FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 349

FusionGeneSummary for ACAP2_IQCG

check button Fusion gene summary
Fusion gene informationFusion gene name: ACAP2_IQCG
Fusion gene ID: 349
HgeneTgene
Gene symbol

ACAP2

IQCG

Gene ID

23527

84223

Gene nameArfGAP with coiled-coil, ankyrin repeat and PH domains 2IQ motif containing G
SynonymsCENTB2|CNT-B2CFAP122|DRC9
Cytomap

3q29

3q29

Type of geneprotein-codingprotein-coding
Descriptionarf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2Arf GAP with coiled coil, ANK repeat and PH domains 2centaurin-beta-2dynein regulatory complex protein 9IQ domain-containing protein Gdynein regulatory complex subunit 9
Modification date2018052320180519
UniProtAcc

Q15057

Q9H095

Ensembl transtripts involved in fusion geneENST00000326793, ENST00000472860, 
ENST00000265239, ENST00000455191, 
ENST00000453254, ENST00000480302, 
Fusion gene scores* DoF score9 X 7 X 10=6308 X 8 X 3=192
# samples 139
** MAII scorelog2(13/630*10)=-2.27684020535882
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/192*10)=-1.09310940439148
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ACAP2 [Title/Abstract] AND IQCG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CV-5970-01AACAP2chr3

195163524

-IQCGchr3

197640913

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000326793ENST00000265239ACAP2chr3

195163524

-IQCGchr3

197640913

-
In-frameENST00000326793ENST00000455191ACAP2chr3

195163524

-IQCGchr3

197640913

-
Frame-shitENST00000326793ENST00000453254ACAP2chr3

195163524

-IQCGchr3

197640913

-
5CDS-intronENST00000326793ENST00000480302ACAP2chr3

195163524

-IQCGchr3

197640913

-
intron-3CDSENST00000472860ENST00000265239ACAP2chr3

195163524

-IQCGchr3

197640913

-
intron-3CDSENST00000472860ENST00000455191ACAP2chr3

195163524

-IQCGchr3

197640913

-
intron-3CDSENST00000472860ENST00000453254ACAP2chr3

195163524

-IQCGchr3

197640913

-
intron-intronENST00000472860ENST00000480302ACAP2chr3

195163524

-IQCGchr3

197640913

-

Top

FusionProtFeatures for ACAP2_IQCG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACAP2

Q15057

IQCG

Q9H095

GTPase-activating protein (GAP) for ADP ribosylationfactor 6 (ARF6). {ECO:0000269|PubMed:11062263}. Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility whichmaintains the alignment and integrity of the distal axoneme andregulates microtubule sliding in motile axonemes. Binds calmodulinwhen cellular Ca(2+) levels are low and thereby contributes to theregulation of calcium and calmodulin-dependent protein kinase IV(CAMK4) activity; contributes to the regulation of CAMK4 signalingcascades. Required for normal axoneme assembly in sperm flagella,normal sperm tail formation and for male fertility.{ECO:0000250|UniProtKB:A3KQH2, ECO:0000250|UniProtKB:A8HQ54,ECO:0000250|UniProtKB:Q80W32}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneIQCGchr3:195163524chr3:197640913ENST00000265239-612393_422242444DomainIQ
TgeneIQCGchr3:195163524chr3:197640913ENST00000455191-511393_422242444DomainIQ

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-1231_22617779DomainNote=BAR
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123266_36117779DomainPH
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123399_52017779DomainArf-GAP
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123640_66917779RepeatNote=ANK 1
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123673_70217779RepeatNote=ANK 2
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123706_73517779RepeatNote=ANK 3
HgeneACAP2chr3:195163524chr3:197640913ENST00000326793-123414_43717779Zinc fingerC4-type


Top

FusionGeneSequence for ACAP2_IQCG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000265239_chr3_197640913_-_219aa
MKMTVDFEECLKDSPRFRVRMSILLTSRTNCKR_RQNPTWRIAT_KPIPSCRLPRPRKSVTEQRNSWWKRLRNSG_KPKKRPGLIQRLKC
SLERSSRNLRRGWSSGWRNTIRTQK_NRMN_MLSKPQRPVT_HTFKTWQR__ESMNRSSLKIV_KRRGARRR_NRISWN_RAL_SSRPGG

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000455191_chr3_197640913_-_219aa
MKMTVDFEECLKDSPRFRVRMSILLTSRTNCKR_RQNPTWRIAT_KPIPSCRLPRPRKSVTEQRNSWWKRLRNSG_KPKKRPGLIQRLKC
SLERSSRNLRRGWSSGWRNTIRTQK_NRMN_MLSKPQRPVT_HTFKTWQR__ESMNRSSLKIV_KRRGARRR_NRISWN_RAL_SSRPGG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000265239_chr3_197640913_-_659nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGAGTCAGAATGAGTATATTGCTAACCTCAAGGACCAAC
TGCAAGAGATGAAGGCAAAATCCAACTTGGAGAATCGCTACATGAAAACCAATACCGAGCTGCAGATTGCCCAGACCCAGAAAAAGTGTA
ACAGAACAGAGGAACTCTTGGTGGAAGAGATTGAGAAACTCAGGATGAAAACCGAAGAAGAGGCCCGGACTCATACAGAGATTGAAATGT
TCCTTAGAAAGGAGCAGCAGAAACTTGAGGAGAGGCTGGAGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAAC
TAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTG
AAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAAACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGC
GAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGATGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGGCA

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000455191_chr3_197640913_-_659nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGAGTCAGAATGAGTATATTGCTAACCTCAAGGACCAAC
TGCAAGAGATGAAGGCAAAATCCAACTTGGAGAATCGCTACATGAAAACCAATACCGAGCTGCAGATTGCCCAGACCCAGAAAAAGTGTA
ACAGAACAGAGGAACTCTTGGTGGAAGAGATTGAGAAACTCAGGATGAAAACCGAAGAAGAGGCCCGGACTCATACAGAGATTGAAATGT
TCCTTAGAAAGGAGCAGCAGAAACTTGAGGAGAGGCTGGAGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAAC
TAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTG
AAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAAACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGC
GAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGATGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000265239_chr3_197640913_-_1395nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGAGTCAGAATGAGTATATTGCTAACCTCAAGGACCAACTGCAAGAGATGAAGGCAAAATCCAACTTGGAGAATCGCT
ACATGAAAACCAATACCGAGCTGCAGATTGCCCAGACCCAGAAAAAGTGTAACAGAACAGAGGAACTCTTGGTGGAAGAGATTGAGAAAC
TCAGGATGAAAACCGAAGAAGAGGCCCGGACTCATACAGAGATTGAAATGTTCCTTAGAAAGGAGCAGCAGAAACTTGAGGAGAGGCTGG
AGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCAC
ACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAA
AACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGA
TGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGGCAAGGATAAGAGGAGAGGCAAGAAGAAGTGACCAAGTTCTC
TTTTGTGTTTTCTGCTGGTATTCTGGAGGTGGGAAGGACTTGGAGAGAGTTAAGAAACACCTGGTACCTCAAAGATGACTCATCTACAGG
TTGTTTCCTATTGAGACTTTCCCAGGGAAGCCTGATTTCACTTTGCCTGTTAATTTCACTCTGCCTGTTAGGTGGGTTTTCAAACCCTGA
TTTAGGATTACACCATTGACTTAGGGCTTCCTCATACCTTGCTGGGAAGAAGTTTCTAGTAGTCCTGTGAAGATTCATTCTTCTTGCTCT
TTCTCAGCAGAACAAAGGAGTTCACTGGCTTAGCTACAGTGACGCATTGAAACTTGAGTAATTCCTGTAATGTCAGATTTTGATTTTACC
CAATTTGTCTGTAGTGAAAAAACTCTTATGAGCAAAAGTATTCAGTAGGAATTACAATATGATGTTATTAGCTGTCCAGCATAATATATA

>In-frame_ACAP2_ENST00000326793_chr3_195163524_-_IQCG_ENST00000455191_chr3_197640913_-_1393nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGAGTCAGAATGAGTATATTGCTAACCTCAAGGACCAACTGCAAGAGATGAAGGCAAAATCCAACTTGGAGAATCGCT
ACATGAAAACCAATACCGAGCTGCAGATTGCCCAGACCCAGAAAAAGTGTAACAGAACAGAGGAACTCTTGGTGGAAGAGATTGAGAAAC
TCAGGATGAAAACCGAAGAAGAGGCCCGGACTCATACAGAGATTGAAATGTTCCTTAGAAAGGAGCAGCAGAAACTTGAGGAGAGGCTGG
AGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCAC
ACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAA
AACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGA
TGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGGCAAGGATAAGAGGAGAGGCAAGAAGAAGTGACCAAGTTCTC
TTTTGTGTTTTCTGCTGGTATTCTGGAGGTGGGAAGGACTTGGAGAGAGTTAAGAAACACCTGGTACCTCAAAGATGACTCATCTACAGG
TTGTTTCCTATTGAGACTTTCCCAGGGAAGCCTGATTTCACTTTGCCTGTTAATTTCACTCTGCCTGTTAGGTGGGTTTTCAAACCCTGA
TTTAGGATTACACCATTGACTTAGGGCTTCCTCATACCTTGCTGGGAAGAAGTTTCTAGTAGTCCTGTGAAGATTCATTCTTCTTGCTCT
TTCTCAGCAGAACAAAGGAGTTCACTGGCTTAGCTACAGTGACGCATTGAAACTTGAGTAATTCCTGTAATGTCAGATTTTGATTTTACC
CAATTTGTCTGTAGTGAAAAAACTCTTATGAGCAAAAGTATTCAGTAGGAATTACAATATGATGTTATTAGCTGTCCAGCATAATATATA


Top

FusionGenePPI for ACAP2_IQCG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACAP2SMURF1, HSPB1, RAB11FIP3, MED4, PDK3, SOAT1, NDUFS1, NDUFA9, PIGS, MBOAT7, EHBP1, GDI1, GPAA1, CYLDIQCGBAG6, GSK3B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACAP2_IQCG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ACAP2_IQCG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource