FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35645

FusionGeneSummary for SPEN_CTRC

check button Fusion gene summary
Fusion gene informationFusion gene name: SPEN_CTRC
Fusion gene ID: 35645
HgeneTgene
Gene symbol

SPEN

CTRC

Gene ID

64783

11330

Gene nameRNA binding motif protein 15chymotrypsin C
SynonymsOTT|OTT1|SPENCLCR|ELA4
Cytomap

1p13.3

1p36.21

Type of geneprotein-codingprotein-coding
Descriptionputative RNA-binding protein 15one twenty two proteinone twenty-twoone-twenty two protein 1chymotrypsin-Ccaldecrinelastase 4elastase IVserum calcium decreasing factor
Modification date2018052320180520
UniProtAcc

Q96T58

Q99895

Ensembl transtripts involved in fusion geneENST00000375759, ENST00000471538, 
ENST00000375949, ENST00000375943, 
ENST00000483406, 
Fusion gene scores* DoF score15 X 10 X 12=18001 X 1 X 1=1
# samples 221
** MAII scorelog2(22/1800*10)=-3.03242147769238
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: SPEN [Title/Abstract] AND CTRC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSPEN

GO:0045892

negative regulation of transcription, DNA-templated

16129689


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVKIRPTCGA-DZ-6131-01ASPENchr1

16199631

+CTRCchr1

15768943

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000375759ENST00000375949SPENchr1

16199631

+CTRCchr1

15768943

+
Frame-shiftENST00000375759ENST00000375943SPENchr1

16199631

+CTRCchr1

15768943

+
5CDS-3UTRENST00000375759ENST00000483406SPENchr1

16199631

+CTRCchr1

15768943

+
intron-3CDSENST00000471538ENST00000375949SPENchr1

16199631

+CTRCchr1

15768943

+
intron-3CDSENST00000471538ENST00000375943SPENchr1

16199631

+CTRCchr1

15768943

+
intron-3UTRENST00000471538ENST00000483406SPENchr1

16199631

+CTRCchr1

15768943

+

Top

FusionProtFeatures for SPEN_CTRC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SPEN

Q96T58

CTRC

Q99895

May serve as a nuclear matrix platform that organizesand integrates transcriptional responses. In osteoblasts, supportstranscription activation: synergizes with RUNX2 to enhance FGFR2-mediated activation of the osteocalcin FGF-responsive element(OCFRE) (By similarity). Has also been shown to be an essentialcorepressor protein, which probably regulates different keypathways such as the Notch pathway. Negative regulator of theNotch pathway via its interaction with RBPSUH, which prevents theassociation between NOTCH1 and RBPSUH, and therefore suppressesthe transactivation activity of Notch signaling. Blocks thedifferentiation of precursor B-cells into marginal zone B-cells.Probably represses transcription via the recruitment of largecomplexes containing histone deacetylase proteins. May bind bothto DNA and RNA. {ECO:0000250, ECO:0000269|PubMed:11331609,ECO:0000269|PubMed:12374742}. Regulates activation and degradation of trypsinogens andprocarboxypeptidases by targeting specific cleavage sites withintheir zymogen precursors. Has chymotrypsin-type protease activityand hypocalcemic activity. {ECO:0000269|PubMed:23430245}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2156_811343665DomainRRM 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151170_11911343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151408_14281343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151496_15291343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151592_16121343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151928_19441343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215688_7151343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215977_10041343665Coiled coilOntology_term=ECO:0000255
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215125_2771343665Compositional biasNote=Arg-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215240_3251343665Compositional biasNote=Ser-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2152428_25201343665Compositional biasNote=Pro-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2153220_34821343665Compositional biasNote=Pro-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215616_8101343665Compositional biasNote=Arg-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215624_6971343665Compositional biasNote=Tyr-rich
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2151_5731343665DNA bindingOntology_term=ECO:0000250
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2152201_27071343665DomainNote=RID
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215335_4151343665DomainRRM 2
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2153498_36641343665DomainSPOC
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215438_5131343665DomainRRM 3
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+215517_5891343665DomainRRM 4
TgeneCTRCchr1:16199631chr1:15768943ENST00000375949+2830_26776269DomainPeptidase S1


Top

FusionGeneSequence for SPEN_CTRC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SPEN_ENST00000375759_chr1_16199631_+_CTRC_ENST00000375949_chr1_15768943_+_327aa
MVRETRHLWVGNLPENVREEKIIEHFKRYGRVESVKILPKRGSEGGVAAFVDFVDIKSAQKAHNSVNKMGDRDLRTDYNEPGTIPSAARG
LDDTVSIASRSREVSGFRGGGGGPAYGPPPSLHAREGRYERRLDGNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDI
ALIKLAEHVELSDTIQVACLPEKDSLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVISAC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SPEN_ENST00000375759_chr1_16199631_+_CTRC_ENST00000375949_chr1_15768943_+_981nt
ATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATCATCGAGCATTTCAAACGATATGGC
CGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGATTTTGTGGACATCAAAAGTGCACAG
AAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGCACCATCCCGAGTGCTGCTCGGGGA
TTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGAGGGCCTGCTTATGGTCCCCCACCG
TCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGCAACACCCGGACCTACCGTGTGGCCGTGGGAAAGAACAACCTGGAG
GTGGAAGACGAAGAAGGATCCCTGTTTGTGGGTGTGGACACCATCCACGTCCACAAGAGATGGAATGCCCTCCTGTTGCGCAATGATATT
GCCCTCATCAAGCTTGCAGAGCATGTGGAGCTGAGTGACACCATCCAGGTGGCCTGCCTGCCAGAGAAGGACTCCCTGCTCCCCAAGGAC
TACCCCTGCTATGTCACCGGCTGGGGCCGCCTCTGGACCAACGGCCCCATTGCTGATAAGCTGCAGCAGGGCCTGCAGCCCGTGGTGGAT
CACGCCACGTGCTCCAGGATTGACTGGTGGGGCTTCAGGGTGAAGAAAACCATGGTGTGCGCTGGGGGCGATGGCGTCATCTCAGCCTGC
AATGGGGACTCCGGTGGCCCACTGAACTGCCAGTTGGAGAACGGTTCCTGGGAGGTGTTTGGCATCGTCAGCTTTGGCTCCCGGCGGGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SPEN_ENST00000375759_chr1_16199631_+_CTRC_ENST00000375949_chr1_15768943_+_1250nt
TGAGCTGCGAGGCCCGAGAGTCAGAACCTGGGGGAGAGGGATGGTCTCTGCACGGGGGGGAGCCGGAGGAGCCGCCGCCGCTGCCGACGC
CACCGCCGCAGCCGCCGCCGCCGCCGCCCCGGCACCCGCCTCCCGGCGCTGACGGTCTCGTACGAAGCCGGCGAGGGGGAGCCAGCAGCG
GCGGTCGCCGGCACGCCGCCCAGCATGGTCCGGGAAACCAGGCATCTCTGGGTGGGCAACTTACCCGAGAACGTGCGGGAAGAGAAGATC
ATCGAGCATTTCAAACGATATGGCCGCGTGGAAAGTGTCAAAATTCTTCCCAAGAGGGGATCTGAAGGAGGAGTGGCTGCCTTTGTGGAT
TTTGTGGACATCAAAAGTGCACAGAAAGCTCACAACTCGGTCAACAAAATGGGTGACAGAGACCTACGCACGGATTATAATGAACCAGGC
ACCATCCCGAGTGCTGCTCGGGGATTGGATGATACAGTTTCCATAGCATCTCGTAGTAGAGAGGTTTCTGGGTTCAGAGGAGGTGGTGGA
GGGCCTGCTTATGGTCCCCCACCGTCACTTCATGCACGAGAAGGACGTTATGAGCGGAGACTTGATGGCAACACCCGGACCTACCGTGTG
GCCGTGGGAAAGAACAACCTGGAGGTGGAAGACGAAGAAGGATCCCTGTTTGTGGGTGTGGACACCATCCACGTCCACAAGAGATGGAAT
GCCCTCCTGTTGCGCAATGATATTGCCCTCATCAAGCTTGCAGAGCATGTGGAGCTGAGTGACACCATCCAGGTGGCCTGCCTGCCAGAG
AAGGACTCCCTGCTCCCCAAGGACTACCCCTGCTATGTCACCGGCTGGGGCCGCCTCTGGACCAACGGCCCCATTGCTGATAAGCTGCAG
CAGGGCCTGCAGCCCGTGGTGGATCACGCCACGTGCTCCAGGATTGACTGGTGGGGCTTCAGGGTGAAGAAAACCATGGTGTGCGCTGGG
GGCGATGGCGTCATCTCAGCCTGCAATGGGGACTCCGGTGGCCCACTGAACTGCCAGTTGGAGAACGGTTCCTGGGAGGTGTTTGGCATC
GTCAGCTTTGGCTCCCGGCGGGGCTGCAACACCCGCAAGAAGCCGGTAGTCTACACCCGGGTGTCCGCCTACATCGACTGGATCAACGAG


Top

FusionGenePPI for SPEN_CTRC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SPENNCOR2, PPARD, HDAC1, SRA1, RBPJ, NCOR1, CTBP1, RBBP8, RUNX1T1, RUNX1, SIRT7, UBE2E2, UBE2L6, ATXN1, NOTCH2, BPGM, TTN, PRDX3, PCBP3, NUP54, PIR, SCYL2, SOX2, HRSP12, SERTAD1, CUL7, OBSL1, EED, BMI1, CCNC, WRAP73, MED23, SRPK2, CLK1, DYNLT1, BCLAF1, FERMT3, USP37, DPPA4, EGFR, TRIML2, CAMKV, PIP4K2A, NR3C1CTRCNEDD8, ST13, UBC, KRTAP10-7, KRTAP10-3, SUMF1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2152130_24641343665MSX2
HgeneSPENchr1:16199631chr1:15768943ENST00000375759+2152709_28701343665RBPSUH


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SPEN_CTRC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SPEN_CTRC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCTRCC0149521Pancreatitis, Chronic1CTD_human
TgeneCTRCC0238339Hereditary pancreatitis1CTD_human;ORPHANET;UNIPROT