FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3527

FusionGeneSummary for ATP9B_LUC7L

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP9B_LUC7L
Fusion gene ID: 3527
HgeneTgene
Gene symbol

ATP9B

LUC7L

Gene ID

374868

55692

Gene nameATPase phospholipid transporting 9B (putative)LUC7 like
SynonymsATPASEP|ATPIIB|HUSSY-20|NEO1L|hMMR1LUC7B1|Luc7|SR+89|hLuc7B1
Cytomap

18q23

16p13.3

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IIBATPase type IV, phospholipid transporting (P-type)ATPase, class II, type 9Bmacrophage MHC receptor 1putative RNA-binding protein Luc7-like 1putative SR protein LUC7B1sarcoplasmic reticulum protein LUC7B1
Modification date2018052320180523
UniProtAcc

O43861

Q9NQ29

Ensembl transtripts involved in fusion geneENST00000426216, ENST00000307671, 
ENST00000586722, ENST00000591464, 
ENST00000458297, ENST00000543761, 
ENST00000293872, ENST00000337351, 
ENST00000397783, ENST00000397780, 
ENST00000494366, 
Fusion gene scores* DoF score4 X 4 X 2=3211 X 10 X 6=660
# samples 312
** MAII scorelog2(3/32*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/660*10)=-2.4594316186373
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ATP9B [Title/Abstract] AND LUC7L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1L0-01AATP9Bchr18

76953263

+LUC7Lchr16

258187

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000426216ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000426216ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000426216ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000426216ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
5CDS-intronENST00000426216ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000307671ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000307671ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000307671ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
In-frameENST00000307671ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
5CDS-intronENST00000307671ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000586722ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000586722ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000586722ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000586722ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-intronENST00000586722ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000591464ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000591464ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000591464ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000591464ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-intronENST00000591464ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000458297ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000458297ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000458297ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000458297ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-intronENST00000458297ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000543761ENST00000293872ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000543761ENST00000337351ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000543761ENST00000397783ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-3CDSENST00000543761ENST00000397780ATP9Bchr18

76953263

+LUC7Lchr16

258187

-
intron-intronENST00000543761ENST00000494366ATP9Bchr18

76953263

+LUC7Lchr16

258187

-

Top

FusionProtFeatures for ATP9B_LUC7L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP9B

O43861

LUC7L

Q9NQ29

May bind to RNA via its Arg/Ser-rich domain.{ECO:0000269|PubMed:11170747}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929169_1733181137Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291_1463181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930169_1733181148Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301_1463181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929147_1683181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929174_1963181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930147_1683181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930174_1963181148TransmembraneHelical
TgeneLUC7Lchr18:76953263chr16:258187ENST00000293872-210218_25985372Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000293872-21087_17785372Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000337351-29218_25985326Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000337351-2987_17785326Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000397783-210218_25985424Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000397783-21087_17785424Coiled coilOntology_term=ECO:0000255
TgeneLUC7Lchr18:76953263chr16:258187ENST00000293872-210243_36285372Compositional biasNote=Arg/Ser-rich
TgeneLUC7Lchr18:76953263chr16:258187ENST00000337351-29243_36285326Compositional biasNote=Arg/Ser-rich
TgeneLUC7Lchr18:76953263chr16:258187ENST00000397783-210243_36285424Compositional biasNote=Arg/Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291032_10383181137Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291062_10673181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291089_11053181137Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291131_11473181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929197_3803181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929402_4093181137Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929432_9303181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929952_9633181137Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929983_10123181137Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301032_10383181148Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301062_10673181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301089_11053181148Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301131_11473181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930197_3803181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930402_4093181148Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930432_9303181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930952_9633181148Topological domainExtracellular
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930983_10123181148Topological domainCytoplasmic
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291013_10313181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291039_10613181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291068_10883181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+9291106_11303181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929381_4013181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929410_4313181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929931_9513181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000307671+929964_9823181137TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301013_10313181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301039_10613181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301068_10883181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+9301106_11303181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930381_4013181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930410_4313181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930931_9513181148TransmembraneHelical
HgeneATP9Bchr18:76953263chr16:258187ENST00000426216+930964_9823181148TransmembraneHelical


Top

FusionGeneSequence for ATP9B_LUC7L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_605aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_605aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_559aa
MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCD
GWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLTEQFKFFLNLTFLVISCSQFVPALKIGTLY
TYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLTSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLD
GETDWKLKVAVSCTQQLPALGDLFSISATVTAQKPQMDIHSFEGTFTRAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVH
ELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLG
FIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_1815nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG
AGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTTCTCCAGAGAGCGGGCATCCAGAGAGGAGTCCTGG
GAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGTCAGAAGAGAAGGAG

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_1815nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG
AGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTTCTCCAGAGAGCGGGCATCCAGAGAGGAGTCCTGG
GAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGTCAGAAGAGAAGGAG

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_1677nt
ATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACTACAGCGCCGCGGGG
CCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAATGATGTCTGAAGAA
GGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGTGGTTTGTCTGTGAT
GGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTCGCACAGTATGGCTT
GGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTATACCTGGGGTTTTG
TATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAATAGGCTATCTCTAC
ACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTCAGCGTGACAAGGAA
GTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAGACCTCATCATAGTG
GAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAACTGATCAACTAGAT
GGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTATCAGTGCTTATGTT
TATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCTTTATTGCTGAATGT
GATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGGCAGAAAAAGTACAT
GAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCCAGAAGATTCTTATG
GAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTCAGCAGCAAAAGCTG
CGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCAAGTTACACTTGGGG
TTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATCGCTTGAGGAGGAGA
GAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCCGGGATCGGCGTCGG
AGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACCGCAGCCGTTCCCGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_2061nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAG
CTCGCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCT
TTATACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGA
AAATAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTT
TTCAGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTG
GAGACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTC
GAACTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTT
CTATCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGT
CCTTTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAA
AGGCAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAAT
CCCAGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTT
TTCAGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTG
GCAAGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGG
ATCGCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCT
CCCGGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCC
ACCGCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTTCTCCAGAGAGCGGGCAT
CCAGAGAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGA
GGTCAGAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTAAATAGTCTGATAAACGTTCACACAGTCTAAAATTACC
CTTTATATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTTTTGGAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGT

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_2689nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAG
CTCGCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCT
TTATACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGA
AAATAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTT
TTCAGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTG
GAGACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTC
GAACTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTT
CTATCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGT
CCTTTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAA
AGGCAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAAT
CCCAGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTT
TTCAGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTG
GCAAGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGG
ATCGCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCT
CCCGGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCC
ACCGCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTC
GGTAGCTGCAACCAGGAGTGAGCCCTTCTCTGTGTTCCCAGGGTCTGCTGAGGGCCGTGTCTGGTGGGGATGGGGCTGGGCTCACCCTCA
GGAGTAGGGCTGGGGAGTCGTGAACGGGACTCAGGTGTGGGAAGAGGCGAGAGGGCTGTGGAGGAGCTCGCACGGCGCCAGGTGATGGGC
TGCACAGGCACTGTCCCCTGCCTGCGTCCTGGGGCCTGTGCACTGTTGCGTCCATGCTCAGAGTGGCTGAGACTTGTGTCCTGACCAGGC
CCTGCTTACCTCTGTTTTGGTTTTTGTTTTTGATATTTTTTTTTCCATTGTGTTTTTACGTAGTGTCATGTTCTGTGCATATAGTGTTGT
ATTCTCCTTTGCACTGTTTATGTTACAGTGAAGGCTCTCCTTATTAAAAATCTTCGCAAAGGTCACTTTTTAATGGCTATCTAACACTCC
ATATGTGGTGGGCAAGTCTGGTTGGCCTCCGGGGGGTTTCCAGGTATAGGGGATGTAGGGCCTTGCCTGGCCTGGTCTGCGGGTCCATCG
TCAGTGCCTGAGCGGCCAGCAGAAGGGGGGCAGCAGCCTCCACTGAGCCTCTGGTTCCCATTTCCCAGGTTCTCCAGAGAGCGGGCATCC
AGAGAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGG
TCAGAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTAAATAGTCTGATAAACGTTCACACAGTCTAAAATTACCCT
TTATATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTTTTGGAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGTTG

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_2096nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAG
CTCGCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCT
TTATACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGA
AAATAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTT
TTCAGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTG
GAGACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTC
GAACTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTT
CTATCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGT
CCTTTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAA
AGGCAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAAT
CCCAGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTT
TTCAGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTG
GCAAGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGG
ATCGCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCT
CCCGGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCC
ACCGCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTC
GGTAGCTGCAACCAGGAGTTCTCCAGAGAGCGGGCATCCAGAGAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGG
AGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGTCAGAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTA
AATAGTCTGATAAACGTTCACACAGTCTAAAATTACCCTTTATATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTT
TTGGAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGTTGCTCCTGTGTTCCCGGGTCATGTTGAGTAGGAATAAATAAATCTGATGCTGC

>In-frame_ATP9B_ENST00000426216_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_1762nt
AAAGGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCT
ACTACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCAC
TAATGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGG
AGTGGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAG
CTCGCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCT
TTATACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGA
AAATAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTT
TTCAGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTG
GAGACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTC
GAACTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTT
CTATCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGT
CCTTTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAA
AGGCAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAAT
CCCAGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTT
TTCAGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTG
GCAAGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGG
ATCGCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCT
CCCGGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCC
ACCGCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTC

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000293872_chr16_258187_-_2058nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTC
GCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTA
TACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAA
TAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTC
AGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAG
ACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAA
CTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTA
TCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCT
TTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGG
CAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCC
AGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTC
AGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCA
AGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATC
GCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCC
GGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACC
GCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTTCTCCAGAGAGCGGGCATCCA
GAGAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGT
CAGAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTAAATAGTCTGATAAACGTTCACACAGTCTAAAATTACCCTT
TATATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTTTTGGAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGTTGC

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000337351_chr16_258187_-_2686nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTC
GCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTA
TACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAA
TAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTC
AGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAG
ACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAA
CTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTA
TCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCT
TTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGG
CAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCC
AGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTC
AGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCA
AGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATC
GCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCC
GGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACC
GCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTCGGT
AGCTGCAACCAGGAGTGAGCCCTTCTCTGTGTTCCCAGGGTCTGCTGAGGGCCGTGTCTGGTGGGGATGGGGCTGGGCTCACCCTCAGGA
GTAGGGCTGGGGAGTCGTGAACGGGACTCAGGTGTGGGAAGAGGCGAGAGGGCTGTGGAGGAGCTCGCACGGCGCCAGGTGATGGGCTGC
ACAGGCACTGTCCCCTGCCTGCGTCCTGGGGCCTGTGCACTGTTGCGTCCATGCTCAGAGTGGCTGAGACTTGTGTCCTGACCAGGCCCT
GCTTACCTCTGTTTTGGTTTTTGTTTTTGATATTTTTTTTTCCATTGTGTTTTTACGTAGTGTCATGTTCTGTGCATATAGTGTTGTATT
CTCCTTTGCACTGTTTATGTTACAGTGAAGGCTCTCCTTATTAAAAATCTTCGCAAAGGTCACTTTTTAATGGCTATCTAACACTCCATA
TGTGGTGGGCAAGTCTGGTTGGCCTCCGGGGGGTTTCCAGGTATAGGGGATGTAGGGCCTTGCCTGGCCTGGTCTGCGGGTCCATCGTCA
GTGCCTGAGCGGCCAGCAGAAGGGGGGCAGCAGCCTCCACTGAGCCTCTGGTTCCCATTTCCCAGGTTCTCCAGAGAGCGGGCATCCAGA
GAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGGCTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGTCA
GAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTAAATAGTCTGATAAACGTTCACACAGTCTAAAATTACCCTTTA
TATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTTTTGGAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGTTGCTC

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397783_chr16_258187_-_2093nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTC
GCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTA
TACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAA
TAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTC
AGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAG
ACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAA
CTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTA
TCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCT
TTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGG
CAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCC
AGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTC
AGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCA
AGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATC
GCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCC
GGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACC
GCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTCGGT
AGCTGCAACCAGGAGTTCTCCAGAGAGCGGGCATCCAGAGAGGAGTCCTGGGAGAGCGGGCGGAGCGAGCGAGGGCCCCCGGACTGGAGG
CTTGAGAGCTCCAACGGGAAGATGGCTTCACGGAGGTCAGAAGAGAAGGAGGCCGGCGAGATCTGAACCCGTCTCCCGGGTGCTGTAAAT
AGTCTGATAAACGTTCACACAGTCTAAAATTACCCTTTATATTTGCTGAATACAACTCATCTTTTGTAGTTTAAAATTTCTATTGTTTTG
GAGCTAGCTGTGAGTTTCTAGAAGTGTACAGAGTTGCTCCTGTGTTCCCGGGTCATGTTGAGTAGGAATAAATAAATCTGATGCTGCCTC

>In-frame_ATP9B_ENST00000307671_chr18_76953263_+_LUC7L_ENST00000397780_chr16_258187_-_1759nt
GGGGCGGTCGGAACATGGCGGACCAGATCCCGCTTTACCCGGTGCGTAGCGCAGCGGCGGCCGCAGCCAACCGCAAACGCGCGGCCTACT
ACAGCGCCGCGGGGCCCAGGCCGGGAGCCGACCGGCACAGCAGGTACCAGCTGGAGGATGAGTCTGCGCATTTGGATGAAATGCCACTAA
TGATGTCTGAAGAAGGCTTTGAGAATGAGGAAAGTGATTACCACACCTTACCACGAGCCAGGATAATGCAAAGGAAAAGAGGACTGGAGT
GGTTTGTCTGTGATGGCTGGAAGTTCCTCTGTACCAGTTGCTGTGGTTGGCTGATAAATATTTGTCGAAGAAAGAAAGAGCTGAAAGCTC
GCACAGTATGGCTTGGATGTCCTGAAAAGTGTGAAGAAAAACATCCCAGGAATTCTATAAAAAATCAAAAATACAATGTGTTTACCTTTA
TACCTGGGGTTTTGTATGAACAATTCAAGTTTTTCTTGAATCTCTATTTTCTAGTAATATCCTGCTCACAGTTTGTACCAGCATTGAAAA
TAGGCTATCTCTACACCTACTGGGCTCCTCTGGGATTTGTCTTGGCTGTTACTATGACACGGGAAGCAATTGATGAATTTCGGCGTTTTC
AGCGTGACAAGGAAGTGAATTCACAACTATATAGCAAGCTTACAGTAAGAGGTAAAGTGCAAGTTAAGAGTTCAGACATACAAGTTGGAG
ACCTCATCATAGTGGAAAAGAATCAAAGAATTCCATCGGACATGGTGTTTCTTAGGACTTCAGAAAAAGCAGGTTCGTGTTTTATTCGAA
CTGATCAACTAGATGGTGAAACTGACTGGAAGCTGAAGGTGGCAGTGAGCTGCACGCAACAGCTGCCGGCTCTGGGGGACCTTTTTTCTA
TCAGTGCTTATGTTTATGCTCAGAAACCACAAATGGACATTCACAGTTTCGAAGGCACATTTACCAGGGCAATGGATCACTTGGAGTCCT
TTATTGCTGAATGTGATCGGAGAACTGAGCTCGCCAAGAAGCGGCTGGCAGAAACACAGGAGGAAATCAGTGCGGAAGTTTCTGCAAAGG
CAGAAAAAGTACATGAGTTAAATGAAGAAATAGGAAAACTCCTTGCTAAAGCCGAACAGCTAGGGGCTGAAGGTAATGTGGATGAATCCC
AGAAGATTCTTATGGAAGTGGAAAAAGTTCGTGCGAAGAAAAAAGAAGCTGAGGAAGAATACAGAAATTCCATGCCTGCATCCAGTTTTC
AGCAGCAAAAGCTGCGTGTCTGCGAGGTCTGTTCAGCCTACCTTGGTCTCCATGACAATGACCGTCGCCTGGCAGACCACTTCGGTGGCA
AGTTACACTTGGGGTTCATTCAGATCCGAGAGAAGCTTGATCAGTTGAGGAAAACTGTCGCTGAAAAGCAGGAGAAGAGAAATCAGGATC
GCTTGAGGAGGAGAGAGGAGAGGGAACGGGAGGAGCGTCTGAGCAGGAGGTCGGGATCAAGAACCAGAGATCGCAGGAGGTCACGCTCCC
GGGATCGGCGTCGGAGGCGGTCAAGATCTACCTCCCGAGAGCGACGGAAATTGTCCCGGTCCCGGTCCCGAGATAGACATCGGCGCCACC
GCAGCCGTTCCCGGAGCCACAGCCGGGGACATCGTCGGGCTTCCCGGGACCGAAGTGCGAAATACAAGTAACTACTCTGACTCCTTCGGT


Top

FusionGenePPI for ATP9B_LUC7L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP9BLUC7LRNPS1, NFKBIL1, FAM173A, USP50, TADA2A, CALM1, JMJD6, TCERG1, GADD45G, BARD1, CHERP, CTNNBL1, LUC7L, FBXO25, PRDX1, SRPK2, SRPK1, CLK2, SRPK3, PRMT5, CCDC8, SUZ12, EAF1, TRA2A, ZRANB2, LUC7L2, RBM27, RBM26, ZFP91, MRPL46, EIF2B1, ZC3H18, NKAP, BCLAF1, THRAP3, RECQL4, PRPF4B, C1QBP, SRRM2, FXR1, PTCD3, ZNF638, RBM23, GPATCH8, MRPS27, U2AF2, NRD1, UBE2O, LSM14B, SRRM1, CMAS, PPIG, PNN, VANGL1, ZCCHC8, LBR, DDX50, MRPS5, RBBP6, CSNK2A2, RBM25, MRPS9, SRRT, LARP1, CLK3, PRPF40A, CSNK2A1, PSME3, LUC7L3, TNPO3, RNMTL1, RBM7, SRSF11, MRPS22, MEPCE, CASC3, ACIN1, SCAF4, PHF10, RNASEH1, NKTR, CLASRP, SETD2, FTL, PRPF38B, MRS2, CPSF7, KBTBD6, VANGL2, MKRN1, YY1AP1, CHCHD2P9, SRSF10, SRSF8, PRRC2A, IBA57, HNRNPR, SF3B3, SNRNP70, SNRPD1, SNRPD2, SNRPD3, SYNCRIP, NTRK1, XPO1, NLRP3, SNW1, CDC5L, NANOG, RC3H1, CHCHD10, MRPL52, SRSF1, NCBP1, MRPL35, ZC3H14, INO80B, DLST, PDHA1, FOXA1, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP9B_LUC7L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP9B_LUC7L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP9BC0236736Cocaine-Related Disorders1CTD_human