGATGCCAATGGCAACAGCTTTGCCACGAGGCTTTC
CAACATTTTTGTCATTGGCAATGGCAATAAACCTTGGATTTCCCTGCCCAGGGGAAAGGGCATTCGACTTACTGTTGCTGAAGAGAGAGA
TAAGAGGCTGGCCACCAAACAGAGCAGTGGCTAAATTGCAGTAGCAGCATATCTTTTTTTCTTTGCACAAATAAACAGTGAATTCTCGTT
TCTTAATGTGTTTTTTCCCCCTTGTGGATAATAGTAGGGTTTGAATTTGCTCATGATTTTGGCACTGTCTTAAGATCTCTAGGAATACCA
CCTATACTTCCTCTGACCCTCCAGTAAATAAACCTTTGCTTCCCTCATACATGTTACCCACACCATCTCTGTGGGCAGAGTGATGGAGTA
GCATTCCAAAACGAAGTACAAAAAACGTATGACATTTCAGAAAGGACGGCATTCTTTTGTGGAAGCTATGGGAGATGGTCTTAGTTTTCT


Top

FusionGenePPI for SRCAP_RPS4Y1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SRCAPNCOR1, RUVBL2, CARM1, EP300, CREBBP, MORF4L1, MORF4L2, MRGBP, AR, DMAP1, KAT5, H2AFZ, VPS72, RUVBL1, IK, SARNP, CFDP1, CDK9, SAFB2, MSN, HECW2, OBSL1, QPRT, CARD8, ACTR6, HIST1H2BA, YEATS4, HIST1H2BG, PDK1, MAU2, NUF2, DIS3L, RNF168, P4HA3, NFATC2IP, ACTBL2, ZNHIT1RPS4Y1CALM1, CD81, IGSF8, ICAM1, RNF2, RPS4Y2, PRPS1, CLK1, ZNF746, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SRCAP_RPS4Y1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SRCAP_RPS4Y1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSRCAPC0010606Adenoid Cystic Carcinoma1CTD_human