FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 35284

FusionGeneSummary for SNX27_PIP5K1A

check button Fusion gene summary
Fusion gene informationFusion gene name: SNX27_PIP5K1A
Fusion gene ID: 35284
HgeneTgene
Gene symbol

SNX27

PIP5K1A

Gene ID

81609

8394

Gene namesorting nexin family member 27phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
SynonymsMRT1|MY014-
Cytomap

1q21.3

1q21.3

Type of geneprotein-codingprotein-coding
Descriptionsorting nexin-27methamphetamine-responsive transcript 1phosphatidylinositol 4-phosphate 5-kinase type-1 alpha68 kDa type I phosphatidylinositol 4-phosphate 5-kinase alphaPIP5K1-alphaPIP5KIalphaphosphatidylinositol 4-phosphate 5-kinase type I alphaptdIns(4)P-5-kinase 1 alpha
Modification date2018052320180519
UniProtAcc

Q96L92

Q99755

Ensembl transtripts involved in fusion geneENST00000458013, ENST00000368843, 
ENST00000368838, ENST00000482791, 
ENST00000409426, ENST00000441902, 
ENST00000368890, ENST00000368888, 
ENST00000464105, ENST00000414290, 
Fusion gene scores* DoF score11 X 6 X 9=5945 X 5 X 3=75
# samples 115
** MAII scorelog2(11/594*10)=-2.43295940727611
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/75*10)=-0.584962500721156
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SNX27 [Title/Abstract] AND PIP5K1A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePIP5K1A

GO:0008654

phospholipid biosynthetic process

15157668


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDESCATCGA-L5-A4OQ-01ASNX27chr1

151655921

+PIP5K1Achr1

151212431

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000458013ENST00000409426SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000458013ENST00000441902SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000458013ENST00000368890SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000458013ENST00000368888SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000458013ENST00000464105SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000458013ENST00000414290SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368843ENST00000409426SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368843ENST00000441902SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368843ENST00000368890SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368843ENST00000368888SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000368843ENST00000464105SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000368843ENST00000414290SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368838ENST00000409426SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368838ENST00000441902SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368838ENST00000368890SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
In-frameENST00000368838ENST00000368888SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000368838ENST00000464105SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
5CDS-intronENST00000368838ENST00000414290SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-3CDSENST00000482791ENST00000409426SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-3CDSENST00000482791ENST00000441902SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-3CDSENST00000482791ENST00000368890SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-3CDSENST00000482791ENST00000368888SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-intronENST00000482791ENST00000464105SNX27chr1

151655921

+PIP5K1Achr1

151212431

+
intron-intronENST00000482791ENST00000414290SNX27chr1

151655921

+PIP5K1Achr1

151212431

+

Top

FusionProtFeatures for SNX27_PIP5K1A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SNX27

