FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35300

FusionGeneSummary for SNX29_TNFRSF17

check button Fusion gene summary
Fusion gene informationFusion gene name: SNX29_TNFRSF17
Fusion gene ID: 35300
HgeneTgene
Gene symbol

SNX29

TNFRSF17

Gene ID

92017

608

Gene namesorting nexin 29TNF receptor superfamily member 17
SynonymsA-388D4.1|RUNDC2ABCM|BCMA|CD269|TNFRSF13A
Cytomap

16p13.13-p13.12

16p13.13

Type of geneprotein-codingprotein-coding
Descriptionsorting nexin-29RUN domain containing 2ARUN domain-containing protein 2Atumor necrosis factor receptor superfamily member 17B cell maturation antigenB-cell maturation factorB-cell maturation protein
Modification date2018051920180519
UniProtAcc

Q8TEQ0

Q02223

Ensembl transtripts involved in fusion geneENST00000566228, ENST00000323433, 
ENST00000306030, ENST00000568359, 
ENST00000053243, ENST00000396495, 
Fusion gene scores* DoF score12 X 11 X 9=11883 X 2 X 4=24
# samples 144
** MAII scorelog2(14/1188*10)=-3.0850361038558
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SNX29 [Title/Abstract] AND TNFRSF17 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-XR-A8TG-01ASNX29chr16

12155503

+TNFRSF17chr16

12060052

+
TCGARVLUADTCGA-69-7979-01ASNX29chr16

12172772

+TNFRSF17chr16

12060052

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000566228ENST00000053243SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000566228ENST00000396495SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
In-frameENST00000323433ENST00000053243SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000323433ENST00000396495SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
In-frameENST00000306030ENST00000053243SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000306030ENST00000396495SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
intron-3CDSENST00000568359ENST00000053243SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
intron-intronENST00000568359ENST00000396495SNX29chr16

12155503

+TNFRSF17chr16

12060052

+
In-frameENST00000566228ENST00000053243SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000566228ENST00000396495SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
In-frameENST00000323433ENST00000053243SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000323433ENST00000396495SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
In-frameENST00000306030ENST00000053243SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
5CDS-intronENST00000306030ENST00000396495SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
intron-3CDSENST00000568359ENST00000053243SNX29chr16

12172772

+TNFRSF17chr16

12060052

+
intron-intronENST00000568359ENST00000396495SNX29chr16

12172772

+TNFRSF17chr16

12060052

+

Top

FusionProtFeatures for SNX29_TNFRSF17


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SNX29

Q8TEQ0

TNFRSF17

Q02223

Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL.Promotes B-cell survival and plays a role in the regulation ofhumoral immunity. Activates NF-kappa-B and JNK.{ECO:0000269|PubMed:10801128, ECO:0000269|PubMed:10903733,ECO:0000269|PubMed:10973284}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNX29chr16:12155503chr16:12060052ENST00000566228+92136_180414814DomainRUN
HgeneSNX29chr16:12172772chr16:12060052ENST00000566228+112136_180467814DomainRUN
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000396495+027_41-38136RepeatNote=TNFR-Cys
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000396495+027_41-38136RepeatNote=TNFR-Cys
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000053243+0378_18443185Topological domainCytoplasmic
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000396495+021_54-38136Topological domainExtracellular
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000396495+0278_184-38136Topological domainCytoplasmic
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000053243+0378_18443185Topological domainCytoplasmic
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000396495+021_54-38136Topological domainExtracellular
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000396495+0278_184-38136Topological domainCytoplasmic
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000053243+0355_7743185TransmembraneHelical%3B Signal-anchor for type III membrane protein
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000396495+0255_77-38136TransmembraneHelical%3B Signal-anchor for type III membrane protein
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000053243+0355_7743185TransmembraneHelical%3B Signal-anchor for type III membrane protein
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000396495+0255_77-38136TransmembraneHelical%3B Signal-anchor for type III membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNX29chr16:12155503chr16:12060052ENST00000566228+921466_545414814Coiled coilOntology_term=ECO:0000255
HgeneSNX29chr16:12172772chr16:12060052ENST00000566228+1121466_545467814Coiled coilOntology_term=ECO:0000255
HgeneSNX29chr16:12155503chr16:12060052ENST00000566228+921656_779414814DomainPX
HgeneSNX29chr16:12172772chr16:12060052ENST00000566228+1121656_779467814DomainPX
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000053243+037_4143185RepeatNote=TNFR-Cys
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000053243+037_4143185RepeatNote=TNFR-Cys
TgeneTNFRSF17chr16:12155503chr16:12060052ENST00000053243+031_5443185Topological domainExtracellular
TgeneTNFRSF17chr16:12172772chr16:12060052ENST00000053243+031_5443185Topological domainExtracellular


Top

FusionGeneSequence for SNX29_TNFRSF17


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SNX29_ENST00000566228_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_609aa
MSGSQNNDKRQFLLERLLDAVKQCQIRFGGRKEIASDSDSRVTCLCAQFEAVLQHGLKRSRGLALTAAAIKQAAGFASKTETEPVFWYYV
KEVLNKHELQRFYSLRHIASDVGRGRAWLRCALNEHSLERYLHMLLADRCRLSTFTEDWSFVMDEERSSMLPTMAAGLNSILFAINIDNK
DLNGQSKFAPTVSDLLKESTQNVTSLLKESTQGVSSLFREITASSAVSILIKPEQETDPLPVVSRNVSADAKCKKERKKKKKVTNIISFD
DEEDEQNSGDVFKKTPGAGESSEDNSDRSSVNIMSAFESPFGPNSNGSQSSNSWKIDSLSLNGEFGYQKLDVKSIDDEDVDENEDDVTGN
SSGRKHRGHSESPEKPLEGNTCLSQMHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLGSLENGTGPEDHVLPDPGLRYSVEASSPGHGS
PLSSLLPSASVPESMTISVTNSVKGTNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILP

>In-frame_SNX29_ENST00000323433_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_224aa
MHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLGSLENGTGPEDHVLPDPGLRYSVEASSPGHGSPLSSLLPSASVPESMTISVTNSVKG
TNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSD

>In-frame_SNX29_ENST00000306030_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_224aa
MHSWAPLKVLHNDSDILFPVSGVGSYSPADAPLGSLENGTGPEDHVLPDPGLRYSVEASSPGHGSPLSSLLPSASVPESMTISVTNSVKG
TNAILWTCLGLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SNX29_ENST00000566228_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_1827nt
ATGAGCGGATCACAGAACAATGACAAAAGACAATTTCTGCTGGAGCGACTGCTGGATGCAGTGAAACAGTGCCAGATCCGCTTTGGAGGG
AGAAAGGAGATTGCCTCGGATTCCGACAGCAGGGTCACCTGTCTGTGTGCCCAGTTTGAAGCCGTCCTGCAGCATGGCTTGAAGAGGAGT
CGAGGATTGGCACTCACAGCGGCAGCGATCAAGCAGGCAGCGGGCTTTGCCAGCAAAACCGAAACAGAGCCCGTGTTCTGGTACTACGTG
AAGGAGGTCCTCAACAAGCACGAGCTGCAGCGCTTCTACTCCCTGCGCCACATCGCCTCAGACGTGGGCCGGGGTCGCGCCTGGCTGCGC
TGTGCCCTCAACGAACACTCCCTGGAGCGCTACCTGCACATGCTCCTGGCCGACCGCTGCAGGCTGAGCACTTTTTATGAAGACTGGTCT
TTTGTGATGGATGAAGAAAGGTCCAGTATGCTTCCTACCATGGCAGCAGGTCTGAACTCCATACTCTTTGCGATTAACATCGACAACAAG
GATTTGAACGGGCAGAGTAAGTTTGCTCCCACCGTTTCAGACCTCTTAAAGGAGTCAACGCAGAACGTGACCTCCTTGCTGAAGGAGTCC
ACGCAAGGAGTGAGCAGCCTGTTCAGGGAGATCACAGCCTCCTCTGCCGTCTCCATCCTCATCAAACCTGAACAGGAGACCGACCCCTTG
CCTGTCGTGTCCAGGAATGTCAGTGCTGATGCCAAATGCAAAAAGGAGCGGAAGAAGAAAAAGAAAGTGACCAACATAATCTCATTTGAT
GATGAGGAAGATGAGCAGAACTCTGGGGACGTGTTTAAAAAGACACCTGGGGCAGGGGAGAGCTCAGAGGACAACTCCGACCGCTCCTCT
GTCAATATCATGTCCGCCTTTGAAAGCCCCTTCGGGCCTAACTCCAATGGAAGTCAGAGCAGCAACTCATGGAAAATTGATTCCCTGTCT
TTGAACGGGGAGTTTGGGTACCAGAAGCTTGATGTGAAAAGCATCGATGATGAAGATGTGGATGAAAACGAAGATGACGTGTATGGAAAC
TCATCAGGAAGGAAGCACAGGGGCCACTCGGAGTCGCCCGAGAAGCCACTGGAAGGGAACACCTGCCTCTCCCAGATGCACAGCTGGGCT
CCGCTGAAGGTGCTGCACAATGACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGATGCCCCCCTCGGAAGC
CTGGAGAACGGGACAGGACCAGAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCTCCAGGCCACGGAAGT
CCTCTGAGCAGCCTGTTACCTTCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGAACGAATGCGATTCTC
TGGACCTGTTTGGGACTGAGCTTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAACTCTGAACCATTAAAG
GACGAGTTTAAAAACACAGGATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGATGAAATTATTCTTCCG
AGAGGCCTCGAGTACACGGTGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGACCATTGCTTTCCACTC
CCAGCTATGGAGGAAGGCGCAACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAG

>In-frame_SNX29_ENST00000323433_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_672nt
ATGCACAGCTGGGCTCCGCTGAAGGTGCTGCACAATGACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGAT
GCCCCCCTCGGAAGCCTGGAGAACGGGACAGGACCAGAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCT
CCAGGCCACGGAAGTCCTCTGAGCAGCCTGTTACCTTCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGA
ACGAATGCGATTCTCTGGACCTGTTTGGGACTGAGCTTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAAC
TCTGAACCATTAAAGGACGAGTTTAAAAACACAGGATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGAT
GAAATTATTCTTCCGAGAGGCCTCGAGTACACGGTGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGAC
CATTGCTTTCCACTCCCAGCTATGGAGGAAGGCGCAACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCT

>In-frame_SNX29_ENST00000306030_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_672nt
ATGCACAGCTGGGCTCCGCTGAAGGTGCTGCACAATGACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGAT
GCCCCCCTCGGAAGCCTGGAGAACGGGACAGGACCAGAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCT
CCAGGCCACGGAAGTCCTCTGAGCAGCCTGTTACCTTCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGA
ACGAATGCGATTCTCTGGACCTGTTTGGGACTGAGCTTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAAC
TCTGAACCATTAAAGGACGAGTTTAAAAACACAGGATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGAT
GAAATTATTCTTCCGAGAGGCCTCGAGTACACGGTGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGAC
CATTGCTTTCCACTCCCAGCTATGGAGGAAGGCGCAACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SNX29_ENST00000566228_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_2117nt
GGAGCTCGGCAGCCGCAGAAGCGGCAGCGGCGGCGGCGCGGCGCAGGCACCGGCCCGGGGAGAGGCACCATGAGCGGATCACAGAACAAT
GACAAAAGACAATTTCTGCTGGAGCGACTGCTGGATGCAGTGAAACAGTGCCAGATCCGCTTTGGAGGGAGAAAGGAGATTGCCTCGGAT
TCCGACAGCAGGGTCACCTGTCTGTGTGCCCAGTTTGAAGCCGTCCTGCAGCATGGCTTGAAGAGGAGTCGAGGATTGGCACTCACAGCG
GCAGCGATCAAGCAGGCAGCGGGCTTTGCCAGCAAAACCGAAACAGAGCCCGTGTTCTGGTACTACGTGAAGGAGGTCCTCAACAAGCAC
GAGCTGCAGCGCTTCTACTCCCTGCGCCACATCGCCTCAGACGTGGGCCGGGGTCGCGCCTGGCTGCGCTGTGCCCTCAACGAACACTCC
CTGGAGCGCTACCTGCACATGCTCCTGGCCGACCGCTGCAGGCTGAGCACTTTTTATGAAGACTGGTCTTTTGTGATGGATGAAGAAAGG
TCCAGTATGCTTCCTACCATGGCAGCAGGTCTGAACTCCATACTCTTTGCGATTAACATCGACAACAAGGATTTGAACGGGCAGAGTAAG
TTTGCTCCCACCGTTTCAGACCTCTTAAAGGAGTCAACGCAGAACGTGACCTCCTTGCTGAAGGAGTCCACGCAAGGAGTGAGCAGCCTG
TTCAGGGAGATCACAGCCTCCTCTGCCGTCTCCATCCTCATCAAACCTGAACAGGAGACCGACCCCTTGCCTGTCGTGTCCAGGAATGTC
AGTGCTGATGCCAAATGCAAAAAGGAGCGGAAGAAGAAAAAGAAAGTGACCAACATAATCTCATTTGATGATGAGGAAGATGAGCAGAAC
TCTGGGGACGTGTTTAAAAAGACACCTGGGGCAGGGGAGAGCTCAGAGGACAACTCCGACCGCTCCTCTGTCAATATCATGTCCGCCTTT
GAAAGCCCCTTCGGGCCTAACTCCAATGGAAGTCAGAGCAGCAACTCATGGAAAATTGATTCCCTGTCTTTGAACGGGGAGTTTGGGTAC
CAGAAGCTTGATGTGAAAAGCATCGATGATGAAGATGTGGATGAAAACGAAGATGACGTGTATGGAAACTCATCAGGAAGGAAGCACAGG
GGCCACTCGGAGTCGCCCGAGAAGCCACTGGAAGGGAACACCTGCCTCTCCCAGATGCACAGCTGGGCTCCGCTGAAGGTGCTGCACAAT
GACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGATGCCCCCCTCGGAAGCCTGGAGAACGGGACAGGACCA
GAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCTCCAGGCCACGGAAGTCCTCTGAGCAGCCTGTTACCT
TCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGAACGAATGCGATTCTCTGGACCTGTTTGGGACTGAGC
TTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAACTCTGAACCATTAAAGGACGAGTTTAAAAACACAGGA
TCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGATGAAATTATTCTTCCGAGAGGCCTCGAGTACACGGTG
GAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGACCATTGCTTTCCACTCCCAGCTATGGAGGAAGGCGCA
ACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAGATAGAGAAATCAATTTCTGCT
AGGTAATTAACCATTTCGACTCGAGCAGTGCCACTTTAAAAATCTTTTGTCAGAATAGATGATGTGTCAGATCTCTTTAGGATGACTGTA
TTTTTCAGTTGCCGATACAGCTTTTTGTCCTCTAACTGTGGAAACTCTTTATGTTAGATATATTTCTCTAGGTTACTGTTGGGAGCTTAA

>In-frame_SNX29_ENST00000323433_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_949nt
GGGGCCACTCGGAGTCGCCCGAGAAGCCACTGGAAGGGAACACCTGCCTCTCCCAGATGCACAGCTGGGCTCCGCTGAAGGTGCTGCACA
ATGACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGATGCCCCCCTCGGAAGCCTGGAGAACGGGACAGGAC
CAGAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCTCCAGGCCACGGAAGTCCTCTGAGCAGCCTGTTAC
CTTCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGAACGAATGCGATTCTCTGGACCTGTTTGGGACTGA
GCTTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAACTCTGAACCATTAAAGGACGAGTTTAAAAACACAG
GATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGATGAAATTATTCTTCCGAGAGGCCTCGAGTACACGG
TGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGACCATTGCTTTCCACTCCCAGCTATGGAGGAAGGCG
CAACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAGATAGAGAAATCAATTTCTG
CTAGGTAATTAACCATTTCGACTCGAGCAGTGCCACTTTAAAAATCTTTTGTCAGAATAGATGATGTGTCAGATCTCTTTAGGATGACTG
TATTTTTCAGTTGCCGATACAGCTTTTTGTCCTCTAACTGTGGAAACTCTTTATGTTAGATATATTTCTCTAGGTTACTGTTGGGAGCTT

>In-frame_SNX29_ENST00000306030_chr16_12172772_+_TNFRSF17_ENST00000053243_chr16_12060052_+_949nt
GGGGCCACTCGGAGTCGCCCGAGAAGCCACTGGAAGGGAACACCTGCCTCTCCCAGATGCACAGCTGGGCTCCGCTGAAGGTGCTGCACA
ATGACTCCGACATCCTCTTCCCTGTCAGTGGCGTGGGCTCCTACAGCCCAGCAGATGCCCCCCTCGGAAGCCTGGAGAACGGGACAGGAC
CAGAGGACCACGTTCTCCCAGATCCTGGACTTCGGTACAGTGTGGAAGCCAGCTCTCCAGGCCACGGAAGTCCTCTGAGCAGCCTGTTAC
CTTCTGCCTCAGTGCCAGAGTCCATGACAATTAGTGTGACCAATTCAGTGAAAGGAACGAATGCGATTCTCTGGACCTGTTTGGGACTGA
GCTTAATAATTTCTTTGGCAGTTTTCGTGCTAATGTTTTTGCTAAGGAAGATAAACTCTGAACCATTAAAGGACGAGTTTAAAAACACAG
GATCAGGTCTCCTGGGCATGGCTAACATTGACCTGGAAAAGAGCAGGACTGGTGATGAAATTATTCTTCCGAGAGGCCTCGAGTACACGG
TGGAAGAATGCACCTGTGAAGACTGCATCAAGAGCAAACCGAAGGTCGACTCTGACCATTGCTTTCCACTCCCAGCTATGGAGGAAGGCG
CAACCATTCTTGTCACCACGAAAACGAATGACTATTGCAAGAGCCTGCCAGCTGCTTTGAGTGCTACGGAGATAGAGAAATCAATTTCTG
CTAGGTAATTAACCATTTCGACTCGAGCAGTGCCACTTTAAAAATCTTTTGTCAGAATAGATGATGTGTCAGATCTCTTTAGGATGACTG
TATTTTTCAGTTGCCGATACAGCTTTTTGTCCTCTAACTGTGGAAACTCTTTATGTTAGATATATTTCTCTAGGTTACTGTTGGGAGCTT


Top

FusionGenePPI for SNX29_TNFRSF17


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SNX29AP2M1, EGFR, TRAF1TNFRSF17TNFSF13B, TRAF1, TRAF2, TRAF3, TRAF5, TRAF6, FAM105A, FAM171A1, OPA3, CD70, PARK2, TARBP1, ZMPSTE24, TSPAN6, INTS7, AGPAT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SNX29_TNFRSF17


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SNX29_TNFRSF17


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource