FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35587

FusionGeneSummary for SPATA7_GABRA3

check button Fusion gene summary
Fusion gene informationFusion gene name: SPATA7_GABRA3
Fusion gene ID: 35587
HgeneTgene
Gene symbol

SPATA7

GABRA3

Gene ID

55812

2556

Gene namespermatogenesis associated 7gamma-aminobutyric acid type A receptor alpha3 subunit
SynonymsHEL-S-296|HSD-3.1|HSD3|LCA3-
Cytomap

14q31.3

Xq28

Type of geneprotein-codingprotein-coding
Descriptionspermatogenesis-associated protein 7epididymis secretory protein Li 296spermatogenesis-associated protein HSD3gamma-aminobutyric acid receptor subunit alpha-3GABA(A) receptor subunit alpha-3GABA(A) receptor, alpha 3gamma-aminobutyric acid (GABA) A receptor, alpha 3gamma-animobutyric acid (GABA) A receptor, alpha 3
Modification date2018051920180523
UniProtAcc

Q9P0W8

P34903

Ensembl transtripts involved in fusion geneENST00000556553, ENST00000393545, 
ENST00000356583, ENST00000554102, 
ENST00000045347, 
ENST00000370314, 
ENST00000535043, ENST00000497894, 
Fusion gene scores* DoF score2 X 2 X 2=86 X 5 X 5=150
# samples 26
** MAII scorelog2(2/8*10)=1.32192809488736log2(6/150*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SPATA7 [Title/Abstract] AND GABRA3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A7-A4SA-01ASPATA7chr14

88904247

+GABRA3chrX

151337035

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000556553ENST00000370314SPATA7chr14

88904247

+GABRA3chrX

151337035

-
Frame-shitENST00000556553ENST00000535043SPATA7chr14

88904247

+GABRA3chrX

151337035

-
5CDS-intronENST00000556553ENST00000497894SPATA7chr14

88904247

+GABRA3chrX

151337035

-
Frame-shitENST00000393545ENST00000370314SPATA7chr14

88904247

+GABRA3chrX

151337035

-
In-frameENST00000393545ENST00000535043SPATA7chr14

88904247

+GABRA3chrX

151337035

-
5CDS-intronENST00000393545ENST00000497894SPATA7chr14

88904247

+GABRA3chrX

151337035

-
In-frameENST00000356583ENST00000370314SPATA7chr14

88904247

+GABRA3chrX

151337035

-
Frame-shitENST00000356583ENST00000535043SPATA7chr14

88904247

+GABRA3chrX

151337035

-
5CDS-intronENST00000356583ENST00000497894SPATA7chr14

88904247

+GABRA3chrX

151337035

-
intron-3CDSENST00000554102ENST00000370314SPATA7chr14

88904247

+GABRA3chrX

151337035

-
intron-3CDSENST00000554102ENST00000535043SPATA7chr14

88904247

+GABRA3chrX

151337035

-
intron-intronENST00000554102ENST00000497894SPATA7chr14

88904247

+GABRA3chrX

151337035

-
In-frameENST00000045347ENST00000370314SPATA7chr14

88904247

+GABRA3chrX

151337035

-
Frame-shitENST00000045347ENST00000535043SPATA7chr14

88904247

+GABRA3chrX

151337035

-
5CDS-intronENST00000045347ENST00000497894SPATA7chr14

88904247

+GABRA3chrX

151337035

-

Top

FusionProtFeatures for SPATA7_GABRA3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SPATA7

Q9P0W8

GABRA3

P34903

Involved in photoreceptor cells maintenance (Bysimilarity). It is required for recruitment and properlocalization of RPGRIP1 to the photoreceptor connecting cilium(CC), as well as protein trafficking across the CC to the outersegments (By similarity). {ECO:0000250|UniProtKB:Q80VP2}. GABA, the major inhibitory neurotransmitter in thevertebrate brain, mediates neuronal inhibition by binding to theGABA/benzodiazepine receptor and opening an integral chloridechannel.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SPATA7_GABRA3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SPATA7_ENST00000393545_chr14_88904247_+_GABRA3_ENST00000535043_chrX_151337035_-_723aa
MDGSRRVRATSVLPRTGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHTNKILSAKAAVDCSVPVSVSTSIKTADQQRREKLK
KELAQCEKEFKLTKTAMRANTKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSP
SSVDTAASGPRKLSSGALTGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQTRTTTPAKRKKDFTD
QRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTTDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQTSLKPPSTRKIYS
DEEELLTLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPN
ELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPITKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNV
IEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV_SSLINTSNGQ_QENTSSPSKENQHYLQHRG
DHLSHQPGQGH_IFHHLQGRCSQCLLNPNNHCFTQGHLRAGQPD_DQDLQQCQQG_QNFPHHLSCALCHIQSGLLGHICQPGVSTQGHDP

>In-frame_SPATA7_ENST00000356583_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_692aa
MDGSRRVRATSVLPRTGPPCLFKGHLSTKSNAAVDCSVPVSVSTSIKTADQQRREKLKKELAQCEKEFKLTKTAMRANTKNNSKSLFNTL
QKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSPSSVDTAASGPRKLSSGALTGRRPRSTFPNSHR
FQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQTRTTTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNI
KQASNCVTTDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQTSLKPPSTRKIYSDEEELLTLSFIEDVTDEILKLGLFSNRFLERL
FERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDEN
EIFPSPTEFFMPITKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSV
KGDNNHDMELSTLKIMEMSIEDCPLDV_SSLINTSNGQ_LKKTPAAPAKKTSTTFNIVGTTTPINLAKDTEFSTISKGAAPSASSTPTII

>In-frame_SPATA7_ENST00000045347_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_539aa
MDGSRRVRATSVLPRTGPPCLFKGHLSTKSNAFCTDSSSLRLSTLQLVKNHMAVHTNKILSAKAAVDCSVPVSVSTSIKTADQQRREKLK
KELAQCEKEFKLTKTAMRANTKNNSKSLFNTLQKPSGEPQIEDDMLKEEMNGFSSFARSLVPSSERLHLSLHKSSKVITNGPEKNSSSSP
SSVDTAASGPRKLSSGALTGRRPRSTFPNSHRFQLVISKAPSGDLLDKHSELFSNKQLPFTPRTLKTEAKSFLSQTRTTTPAKRKKDFTD
QRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTTDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQTSLKPPSTRKIYS
DEEELLTLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSKKTPAAPAKKTSTTFNIVGTTTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SPATA7_ENST00000393545_chr14_88904247_+_GABRA3_ENST00000535043_chrX_151337035_-_2170nt
ATGGATGGCAGCCGGAGAGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCGTGCCTATTTAAAGGACACTTGAGCACCAAAAGT
AATGCTTTTTGCACTGACTCCTCTTCTCTCAGACTAAGCACTCTCCAGCTGGTCAAGAATCACATGGCTGTTCACTATAATAAAATCCTT
TCAGCCAAAGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAGTATGCAGACCAACAACGAAGAGAGAAACTCAAA
AAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAAT
ACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTA
GTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCG
TCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCC
CACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTC
ACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGAT
CAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATG
AACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGAT
GAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCT
GATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAA
CGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGC
TGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAAT
GAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGAT
GAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAAT
GATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTC
ATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCC
AGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAA
TCTTCATTAATAAATACCTCAAATGGCCAGTAACAAGAAAACACCAGCAGCCCCAGCAAAGAAAACCAGCACTACCTTCAACATCGTGGG
GACCACCTATCCCATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGGCGCTGCTCCCAGTGCCTCCTCAACCCCAACAAT
CATTGCTTCACCCAAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCG
CATCATCTTTCCTGTGCTCTTTGCCATATTCAATCTGGTCTATTGGGCCACATATGTCAACCGGGAGTCAGCTATCAAGGGCATGATCCG

>In-frame_SPATA7_ENST00000356583_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_2076nt
ATGGATGGCAGCCGGAGAGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCGTGCCTATTTAAAGGACACTTGAGCACCAAAAGT
AATGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAGTATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAA
TTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTA
CAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCC
TCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGT
GTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGG
TTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCT
CGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGG
ATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATGAACATA
AAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATT
AAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAA
GAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTG
TTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACA
TCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTA
AAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAAC
GAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAA
ACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAA
GGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTC
AAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCA
TTAATAAATACCTCAAATGGCCAGTAACTCAAGAAAACACCAGCAGCCCCAGCAAAGAAAACCAGCACTACCTTCAACATCGTGGGGACC
ACCTATCCCATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGGCGCTGCTCCCAGTGCCTCCTCAACCCCAACAATCATT
GCTTCACCCAAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATC
ATCTTTCCTGTGCTCTTTGCCATATTCAATCTGGTCTATTGGGCCACATATGTCAACCGGGAGTCAGCTATCAAGGGCATGATCCGCAAA

>In-frame_SPATA7_ENST00000045347_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_1617nt
ATGGATGGCAGCCGGAGAGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCGTGCCTATTTAAAGGACACTTGAGCACCAAAAGT
AATGCTTTTTGCACTGACTCCTCTTCTCTCAGACTAAGCACTCTCCAGCTGGTCAAGAATCACATGGCTGTTCACTATAATAAAATCCTT
TCAGCCAAAGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAGTATGCAGACCAACAACGAAGAGAGAAACTCAAA
AAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAAT
ACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTA
GTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCG
TCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCC
CACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTC
ACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGAT
CAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATG
AACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGAT
GAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCT
GATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAA
CGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGC
TGCACATCGGAGGAAAACTCGAAGAAAACACCAGCAGCCCCAGCAAAGAAAACCAGCACTACCTTCAACATCGTGGGGACCACCTATCCC
ATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGGCGCTGCTCCCAGTGCCTCCTCAACCCCAACAATCATTGCTTCACCC
AAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTTCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SPATA7_ENST00000393545_chr14_88904247_+_GABRA3_ENST00000535043_chrX_151337035_-_2383nt
TTTTCTCTCAGTTGAAGCGCGCACATTGAGTCGGCTTTTCTACTGCTTCGGCTAGGGTACCTTGTGACCATGTCTTCCAAGAAGAATAGA
AAGCGGTTGAACCAAAGCGCGGAAAATGGTTCGTCCTTGCCCTCTGCTGCTTCCTCTTGTGCGGAGGCACGGGCTCCTTCTGCTGGATCA
GACTTCGCGGCAACCTCCGGGACTCTGACGGTGACCAACTTATTAGAAAAGGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCG
TGCCTATTTAAAGGACACTTGAGCACCAAAAGTAATGCTTTTTGCACTGACTCCTCTTCTCTCAGACTAAGCACTCTCCAGCTGGTCAAG
AATCACATGGCTGTTCACTATAATAAAATCCTTTCAGCCAAAGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAG
TATGCAGACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCC
AATTATAAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAA
ATGAATGGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACA
AATGGTCCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTAT
GGCAGAAGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACAT
TCTGAACTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTAT
ACACCTGCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACA
GCTGAGACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCT
TTACCTTTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCC
CTGAAGCCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTG
AAACTTGGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGC
CACCTGCTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTT
GATTTTGAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAG
GCTTTGGATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAG
CATTCAGAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGAC
AGTTTAACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTT
AACACATCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAA
ATGAGCATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCTCAAATGGCCAGTAACAAGAAAACACCAGCAGCCCCAGC
AAAGAAAACCAGCACTACCTTCAACATCGTGGGGACCACCTATCCCATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGG
CGCTGCTCCCAGTGCCTCCTCAACCCCAACAATCATTGCTTCACCCAAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTA
CAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTTCCTGTGCTCTTTGCCATATTCAATCTGGTCTATTGGGCCACATATGT

>In-frame_SPATA7_ENST00000356583_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_4283nt
TTTTCTCTCAGTTGAAGCGCGCACATTGAGTCGGCTTTTCTACTGCTTCGGCTAGGGTACCTTGTGACCATGTCTTCCAAGAAGAATAGA
AAGCGGTTGAACCAAAGCGCGGAAAATGGTTCGTCCTTGCCCTCTGCTGCTTCCTCTTGTGCGGAGGCACGGGCTCCTTCTGCTGGATCA
GACTTCGCGGCAACCTCCGGGACTCTGACGGTGACCAACTTATTAGAAAAGGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCG
TGCCTATTTAAAGGACACTTGAGCACCAAAAGTAATGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAGTATGCA
GACCAACAACGAAGAGAGAAACTCAAAAAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTAT
AAAAATAATTCCAAGTCACTTTTTAATACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAAT
GGATTTTCATCCTTTGCAAGGTCACTAGTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGT
CCTGAGAAGAACTCCAGTTCCTCCCCGTCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGA
AGGCCCAGAAGCACATTCCCAAATTCCCACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAA
CTCTTTTCTAACAAACAATTGCCATTCACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCT
GCCAAAAGAAAAAAGGATTTTACAGATCAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAG
ACTAAAAACATGACAGATTCAGAAATGAACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCT
TTAGAAGGGCATGACTCAACATGGGATGAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAG
CCCCCTTCAACTCGTAAAATCTACTCTGATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTT
GGTTTATTTTCAAACAGGTTTTTAGAACGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTG
CTGCATGTCCTGAAAGTAGACTTAGGCTGCACATCGGAGGAAAACTCGGTAAAGCAAAATGATGTTGATATGTTGAATGTATTTGATTTT
GAAAAGGCTGGGAATTCAGAACCAAATGAATTAAAAAATGAAAGTGAAGTAACAATTCAGCAGGAACGTCAACAATACCAAAAGGCTTTG
GATATGTTATTGTCGGCACCAAAGGATGAGAACGAGATATTCCCTTCACCAACTGAATTTTTCATGCCTATTTATAAATCAAAGCATTCA
GAAGGGGTTATAATTCAACAGGTGAATGATGAAACAAATCTTGAAACTTCAACTTTGGATGAAAATCATCCAAGTATTTCAGACAGTTTA
ACAGATCGGGAAACTTCTGTGAATGTCATTGAAGGTGATAGTGACCCTGAAAAGGTTGAGATTTCAAATGGATTATGTGGTCTTAACACA
TCACCCTCCCAATCTGTTCAGTTCTCCAGTGTCAAAGGCGACAATAATCATGACATGGAGTTATCAACTCTTAAAATCATGGAAATGAGC
ATTGAGGACTGCCCTTTGGATGTTTAATCTTCATTAATAAATACCTCAAATGGCCAGTAACTCAAGAAAACACCAGCAGCCCCAGCAAAG
AAAACCAGCACTACCTTCAACATCGTGGGGACCACCTATCCCATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGGCGCT
GCTCCCAGTGCCTCCTCAACCCCAACAATCATTGCTTCACCCAAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTACAAC
AGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTTCCTGTGCTCTTTGCCATATTCAATCTGGTCTATTGGGCCACATATGTCAAC
CGGGAGTCAGCTATCAAGGGCATGATCCGCAAACAGTAGATAGTGGTGGCAGTGCAGCAACCAGAGCACTGTATACCCCGTGAAGCATCC
AGGCACCCAAACCCCGGGGCTCCCCTTCGCGTATTTCAGGATTCTCCTTTTTACCCCTCTACCAAGCTGTGACCCTCAATTCATATTTAT
GAATCTCTACGCAAAAAATAACTACAGAAAAATTACTTGTCCCTCCAATATTGCCCAGTATAACCCCATCAAAGCCAAACACTGCCATTT
GTCCAGTTGCTCATCTTAGTCTGCCAATCTCCCCTAGCTGAGGGCACTGCATGTATTTTATTGCACTCTGCCCGCTGCAAAAAGAACAAG
AGATTCTACTCTCCATAGTGGAAGCCTTGGCTGTTTGAGAGGCCCAGAACAAGGAGAATTGTTGACTCCCATCTAGATCAGATGACTCTA
ACTTACTAGGCAGCCAGGTTAGGCTAGGCCATGTGATCCTGCGTGCCACCTCCCCTGCCTTCAGCAAGGCCTACTAGGCATAAGTACTGA
TAGCAAAGGTGGGAGCCAGTTCTACACCCCCAACCCATTTATTGGTTTGGAAATTAGTGGGGACAATTGGTACTAACCACCGTCTACCAT
GTATGGCCAAAATAAATAGAACTAGCTCTGCCAGCCTGGCACCAAGATGGCTGGTGCCCTGCCATGTCCAGCCCCTCGGGAAAATAGTCC
CCTCCTTGGTACATCTCTCCTCCAGAAAATCTTCTTCCCCCACTGCCTTTGGCACCCTTGTAGCCAACTGAGCACTACTTAATTTGGACT
CATTACCACCTGTAAACTTTTCAGGAAAAAATGATCAAGCATTTTTTATTTATATCGAAAAGTTGCAAATAGAAACAAAGTGATCTAGAT
TTAAAAAAAACATTTTTTTAAAATATGGGAGAGATACAAAAGTCACCTCCCTGCCAAGGCAACTAGCCTATACTGGATTGGGTAAGAGGT
TTGGAGTGGATGGTAGTTGAGGATTGAAGTCTGGCTCAAAAGAGAAGGCTACTGGCAGATGAAAGTCAAATTCTTCCTTCCATACACTCC
ACATTCCACACCCTGGCCCAGGCACTTTTCTCCCACCATATCGGGAACCTCCGGTCCTCTGTTGATGCCGATTCTATGAGGGGTGAATTG
GAAATTCATACAAATAAATATCTCTAGTCAATATTGAGTCAACTAGATCATTAACTTTATTGCCAATTTTATAATATATTATTTAGAGGC
CATTTGTTCTTAATCTTAATGTGAGTAAAAGACACAGGCATAAATACGCAATTTTTATAAGGTAGATAAACTGAATCCCAGAAGTTTGAA
TGATTTGCCTAGGCTCCTTACAAGTGTCTTTAATAAAGAGCTATCGTGCGCCCCTTTCCAAAGGCCAAAATAAAGGACTGAGAAGCCAGG
TCCACCGTGACCTCAGAATCAGCACAATCTCAGCGGGCCTTCTGGGTCACTAGTGGAACTTGGTTGGGCACCAAAAAGGTTTTTAGAAAG
TCACAATGTGTCACCCAAGAAGATCACTTTTAATAGTCTCAGCCCAAGAGAATGAGACTGTTTATGATGGCAGCCCCAGCCACTTTGGCT
CTGAATACCTGCACTAGTCCAGAGTATCCTAGAAGCCCAGGGTAAAGCCACAGAGGGCACCACAAGCAGATTCTCCCTGCCCACCGGCTG
AACAAAGCTCCTAAGGGGTGTATCATTAGCTGCTGGTTGCCTTTTCATCCATCCTTTCCCCGTCCCCTGCTTCCTTGCCATTGCTGGGAT
AATGCATGCCCGTCCCATTATTCCTAAGACTGTGTCTGTAGGTAAATTCATGACTAGAAGAGTGTAGTCTTGTGGATATGTGGGGATATG
GGGGGTGGGAGGGCGGGGCTGTTAATGGTTGTCTTAAGGAACTTAGAATGGAAGCCTGATCTTTGCCTCTCTGTAGAAATTGTGTTTCCA

>In-frame_SPATA7_ENST00000045347_chr14_88904247_+_GABRA3_ENST00000370314_chrX_151337035_-_3611nt
ATGGATGGCAGCCGGAGAGTCAGAGCAACCTCTGTCCTTCCCAGATATGGTCCACCGTGCCTATTTAAAGGACACTTGAGCACCAAAAGT
AATGCTTTTTGCACTGACTCCTCTTCTCTCAGACTAAGCACTCTCCAGCTGGTCAAGAATCACATGGCTGTTCACTATAATAAAATCCTT
TCAGCCAAAGCTGCAGTAGACTGCTCGGTTCCAGTAAGCGTGAGTACCAGCATAAAGTATGCAGACCAACAACGAAGAGAGAAACTCAAA
AAGGAATTAGCACAATGTGAAAAAGAGTTCAAATTAACTAAAACTGCAATGCGAGCCAATTATAAAAATAATTCCAAGTCACTTTTTAAT
ACCTTACAAAAGCCCTCAGGCGAACCGCAAATTGAGGATGACATGTTAAAAGAAGAAATGAATGGATTTTCATCCTTTGCAAGGTCACTA
GTACCCTCTTCAGAGAGACTACACCTAAGTCTACATAAATCCAGTAAAGTCATCACAAATGGTCCTGAGAAGAACTCCAGTTCCTCCCCG
TCCAGTGTGGATTATGCAGCCTCCGGGCCCCGGAAACTGAGCTCTGGAGCCCTGTATGGCAGAAGGCCCAGAAGCACATTCCCAAATTCC
CACCGGTTTCAGTTAGTCATTTCGAAAGCACCCAGTGGGGATCTTTTGGATAAACATTCTGAACTCTTTTCTAACAAACAATTGCCATTC
ACTCCTCGCACTTTAAAAACAGAAGCAAAATCTTTCCTGTCACAGTATCGCTATTATACACCTGCCAAAAGAAAAAAGGATTTTACAGAT
CAACGGATAGAAGCTGAAACCCAGACTGAATTAAGCTTTAAATCTGAGTTGGGGACAGCTGAGACTAAAAACATGACAGATTCAGAAATG
AACATAAAGCAGGCATCTAATTGTGTGACATATGATGCCAAAGAAAAAATAGCTCCTTTACCTTTAGAAGGGCATGACTCAACATGGGAT
GAGATTAAGGATGATGCTCTTCAGCATTCCTCACCAAGGGCAATGTGTCAGTATTCCCTGAAGCCCCCTTCAACTCGTAAAATCTACTCT
GATGAAGAAGAACTGTTGTATCTGAGTTTCATTGAAGATGTAACAGATGAAATTTTGAAACTTGGTTTATTTTCAAACAGGTTTTTAGAA
CGACTGTTCGAGCGACATATAAAACAAAATAAACATTTGGAGGAGGAAAAAATGCGCCACCTGCTGCATGTCCTGAAAGTAGACTTAGGC
TGCACATCGGAGGAAAACTCGAAGAAAACACCAGCAGCCCCAGCAAAGAAAACCAGCACTACCTTCAACATCGTGGGGACCACCTATCCC
ATCAACCTGGCCAAGGACACTGAATTTTCCACCATCTCCAAGGGCGCTGCTCCCAGTGCCTCCTCAACCCCAACAATCATTGCTTCACCC
AAGGCCACCTACGTGCAGGACAGCCCGACTGAGACCAAGACCTACAACAGTGTCAGCAAGGTTGACAAAATTTCCCGCATCATCTTTCCT
GTGCTCTTTGCCATATTCAATCTGGTCTATTGGGCCACATATGTCAACCGGGAGTCAGCTATCAAGGGCATGATCCGCAAACAGTAGATA
GTGGTGGCAGTGCAGCAACCAGAGCACTGTATACCCCGTGAAGCATCCAGGCACCCAAACCCCGGGGCTCCCCTTCGCGTATTTCAGGAT
TCTCCTTTTTACCCCTCTACCAAGCTGTGACCCTCAATTCATATTTATGAATCTCTACGCAAAAAATAACTACAGAAAAATTACTTGTCC
CTCCAATATTGCCCAGTATAACCCCATCAAAGCCAAACACTGCCATTTGTCCAGTTGCTCATCTTAGTCTGCCAATCTCCCCTAGCTGAG
GGCACTGCATGTATTTTATTGCACTCTGCCCGCTGCAAAAAGAACAAGAGATTCTACTCTCCATAGTGGAAGCCTTGGCTGTTTGAGAGG
CCCAGAACAAGGAGAATTGTTGACTCCCATCTAGATCAGATGACTCTAACTTACTAGGCAGCCAGGTTAGGCTAGGCCATGTGATCCTGC
GTGCCACCTCCCCTGCCTTCAGCAAGGCCTACTAGGCATAAGTACTGATAGCAAAGGTGGGAGCCAGTTCTACACCCCCAACCCATTTAT
TGGTTTGGAAATTAGTGGGGACAATTGGTACTAACCACCGTCTACCATGTATGGCCAAAATAAATAGAACTAGCTCTGCCAGCCTGGCAC
CAAGATGGCTGGTGCCCTGCCATGTCCAGCCCCTCGGGAAAATAGTCCCCTCCTTGGTACATCTCTCCTCCAGAAAATCTTCTTCCCCCA
CTGCCTTTGGCACCCTTGTAGCCAACTGAGCACTACTTAATTTGGACTCATTACCACCTGTAAACTTTTCAGGAAAAAATGATCAAGCAT
TTTTTATTTATATCGAAAAGTTGCAAATAGAAACAAAGTGATCTAGATTTAAAAAAAACATTTTTTTAAAATATGGGAGAGATACAAAAG
TCACCTCCCTGCCAAGGCAACTAGCCTATACTGGATTGGGTAAGAGGTTTGGAGTGGATGGTAGTTGAGGATTGAAGTCTGGCTCAAAAG
AGAAGGCTACTGGCAGATGAAAGTCAAATTCTTCCTTCCATACACTCCACATTCCACACCCTGGCCCAGGCACTTTTCTCCCACCATATC
GGGAACCTCCGGTCCTCTGTTGATGCCGATTCTATGAGGGGTGAATTGGAAATTCATACAAATAAATATCTCTAGTCAATATTGAGTCAA
CTAGATCATTAACTTTATTGCCAATTTTATAATATATTATTTAGAGGCCATTTGTTCTTAATCTTAATGTGAGTAAAAGACACAGGCATA
AATACGCAATTTTTATAAGGTAGATAAACTGAATCCCAGAAGTTTGAATGATTTGCCTAGGCTCCTTACAAGTGTCTTTAATAAAGAGCT
ATCGTGCGCCCCTTTCCAAAGGCCAAAATAAAGGACTGAGAAGCCAGGTCCACCGTGACCTCAGAATCAGCACAATCTCAGCGGGCCTTC
TGGGTCACTAGTGGAACTTGGTTGGGCACCAAAAAGGTTTTTAGAAAGTCACAATGTGTCACCCAAGAAGATCACTTTTAATAGTCTCAG
CCCAAGAGAATGAGACTGTTTATGATGGCAGCCCCAGCCACTTTGGCTCTGAATACCTGCACTAGTCCAGAGTATCCTAGAAGCCCAGGG
TAAAGCCACAGAGGGCACCACAAGCAGATTCTCCCTGCCCACCGGCTGAACAAAGCTCCTAAGGGGTGTATCATTAGCTGCTGGTTGCCT
TTTCATCCATCCTTTCCCCGTCCCCTGCTTCCTTGCCATTGCTGGGATAATGCATGCCCGTCCCATTATTCCTAAGACTGTGTCTGTAGG
TAAATTCATGACTAGAAGAGTGTAGTCTTGTGGATATGTGGGGATATGGGGGGTGGGAGGGCGGGGCTGTTAATGGTTGTCTTAAGGAAC
TTAGAATGGAAGCCTGATCTTTGCCTCTCTGTAGAAATTGTGTTTCCAAATGCTTTGGTGCAATGTTTAGCTGCTGTTTATTAAACCCTT


Top

FusionGenePPI for SPATA7_GABRA3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SPATA7APP, PTF1A, HSPB1, RPGRIP1L, RAF1, C21orf2, NEK1GABRA3UBQLN1, UGT2B7, SDCBP2, EGFR, GABRA5, ABCA7, SEC11C, TMEM131, GLRB, TUSC3, AMIGO1, TMEM59L, TTC17, EDA, POMT1, SPCS1, WLS, ALG9, SLC47A1, HLA-C, GPAA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SPATA7_GABRA3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneGABRA3P34903DB00425ZolpidemGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB00546AdinazolamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB00842OxazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB00849MethylphenobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB00898EthanolGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB01198ZopicloneGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB01354HeptabarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB01355HexobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB01594CinolazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB01595NitrazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB09166EtizolamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB13872LormetazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved
TgeneGABRA3P34903DB00306TalbutalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB00371MeprobamateGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB00683MidazolamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01215EstazolamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01351AmobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01352AprobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01353ButethalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01544FlunitrazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01559ClotiazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01567FludiazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01588PrazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB01589QuazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit
TgeneGABRA3P34903DB00690FlurazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit|investigational
TgeneGABRA3P34903DB01558BromazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit|investigational
TgeneGABRA3P34903DB00829DiazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit|investigational|vet_approved
TgeneGABRA3P34903DB00801HalazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|illicit|withdrawn
TgeneGABRA3P34903DB00231TemazepamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|investigational
TgeneGABRA3P34903DB00402EszopicloneGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|investigational
TgeneGABRA3P34903DB00897TriazolamGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|investigational
TgeneGABRA3P34903DB00312PentobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|investigational|vet_approved
TgeneGABRA3P34903DB00418SecobarbitalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|vet_approved
TgeneGABRA3P34903DB00599ThiopentalGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|vet_approved
TgeneGABRA3P34903DB00794PrimidoneGamma-aminobutyric acid receptor subunit alpha-3small moleculeapproved|vet_approved

Top

RelatedDiseases for SPATA7_GABRA3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSPATA7C0035334Retinitis Pigmentosa1CTD_human;ORPHANET
HgeneSPATA7C0339527Leber Congenital Amaurosis1CTD_human;ORPHANET
TgeneGABRA3C0005586Bipolar Disorder5PSYGENET
TgeneGABRA3C0004352Autistic Disorder1CTD_human
TgeneGABRA3C0011570Mental Depression1PSYGENET
TgeneGABRA3C0011581Depressive disorder1PSYGENET