Q96L92

PIP5K1A

Q99755

Catalyzes the phosphorylation of phosphatidylinositol 4-phosphate (PtdIns4P) to form phosphatidylinositol 4,5-bisphosphate(PtdIns(4,5)P2). PtdIns(4,5)P2 is involved in a variety ofcellular processes and is the substrate to formphosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3),another second messenger. The majority of PtdIns(4,5)P2 is thoughtto occur via type I phosphatidylinositol 4-phosphate 5-kinasesgiven the abundance of PtdIns4P. Participates in a variety ofcellular processes such as actin cytoskeleton organization, celladhesion, migration and phagocytosis. Required for membraneruffling formation, actin organization and focal adhesionformation during directional cell migration by controllingintegrin-induced translocation of RAC1 to the plasma membrane.Together with PIP5K1C is required for phagocytosis, but theyregulate different types of actin remodeling at sequential steps.Promotes particle ingestion by activating WAS that induces Arp2/3dependent actin polymerization at the nascent phagocytic cup.Together with PIP5K1B is required after stimulation of G-proteincoupled receptors for stable platelet adhesion. Plays a roleduring calcium-induced keratinocyte differentiation. Recruited tothe plasma membrane by the E-cadherin/beta-catenin complex whereit provides the substrate PtdIns(4,5)P2 for the production ofPtdIns(3,4,5)P3, diacylglycerol and inositol 1,4,5-trisphosphatethat mobilize internal calcium and drive keratinocytedifferentiation. Together with PIP5K1C have a role duringembryogenesis. Functions also in the nucleus where acts as anactivator of TUT1 adenylyltransferase activity in nuclearspeckles, thereby regulating mRNA polyadenylation of a select setof mRNAs. {ECO:0000269|PubMed:18288197,ECO:0000269|PubMed:19158393, ECO:0000269|PubMed:20660631}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNX27chr1:151655921chr1:151212431ENST00000368838+711161_269320436DomainPX
HgeneSNX27chr1:151655921chr1:151212431ENST00000368838+71143_136320436DomainPDZ
HgeneSNX27chr1:151655921chr1:151212431ENST00000368843+812161_269413529DomainPX
HgeneSNX27chr1:151655921chr1:151212431ENST00000368843+81243_136413529DomainPDZ
HgeneSNX27chr1:151655921chr1:151212431ENST00000458013+812161_269413542DomainPX
HgeneSNX27chr1:151655921chr1:151212431ENST00000458013+81243_136413542DomainPDZ
HgeneSNX27chr1:151655921chr1:151212431ENST00000368843+812273_362413529RegionNote=FERM-like region F1
HgeneSNX27chr1:151655921chr1:151212431ENST00000458013+812273_362413542RegionNote=FERM-like region F1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSNX27chr1:151655921chr1:151212431ENST00000368838+711273_362320436RegionNote=FERM-like region F1
HgeneSNX27chr1:151655921chr1:151212431ENST00000368838+711373_421320436RegionNote=FERM-like region F2
HgeneSNX27chr1:151655921chr1:151212431ENST00000368838+711425_525320436RegionNote=FERM-like region F3
HgeneSNX27chr1:151655921chr1:151212431ENST00000368843+812373_421413529RegionNote=FERM-like region F2
HgeneSNX27chr1:151655921chr1:151212431ENST00000368843+812425_525413529RegionNote=FERM-like region F3
HgeneSNX27chr1:151655921chr1:151212431ENST00000458013+812373_421413542RegionNote=FERM-like region F2
HgeneSNX27chr1:151655921chr1:151212431ENST00000458013+812425_525413542RegionNote=FERM-like region F3
TgenePIP5K1Achr1:151655921chr1:151212431ENST00000368888+101681_449426563DomainPIPK
TgenePIP5K1Achr1:151655921chr1:151212431ENST00000368890+91481_449413501DomainPIPK
TgenePIP5K1Achr1:151655921chr1:151212431ENST00000441902+81481_449386523DomainPIPK


Top

FusionGeneSequence for SNX27_PIP5K1A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_501aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGRPDV

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_501aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGRPDV

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_550aa
MADEDGEGIHPSAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAA
DRAGVRKGDRILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKF
VVTNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYN
GVSDVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKF
RSGSSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKL

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_457aa
MGLSFSLFPLRNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKFVVT
NVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYNGVS
DVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKWLFT
TEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSG
SSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVA

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_457aa
MGLSFSLFPLRNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKFVVT
NVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYNGVS
DVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKWLFT
TEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSG
SSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVA

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_408aa
MGLSFSLFPLRNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKFVVT
NVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYNGVS
DVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKWLFT
TEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPCVHLGRPDVLPQ

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_457aa
MGLSFSLFPLRNHVNVEGATHKQVVDLIRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFTDYTEKQAVPISVPRYKHVEQNGEKFVVT
NVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEETLEKVCSIRVIGESDIMQEFLSESDENYNGVS
DVELRVALPDGTTVTVRVKKNSTTDQVTQAIAAKVGMDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNTTSAVPGTCLTIRKWLFT
TEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSTQLQKLYEQRKMVMDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPSKKFRSG
SSFSRRAGSSGNSCITYQPSVSGEHKAQVTTKAEVEPGVHLGRPDVLPQTPPLEEISEGSPIPDPSFSPLVGETLQMLTTSTTLEKLEVA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_1503nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTGCGTTCACCTTGGTCGTCCTGATGTT
TTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAA

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_1503nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTGCGTTCACCTTGGTCGTCCTGATGTT
TTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAA

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1650nt
ATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGCGGCGGCGGCGGGGGGTCTGGGCTCCACTGC
GCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAGTCCGGCTACGGCTTCAACGTGCGGGGCCAA
GTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCATGTGAGCGCCGTGCTGCCCGGGGGGGCGGCC
GATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTG
ATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTG
GGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTT
GTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAG
TTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAA
GAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAAT
GGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTA
TATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGT
AAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGG
CTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAA
GGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGC
CCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTT
CGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCA
CAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGT
GAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTT

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_1371nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_1371nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_1224nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAG
ACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACT

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1371nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_3409nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG
CTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGA
TTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATA
GAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAG
AGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGGTGGTATGGATTTTCAACTGGCCAACCCTTTGCCTCCACTATTGAATTTTTT
TCAGACCCCCATTCTTCATGCTGGAAATGGGATTGCTGGACTTGGCAGCTTTCTTTCCCCTCGTCTTTGACTAGGAACCGGACTCTTAAT
TTCCTCAGGACAGACTAGCTGGCACATTATCCCTACCTTAGTTCTTTCTCTCTGACTCCTGGAAGAATACTCCTGTAATCTCTGTAAAGG
TTTTTGGGGGATAAGGGTGTTTAACCACCTCCCAGCTTTCTTCTTCTTTTTTTTTTTCTGAAAAAAGGAAAAAGCACACAGCACACAATT
TCAAGCCATTTTCAGATCAGAACTCCAGAAGTGTTGACAAGATGCCTATTCGTAGAGTTCCCTCAGAAGAGCCATGGTGTTTATGAAGAG
AAGAGTAGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTAAACTCCTCCTCTCTTGATGAATTTCTTAAGGCTGAAGGAATGAAGAGAGTG
GGACATGGGGTAATCTTTATCCCTTTTGTTAAAACAGGAGGCAGCCATGGGCTGGGAGATCATAGCCCTTCCTAGGCAGAATCCTGTTCA
CTGCCAGGCTATAGTAATTATTACTATTTTGCAATTTGAAATATATTCTGGTTGTTTTTCTAAATGTGAAGACTTACCAAATGAATTTTA
GATCATTCTCCAGAGGAGATTTTTTTTGCTCTTCTCATCTTTTCCAACAGTGTTCTCCTGTTTGTGGAGCTAAGGTAAAGAGGGGACACT
TCTGTCTGTTTAACAGACAGTCCATATCTGTGAGGCCAGCAAATATTTTCTTAAACTCATGGGGAGACAGCAGATTCTTGCCTTGGTGAG
GTCATTGCTGTGCCATATGTCCTACCCCCCTGTCTTCATGCAGGGAAGTTGGAAATGGGGGCTACATATGCCCTCTCCTCCCCGTCTACA
AGAGTTGTGGTTTTCCATCTGATCCTTCCACTCTTGTCAGGGGAAGAAGGGGGCCTGGTATCTCAGGCAGATTGTTGAATTCCTGTTCTA
TCCCTTCTCTATCCCACCCTGCCTTGATAATATGTTAGCCCATACCCCAAATAACTGTCTATATTAGACACCCCCAGCCAGTTTCTGGCT
GCCTGTCTTTGCTGCCATGTTTTTTACAAGAAGGAAAGAATTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATTTAAGTGT
TTTATTAAGGACAGAGTTCTGTTAGGGGTGGGAGGGAATATTTGAGGGAGGGCTGGGTCTTAGGGAAAGGAATGGGGAAGCAACATTTTT

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_2054nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG
CTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGA
TTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATA
GAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAG

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_3289nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGT
TTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCAT
TAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTT
CTTCTACTTGGTCATCAAAAAAGGAGTGTAATAGAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCC
TCTTCCTCATGAATGGGCCTTAGTGCCTCAGAGAGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGGTGGTATGGATTTTCAACT
GGCCAACCCTTTGCCTCCACTATTGAATTTTTTTCAGACCCCCATTCTTCATGCTGGAAATGGGATTGCTGGACTTGGCAGCTTTCTTTC
CCCTCGTCTTTGACTAGGAACCGGACTCTTAATTTCCTCAGGACAGACTAGCTGGCACATTATCCCTACCTTAGTTCTTTCTCTCTGACT
CCTGGAAGAATACTCCTGTAATCTCTGTAAAGGTTTTTGGGGGATAAGGGTGTTTAACCACCTCCCAGCTTTCTTCTTCTTTTTTTTTTT
CTGAAAAAAGGAAAAAGCACACAGCACACAATTTCAAGCCATTTTCAGATCAGAACTCCAGAAGTGTTGACAAGATGCCTATTCGTAGAG
TTCCCTCAGAAGAGCCATGGTGTTTATGAAGAGAAGAGTAGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTAAACTCCTCCTCTCTTGAT
GAATTTCTTAAGGCTGAAGGAATGAAGAGAGTGGGACATGGGGTAATCTTTATCCCTTTTGTTAAAACAGGAGGCAGCCATGGGCTGGGA
GATCATAGCCCTTCCTAGGCAGAATCCTGTTCACTGCCAGGCTATAGTAATTATTACTATTTTGCAATTTGAAATATATTCTGGTTGTTT
TTCTAAATGTGAAGACTTACCAAATGAATTTTAGATCATTCTCCAGAGGAGATTTTTTTTGCTCTTCTCATCTTTTCCAACAGTGTTCTC
CTGTTTGTGGAGCTAAGGTAAAGAGGGGACACTTCTGTCTGTTTAACAGACAGTCCATATCTGTGAGGCCAGCAAATATTTTCTTAAACT
CATGGGGAGACAGCAGATTCTTGCCTTGGTGAGGTCATTGCTGTGCCATATGTCCTACCCCCCTGTCTTCATGCAGGGAAGTTGGAAATG
GGGGCTACATATGCCCTCTCCTCCCCGTCTACAAGAGTTGTGGTTTTCCATCTGATCCTTCCACTCTTGTCAGGGGAAGAAGGGGGCCTG
GTATCTCAGGCAGATTGTTGAATTCCTGTTCTATCCCTTCTCTATCCCACCCTGCCTTGATAATATGTTAGCCCATACCCCAAATAACTG
TCTATATTAGACACCCCCAGCCAGTTTCTGGCTGCCTGTCTTTGCTGCCATGTTTTTTACAAGAAGGAAAGAATTCTTGCTATTTTTTTT
TCATAATTTACTATTTATGATGTATTTAAGTGTTTTATTAAGGACAGAGTTCTGTTAGGGGTGGGAGGGAATATTTGAGGGAGGGCTGGG
TCTTAGGGAAAGGAATGGGGAAGCAACATTTTTATTAAGTGTTACTATTTGCCTCTACTTTGTATTGTTCAGAAATGGCAAATACAATAT

>In-frame_SNX27_ENST00000458013_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1793nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_3409nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG
CTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGA
TTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATA
GAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAG
AGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGGTGGTATGGATTTTCAACTGGCCAACCCTTTGCCTCCACTATTGAATTTTTT
TCAGACCCCCATTCTTCATGCTGGAAATGGGATTGCTGGACTTGGCAGCTTTCTTTCCCCTCGTCTTTGACTAGGAACCGGACTCTTAAT
TTCCTCAGGACAGACTAGCTGGCACATTATCCCTACCTTAGTTCTTTCTCTCTGACTCCTGGAAGAATACTCCTGTAATCTCTGTAAAGG
TTTTTGGGGGATAAGGGTGTTTAACCACCTCCCAGCTTTCTTCTTCTTTTTTTTTTTCTGAAAAAAGGAAAAAGCACACAGCACACAATT
TCAAGCCATTTTCAGATCAGAACTCCAGAAGTGTTGACAAGATGCCTATTCGTAGAGTTCCCTCAGAAGAGCCATGGTGTTTATGAAGAG
AAGAGTAGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTAAACTCCTCCTCTCTTGATGAATTTCTTAAGGCTGAAGGAATGAAGAGAGTG
GGACATGGGGTAATCTTTATCCCTTTTGTTAAAACAGGAGGCAGCCATGGGCTGGGAGATCATAGCCCTTCCTAGGCAGAATCCTGTTCA
CTGCCAGGCTATAGTAATTATTACTATTTTGCAATTTGAAATATATTCTGGTTGTTTTTCTAAATGTGAAGACTTACCAAATGAATTTTA
GATCATTCTCCAGAGGAGATTTTTTTTGCTCTTCTCATCTTTTCCAACAGTGTTCTCCTGTTTGTGGAGCTAAGGTAAAGAGGGGACACT
TCTGTCTGTTTAACAGACAGTCCATATCTGTGAGGCCAGCAAATATTTTCTTAAACTCATGGGGAGACAGCAGATTCTTGCCTTGGTGAG
GTCATTGCTGTGCCATATGTCCTACCCCCCTGTCTTCATGCAGGGAAGTTGGAAATGGGGGCTACATATGCCCTCTCCTCCCCGTCTACA
AGAGTTGTGGTTTTCCATCTGATCCTTCCACTCTTGTCAGGGGAAGAAGGGGGCCTGGTATCTCAGGCAGATTGTTGAATTCCTGTTCTA
TCCCTTCTCTATCCCACCCTGCCTTGATAATATGTTAGCCCATACCCCAAATAACTGTCTATATTAGACACCCCCAGCCAGTTTCTGGCT
GCCTGTCTTTGCTGCCATGTTTTTTACAAGAAGGAAAGAATTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATTTAAGTGT
TTTATTAAGGACAGAGTTCTGTTAGGGGTGGGAGGGAATATTTGAGGGAGGGCTGGGTCTTAGGGAAAGGAATGGGGAAGCAACATTTTT

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_2054nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG
CTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGA
TTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATA
GAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAG

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_3289nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGT
TTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCAT
TAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTT
CTTCTACTTGGTCATCAAAAAAGGAGTGTAATAGAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCC
TCTTCCTCATGAATGGGCCTTAGTGCCTCAGAGAGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGGTGGTATGGATTTTCAACT
GGCCAACCCTTTGCCTCCACTATTGAATTTTTTTCAGACCCCCATTCTTCATGCTGGAAATGGGATTGCTGGACTTGGCAGCTTTCTTTC
CCCTCGTCTTTGACTAGGAACCGGACTCTTAATTTCCTCAGGACAGACTAGCTGGCACATTATCCCTACCTTAGTTCTTTCTCTCTGACT
CCTGGAAGAATACTCCTGTAATCTCTGTAAAGGTTTTTGGGGGATAAGGGTGTTTAACCACCTCCCAGCTTTCTTCTTCTTTTTTTTTTT
CTGAAAAAAGGAAAAAGCACACAGCACACAATTTCAAGCCATTTTCAGATCAGAACTCCAGAAGTGTTGACAAGATGCCTATTCGTAGAG
TTCCCTCAGAAGAGCCATGGTGTTTATGAAGAGAAGAGTAGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTAAACTCCTCCTCTCTTGAT
GAATTTCTTAAGGCTGAAGGAATGAAGAGAGTGGGACATGGGGTAATCTTTATCCCTTTTGTTAAAACAGGAGGCAGCCATGGGCTGGGA
GATCATAGCCCTTCCTAGGCAGAATCCTGTTCACTGCCAGGCTATAGTAATTATTACTATTTTGCAATTTGAAATATATTCTGGTTGTTT
TTCTAAATGTGAAGACTTACCAAATGAATTTTAGATCATTCTCCAGAGGAGATTTTTTTTGCTCTTCTCATCTTTTCCAACAGTGTTCTC
CTGTTTGTGGAGCTAAGGTAAAGAGGGGACACTTCTGTCTGTTTAACAGACAGTCCATATCTGTGAGGCCAGCAAATATTTTCTTAAACT
CATGGGGAGACAGCAGATTCTTGCCTTGGTGAGGTCATTGCTGTGCCATATGTCCTACCCCCCTGTCTTCATGCAGGGAAGTTGGAAATG
GGGGCTACATATGCCCTCTCCTCCCCGTCTACAAGAGTTGTGGTTTTCCATCTGATCCTTCCACTCTTGTCAGGGGAAGAAGGGGGCCTG
GTATCTCAGGCAGATTGTTGAATTCCTGTTCTATCCCTTCTCTATCCCACCCTGCCTTGATAATATGTTAGCCCATACCCCAAATAACTG
TCTATATTAGACACCCCCAGCCAGTTTCTGGCTGCCTGTCTTTGCTGCCATGTTTTTTACAAGAAGGAAAGAATTCTTGCTATTTTTTTT
TCATAATTTACTATTTATGATGTATTTAAGTGTTTTATTAAGGACAGAGTTCTGTTAGGGGTGGGAGGGAATATTTGAGGGAGGGCTGGG
TCTTAGGGAAAGGAATGGGGAAGCAACATTTTTATTAAGTGTTACTATTTGCCTCTACTTTGTATTGTTCAGAAATGGCAAATACAATAT

>In-frame_SNX27_ENST00000368843_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1793nt
TCCCGCGGCCGGCGGATCGGGCGCGCGCGTCGGGGGTCGTCCGGCTGCCAGGCAGGGCGAGCACGCGCCGGGAGGCCTTGGAGGCGTAGG
GGGCGGGGGTACGGCTCGCCTGCTCGCAAGATGGCGGACGAGGACGGGGAAGGGATTCATCCCTCAGCCCCTCACAGGAACGGAGGTGGC
GGCGGCGGCGGGGGGTCTGGGCTCCACTGCGCCGGGAACGGCGGCGGGGGAGGCGGCGGCCCGCGGGTCGTGCGCATCGTCAAGTCCGAG
TCCGGCTACGGCTTCAACGTGCGGGGCCAAGTGAGCGAGGGCGGGCAACTGCGGAGCATCAACGGGGAGCTGTACGCGCCGCTGCAGCAT
GTGAGCGCCGTGCTGCCCGGGGGGGCGGCCGATCGGGCCGGGGTGCGCAAGGGGGACCGCATCCTGGAGGTGAACCACGTGAATGTTGAG
GGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCAGGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCA
GATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCATTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATAC
AAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATATAATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTT
GCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAACTTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAA
CAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTAGAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAA
TTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCCGACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGG
GTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCTATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTA
TTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCACCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTG
CCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACAACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTC
TTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATCAAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAA
ATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTCTACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATT
CCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGCTCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTAC
CAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACAACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTA
CCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATG

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000409426_chr1_151212431_+_3010nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA
GAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCC
CCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATAGAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGA
AGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAGAGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGG
TGGTATGGATTTTCAACTGGCCAACCCTTTGCCTCCACTATTGAATTTTTTTCAGACCCCCATTCTTCATGCTGGAAATGGGATTGCTGG
ACTTGGCAGCTTTCTTTCCCCTCGTCTTTGACTAGGAACCGGACTCTTAATTTCCTCAGGACAGACTAGCTGGCACATTATCCCTACCTT
AGTTCTTTCTCTCTGACTCCTGGAAGAATACTCCTGTAATCTCTGTAAAGGTTTTTGGGGGATAAGGGTGTTTAACCACCTCCCAGCTTT
CTTCTTCTTTTTTTTTTTCTGAAAAAAGGAAAAAGCACACAGCACACAATTTCAAGCCATTTTCAGATCAGAACTCCAGAAGTGTTGACA
AGATGCCTATTCGTAGAGTTCCCTCAGAAGAGCCATGGTGTTTATGAAGAGAAGAGTAGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTA
AACTCCTCCTCTCTTGATGAATTTCTTAAGGCTGAAGGAATGAAGAGAGTGGGACATGGGGTAATCTTTATCCCTTTTGTTAAAACAGGA
GGCAGCCATGGGCTGGGAGATCATAGCCCTTCCTAGGCAGAATCCTGTTCACTGCCAGGCTATAGTAATTATTACTATTTTGCAATTTGA
AATATATTCTGGTTGTTTTTCTAAATGTGAAGACTTACCAAATGAATTTTAGATCATTCTCCAGAGGAGATTTTTTTTGCTCTTCTCATC
TTTTCCAACAGTGTTCTCCTGTTTGTGGAGCTAAGGTAAAGAGGGGACACTTCTGTCTGTTTAACAGACAGTCCATATCTGTGAGGCCAG
CAAATATTTTCTTAAACTCATGGGGAGACAGCAGATTCTTGCCTTGGTGAGGTCATTGCTGTGCCATATGTCCTACCCCCCTGTCTTCAT
GCAGGGAAGTTGGAAATGGGGGCTACATATGCCCTCTCCTCCCCGTCTACAAGAGTTGTGGTTTTCCATCTGATCCTTCCACTCTTGTCA
GGGGAAGAAGGGGGCCTGGTATCTCAGGCAGATTGTTGAATTCCTGTTCTATCCCTTCTCTATCCCACCCTGCCTTGATAATATGTTAGC
CCATACCCCAAATAACTGTCTATATTAGACACCCCCAGCCAGTTTCTGGCTGCCTGTCTTTGCTGCCATGTTTTTTACAAGAAGGAAAGA
ATTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATTTAAGTGTTTTATTAAGGACAGAGTTCTGTTAGGGGTGGGAGGGAAT
ATTTGAGGGAGGGCTGGGTCTTAGGGAAAGGAATGGGGAAGCAACATTTTTATTAAGTGTTACTATTTGCCTCTACTTTGTATTGTTCAG

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000441902_chr1_151212431_+_1655nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA
GAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGCCATCTCTGTGATCCCAAGATGTCAGCCCTTGCC
CCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATAGAAGTGAGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGA
AGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAGAGTTGAGGACCGCAGCATCCCCTCCACTCCAGAGTTGGG

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368890_chr1_151212431_+_2890nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAG
ACTCCACCTTTGGAGGAAATCAGTGAGGGCTCGCCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACT
ACAAGTACAACCTTGGAAAAGCTTGAAGTTGCAGAGTCAGAGTTCACCCATTAAGCGCAAAGCCTCAGAAGACCTGGAACAAGATTCTGC
CATCTCTGTGATCCCAAGATGTCAGCCCTTGCCCCAGCAATGCTGAATTTTCTTCTACTTGGTCATCAAAAAAGGAGTGTAATAGAAGTG
AGGGGAGCTGCTCCTCCATCTTCTTCCTGAAGAAGAACCTTCTCTCCTTCCTCTTCCTCATGAATGGGCCTTAGTGCCTCAGAGAGTTGA
GGACCGCAGCATCCCCTCCACTCCAGAGTTGGGTGGTATGGATTTTCAACTGGCCAACCCTTTGCCTCCACTATTGAATTTTTTTCAGAC
CCCCATTCTTCATGCTGGAAATGGGATTGCTGGACTTGGCAGCTTTCTTTCCCCTCGTCTTTGACTAGGAACCGGACTCTTAATTTCCTC
AGGACAGACTAGCTGGCACATTATCCCTACCTTAGTTCTTTCTCTCTGACTCCTGGAAGAATACTCCTGTAATCTCTGTAAAGGTTTTTG
GGGGATAAGGGTGTTTAACCACCTCCCAGCTTTCTTCTTCTTTTTTTTTTTCTGAAAAAAGGAAAAAGCACACAGCACACAATTTCAAGC
CATTTTCAGATCAGAACTCCAGAAGTGTTGACAAGATGCCTATTCGTAGAGTTCCCTCAGAAGAGCCATGGTGTTTATGAAGAGAAGAGT
AGTGATTGCTCTGCCAGAAGCAGCTCCTCTTTAAACTCCTCCTCTCTTGATGAATTTCTTAAGGCTGAAGGAATGAAGAGAGTGGGACAT
GGGGTAATCTTTATCCCTTTTGTTAAAACAGGAGGCAGCCATGGGCTGGGAGATCATAGCCCTTCCTAGGCAGAATCCTGTTCACTGCCA
GGCTATAGTAATTATTACTATTTTGCAATTTGAAATATATTCTGGTTGTTTTTCTAAATGTGAAGACTTACCAAATGAATTTTAGATCAT
TCTCCAGAGGAGATTTTTTTTGCTCTTCTCATCTTTTCCAACAGTGTTCTCCTGTTTGTGGAGCTAAGGTAAAGAGGGGACACTTCTGTC
TGTTTAACAGACAGTCCATATCTGTGAGGCCAGCAAATATTTTCTTAAACTCATGGGGAGACAGCAGATTCTTGCCTTGGTGAGGTCATT
GCTGTGCCATATGTCCTACCCCCCTGTCTTCATGCAGGGAAGTTGGAAATGGGGGCTACATATGCCCTCTCCTCCCCGTCTACAAGAGTT
GTGGTTTTCCATCTGATCCTTCCACTCTTGTCAGGGGAAGAAGGGGGCCTGGTATCTCAGGCAGATTGTTGAATTCCTGTTCTATCCCTT
CTCTATCCCACCCTGCCTTGATAATATGTTAGCCCATACCCCAAATAACTGTCTATATTAGACACCCCCAGCCAGTTTCTGGCTGCCTGT
CTTTGCTGCCATGTTTTTTACAAGAAGGAAAGAATTCTTGCTATTTTTTTTTCATAATTTACTATTTATGATGTATTTAAGTGTTTTATT
AAGGACAGAGTTCTGTTAGGGGTGGGAGGGAATATTTGAGGGAGGGCTGGGTCTTAGGGAAAGGAATGGGGAAGCAACATTTTTATTAAG
TGTTACTATTTGCCTCTACTTTGTATTGTTCAGAAATGGCAAATACAATATAAAAGTGATATATGGTTTTAATGTAATAAACTTTAATGA

>In-frame_SNX27_ENST00000368838_chr1_151655921_+_PIP5K1A_ENST00000368888_chr1_151212431_+_1394nt
ATGGGATTGTCTTTTTCCCTTTTTCCCCTTAGGAACCACGTGAATGTTGAGGGGGCGACACACAAGCAGGTGGTGGACCTGATTCGAGCA
GGCGAGAAGGAATTGATCTTGACAGTGTTATCTGTACCTCCTCATGAGGCAGATAACCTAGATCCCAGTGACGACTCGTTGGGACAATCA
TTTTATGATTACACAGAAAAGCAAGCAGTGCCCATATCGGTCCCCAGATACAAACATGTGGAGCAGAATGGTGAGAAGTTTGTGGTATAT
AATGTTTACATGGCAGGGAGGCAGCTGTGTTCTAAGCGGTACCGGGAGTTTGCTATCCTACACCAGAACCTGAAGAGAGAGTTTGCCAAC
TTTACATTTCCTCGACTCCCAGGGAAGTGGCCATTTTCATTATCAGAACAACAATTAGATGCCCGACGTCGGGGATTGGAAGAATATCTA
GAAAAAGTGTGTTCAATACGAGTAATTGGTGAGAGTGACATCATGCAGGAATTCCTATCAGAATCCGATGAGAACTACAATGGTGTGTCC
GACGTAGAGCTGAGAGTAGCATTACCAGATGGAACAACGGTTACAGTCAGGGTTAAAAAGAACAGTACTACAGACCAAGTATATCAGGCT
ATCGCAGCAAAGGTTGGCATGGACAGTACGACAGTGAATTACTTTGCCTTATTTGAAGTGATCAGTCACTCCTTTGTACGTAAATTGGCA
CCTAATGAGTTTCCTCACAAACTCTACATTCAGAATTATACATCAGCTGTGCCAGGCACCTGCTTGACCATTCGAAAGTGGCTTTTTACA
ACAGAAGAAGAAATTCTCTTAAATGACAATGACCTTGCTGTTACCTACTTCTTTCATCAGGCAGTCGATGATGTGAAGAAAGGTTACATC
AAAGCAGAAGAAAAGTCCTATCAATTACAGAAGCTATACGAACAAAGAAAAATGGTCATGGACACTGTCTCAGTGCATCGCCCAGGCTTC
TACGCTGAACGGTTCCAGCGCTTCATGTGCAACACAGTATTTAAGAAGATTCCCTTGAAGCCTTCTCCTTCCAAAAAGTTTCGGTCTGGC
TCATCTTTCTCTCGGCGAGCAGGCTCCAGTGGCAACTCCTGCATTACTTACCAGCCATCGGTCTCTGGGGAACACAAGGCACAAGTGACA
ACAAAGGCAGAAGTGGAGCCAGGCGTTCACCTTGGTCGTCCTGATGTTTTACCTCAGACTCCACCTTTGGAGGAAATCAGTGAGGGCTCG
CCTATTCCTGACCCCAGTTTCTCACCTCTAGTTGGAGAGACTTTGCAAATGCTAACTACAAGTACAACCTTGGAAAAGCTTGAAGTTGCA


Top

FusionGenePPI for SNX27_PIP5K1A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SNX27PHLPP2, PHLPP1, ELAVL1, PNPLA3, AKT2, HLCS, ABCC4, SELP, INSR, NTRK1, APP, VPS26B, RASSF1, CDK16, MSH2, CENPJ, USB1, TIGD6, APOA1, CDS1, CP, HP, C3, IGHA2, BPIFA1, C4A, IGHG3, LTF, PRR4, FIG4, SERPINA1, PIGR, FGB, LACRT, ORM1, FGA, FGG, AHSG, SCGB2A1, IGHM, LRRC36, GPR156, IGHG2, MRAP2, APOA4, BPIFB1, IGHG4, IGLC2, TF, LCN2, PROSER2, C6orf58, HPX, FAM19A3, SERPINA3, CST1, IGHA1, DMBT1, TTR, ZG16B, IGJ, KNG1, SCGB1D1, CHRDL1, IGLL5, ALB, LYZ, LCN1, CST4, IGHG1, PTPRQ, PIBF1, EEA1, TRIM25PIP5K1APIP5KL1, APP, CSNK1A1, SIRT1, HECW2, ITGB1BP2, MOV10, NXF1, KCTD17, RABGGTB, SKAP1, GFOD1, FLNC, PIP5K1C, DCAF5, NRP1, RAD21, CENPB, NRXN3, PELP1, HTATSF1, STAG2, GPC3, TRIM41, TGFBR3, MED4, MYH9, RPL10, RHOU, PIP4K2A, PRKCA, IMPDH1, CCDC97, PFDN2, GPR156, CAMK2D, ARIH1, ARHGAP22, KLHDC3, ZSCAN31, ZC3H18, AHCYL2, KBTBD7, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SNX27_PIP5K1A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SNX27_PIP5K1A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource