FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34849

FusionGeneSummary for SMARCE1_RARA

check button Fusion gene summary
Fusion gene informationFusion gene name: SMARCE1_RARA
Fusion gene ID: 34849
HgeneTgene
Gene symbol

SMARCE1

RARA

Gene ID

6605

5914

Gene nameSWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1retinoic acid receptor alpha
SynonymsBAF57|CSS5NR1B1|RAR
Cytomap

17q21.2

17q21.2

Type of geneprotein-codingprotein-coding
DescriptionSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1BRG1-associated factor 57SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1chromatin remodeling complex BRG1-associated factor 57retinoic acid receptor alphaRAR-alphanuclear receptor subfamily 1 group B member 1nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long formretinoic acid nuclear receptor alpha variant 1retinoic acid nuclear receptor alpha variant 2
Modification date2018052220180523
UniProtAcc

Q969G3

P10276

Ensembl transtripts involved in fusion geneENST00000348513, ENST00000544009, 
ENST00000431889, ENST00000580419, 
ENST00000377808, ENST00000400122, 
ENST00000578044, ENST00000474246, 
ENST00000254066, ENST00000394089, 
ENST00000425707, ENST00000394086, 
ENST00000394081, ENST00000420042, 
Fusion gene scores* DoF score2 X 2 X 2=818 X 16 X 10=2880
# samples 242
** MAII scorelog2(2/8*10)=1.32192809488736log2(42/2880*10)=-2.77760757866355
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SMARCE1 [Title/Abstract] AND RARA [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSMARCE1

GO:0006337

nucleosome disassembly

8895581

HgeneSMARCE1

GO:0006338

chromatin remodeling

11726552

HgeneSMARCE1

GO:0045892

negative regulation of transcription, DNA-templated

12192000

TgeneRARA

GO:0007165

signal transduction

2825025

TgeneRARA

GO:0030853

negative regulation of granulocyte differentiation

19917671

TgeneRARA

GO:0032689

negative regulation of interferon-gamma production

18416830

TgeneRARA

GO:0032720

negative regulation of tumor necrosis factor production

18416830

TgeneRARA

GO:0032736

positive regulation of interleukin-13 production

18416830

TgeneRARA

GO:0032753

positive regulation of interleukin-4 production

18416830

TgeneRARA

GO:0032754

positive regulation of interleukin-5 production

18416830

TgeneRARA

GO:0045630

positive regulation of T-helper 2 cell differentiation

18416830

TgeneRARA

GO:0045892

negative regulation of transcription, DNA-templated

20080953

TgeneRARA

GO:0045893

positive regulation of transcription, DNA-templated

18845237|19850744|20080953

TgeneRARA

GO:0045944

positive regulation of transcription by RNA polymerase II

19850744

TgeneRARA

GO:0071300

cellular response to retinoic acid

19917671

TgeneRARA

GO:0071391

cellular response to estrogen stimulus

20080953


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVREADTCGA-AH-6643-01ASMARCE1chr17

38792183

-RARAchr17

38511515

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000348513ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000348513ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000348513ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000348513ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000348513ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000348513ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000544009ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000544009ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000544009ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000544009ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000544009ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000544009ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000431889ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000431889ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000431889ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000431889ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000431889ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000431889ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000580419ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000580419ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000580419ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000580419ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000580419ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000580419ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000377808ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000377808ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000377808ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000377808ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000377808ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000377808ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000400122ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000400122ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000400122ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000400122ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
In-frameENST00000400122ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000400122ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000578044ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000578044ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000578044ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000578044ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
Frame-shitENST00000578044ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
5CDS-3UTRENST00000578044ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3CDSENST00000474246ENST00000254066SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3CDSENST00000474246ENST00000394089SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3CDSENST00000474246ENST00000425707SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3CDSENST00000474246ENST00000394086SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3CDSENST00000474246ENST00000394081SMARCE1chr17

38792183

-RARAchr17

38511515

+
intron-3UTRENST00000474246ENST00000420042SMARCE1chr17

38792183

-RARAchr17

38511515

+

Top

FusionProtFeatures for SMARCE1_RARA


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SMARCE1

Q969G3

RARA

P10276

Involved in transcriptional activation and repression ofselect genes by chromatin remodeling (alteration of DNA-nucleosometopology). Component of SWI/SNF chromatin remodeling complexesthat carry out key enzymatic activities, changing chromatinstructure by altering DNA-histone contacts within a nucleosome inan ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and theneuron-specific chromatin remodeling complex (nBAF complex).During neural development a switch from a stem/progenitor to apostmitotic chromatin remodeling mechanism occurs as neurons exitthe cell cycle and become committed to their adult state. Thetransition from proliferating neural stem/progenitor cells topostmitotic neurons requires a switch in subunit composition ofthe npBAF and nBAF complexes. As neural progenitors exit mitosisand differentiate into neurons, npBAF complexes which containACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologousalternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunitsin neuron-specific complexes (nBAF). The npBAF complex isessential for the self-renewal/proliferative capacity of themultipotent neural stem cells. The nBAF complex along with CRESTplays a role regulating the activity of genes essential fordendrite growth (By similarity). Required for the coactivation ofestrogen responsive promoters by SWI/SNF complexes and theSRC/p160 family of histone acetyltransferases (HATs). Alsospecifically interacts with the CoREST corepressor resulting inrepression of neuronal specific gene promoters in non-neuronalcells. {ECO:0000250|UniProtKB:O54941, ECO:0000303|PubMed:12672490,ECO:0000303|PubMed:22952240, ECO:0000303|PubMed:26601204}. Receptor for retinoic acid. Retinoic acid receptors bindas heterodimers to their target response elements in response totheir ligands, all-trans or 9-cis retinoic acid, and regulate geneexpression in various biological processes. The RXR/RARheterodimers bind to the retinoic acid response elements (RARE)composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In theabsence of ligand, the RXR-RAR heterodimers associate with amultiprotein complex containing transcription corepressors thatinduce histone acetylation, chromatin condensation andtranscriptional suppression. On ligand binding, the corepressorsdissociate from the receptors and associate with the coactivatorsleading to transcriptional activation. RARA plays an essentialrole in the regulation of retinoic acid-induced germ celldevelopment during spermatogenesis. Has a role in the survival ofearly spermatocytes at the beginning prophase of meiosis. InSertoli cells, may promote the survival and development of earlymeiotic prophase spermatocytes. In concert with RARG, required forskeletal growth, matrix homeostasis and growth plate function (Bysimilarity). {ECO:0000250|UniProtKB:P11416,ECO:0000269|PubMed:16417524, ECO:0000269|PubMed:19850744,ECO:0000269|PubMed:20215566}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SMARCE1_RARA


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_271aa
MSKRPSTAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIE
YNESMKATHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPH
MFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_271aa
MSKRPSTAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIE
YNESMKATHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPH
MFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_271aa
MSKRPSTAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIE
YNESMKATHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPH
MFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_271aa
MSKRPSTAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIE
YNESMKATHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPH
MFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_271aa
MSKRPSTAPPPTPAPATASSGITIPKPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIE
YNESMKATHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPH
MFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSPSSNRSSPATHSP

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_236aa
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQETLNEYEAEKIEYNESMKATHNSPAYLAYINAKSRAEAALEEESRQR
QSRMEKGEPYMSIQPAEDPDDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_813nt
ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCA
CCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAG
ATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAG
TACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAA
GAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTG
GAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCAC
ATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATC
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGG
GACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCG

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_813nt
ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCA
CCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAG
ATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAG
TACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAA
GAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTG
GAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCAC
ATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATC
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGG
GACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCG

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_813nt
ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCA
CCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAG
ATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAG
TACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAA
GAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTG
GAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCAC
ATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATC
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGG
GACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCG

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_813nt
ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCA
CCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAG
ATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAG
TACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAA
GAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTG
GAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCAC
ATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATC
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGG
GACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCG

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_813nt
ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCA
CCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAG
ATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAG
TACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAA
GAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTG
GAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCAC
ATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATC
CCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGG
GACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_708nt
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATT
GGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATG
AAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGA
CAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGG
GTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATG
CTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCG
CCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_1385nt
GTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAAAATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGC
CACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGG
AGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAG
AGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGG
AAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACC
TGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCC
ACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGA
TCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGC
GGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCC
CGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCC
CTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGG
GCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAG
GATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCC
CCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAG
GGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTT

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_920nt
GTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAAAATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGC
CACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGG
AGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAG
AGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGG
AAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACC
TGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCC
ACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGA
TCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGC
GGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCC
CGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCC

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_1431nt
GTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAAAATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGC
CACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGG
AGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAG
AGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGG
AAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACC
TGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCC
ACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGA
TCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGC
GGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCC
CGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCC
CTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGG
GCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAG
GATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCC
CCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAG
GGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTT

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_1384nt
GTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAAAATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGC
CACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGG
AGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAG
AGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGG
AAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACC
TGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCC
ACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGA
TCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGC
GGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCC
CGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCC
CTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGG
GCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAG
GATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCC
CCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAG
GGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTT

>In-frame_SMARCE1_ENST00000544009_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_1384nt
GTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAAAATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGC
CACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGG
AGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAG
AGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGG
AAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACC
TGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCC
ACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGA
TCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGC
GGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCC
CGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCC
CTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGG
GCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAG
GATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCC
CCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAG
GGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTT

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_1474nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCC
ACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGA
GATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGA
GTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGA
AGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCT
GGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCA
CATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
CCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCG
GGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCC
GTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCC
TGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGG
CCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGG
ATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCC
CCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGG
GGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTTT

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_1009nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCC
ACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGA
GATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGA
GTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGA
AGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCT
GGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCA
CATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
CCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCG
GGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCC
GTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCC

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_1520nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCC
ACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGA
GATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGA
GTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGA
AGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCT
GGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCA
CATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
CCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCG
GGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCC
GTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCC
TGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGG
CCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGG
ATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCC
CCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGG
GGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTTT

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_1473nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCC
ACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGA
GATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGA
GTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGA
AGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCT
GGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCA
CATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
CCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCG
GGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCC
GTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCC
TGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGG
CCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGG
ATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCC
CCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGG
GGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTTT

>In-frame_SMARCE1_ENST00000377808_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_1473nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCC
ACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGA
GATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGA
GTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGA
AGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCT
GGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGGAGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCA
CATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCATCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGAT
CCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACTCAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCG
GGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCAGCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCC
GTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCCGGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCC
TGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGGGGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGG
CCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGAGGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGG
ATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCCAGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCC
CCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACCTCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGG
GGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAGGTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTTT

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000254066_chr17_38511515_+_1430nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGG
TCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATG
AAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACC
TTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGT
ACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCA
TCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCA
GCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC
GGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCCTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGG
GGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGGCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGA
GGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGGATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCC
AGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCCCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACC
TCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGGGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394089_chr17_38511515_+_965nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGG
TCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATG
AAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACC
TTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGT
ACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCA
TCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCA
GCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000425707_chr17_38511515_+_1476nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGG
TCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATG
AAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACC
TTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGT
ACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCA
TCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCA
GCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC
GGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCCTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGG
GGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGGCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGA
GGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGGATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCC
AGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCCCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACC
TCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGGGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAG
GTATTAATTCTCGCTGGTTTTGTTTTTATTTTAATTTTTTTGTTTTGATTTTTTTAATAAGAATTTTCATTTTAAGCACATTTATACTGA

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394086_chr17_38511515_+_1429nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGG
TCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATG
AAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACC
TTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGT
ACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCA
TCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCA
GCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC
GGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCCTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGG
GGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGGCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGA
GGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGGATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCC
AGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCCCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACC
TCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGGGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAG

>In-frame_SMARCE1_ENST00000400122_chr17_38792183_-_RARA_ENST00000394081_chr17_38511515_+_1429nt
CAAAGGGAAGCGAAGCCGGAGCTGCGGGCGCTTTTTCTGCCCGCGGTGTCTCAGATTCATTCTTAAGGAACTGAGAACTTAATCTTCCAA
AATGTCAAGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTGATGCCCTACATGAGGTACAGCAGAAAGG
TCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATG
AAGAAAAACAAGAATATTTAAACGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACC
TTGCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCATGGAGAAAGGAGAACCGT
ACATGAGCATTCAGCCTGCTGAAGATCCAGATGACCGCCAGGACCTGGAGCAGCCGGACCGGGTGGACATGCTGCAGGAGCCGCTGCTGG
AGGCGCTAAAGGTCTACGTGCGGAAGCGGAGGCCCAGCCGCCCCCACATGTTCCCCAAGATGCTAATGAAGATTACTGACCTGCGAAGCA
TCAGCGCCAAGGGGGCTGAGCGGGTGATCACGCTGAAGATGGAGATCCCGGGCTCCATGCCGCCTCTCATCCAGGAAATGTTGGAGAACT
CAGAGGGCCTGGACACTCTGAGCGGACAGCCGGGGGGTGGGGGGCGGGACGGGGGTGGCCTGGCCCCCCCGCCAGGCAGCTGTAGCCCCA
GCCTCAGCCCCAGCTCCAACAGAAGCAGCCCGGCCACCCACTCCCCGTGACCGCCCACGCCACATGGACACAGCCCTCGCCCTCCGCCCC
GGCTTTTCTCTGCCTTTCTACCGACCATGTGACCCCGCACCAGCCCTGCCCCCACCTGCCCTCCCGGGCAGTACTGGGGACCTTCCCTGG
GGGACGGGGAGGGAGGAGGCAGCGACTCCTTGGACAGAGGCCTGGGCCCTCAGTGGACTGCCTGCTCCCACAGCCTGGGCTGACGTCAGA
GGCCGAGGCCAGGAACTGAGTGAGGCCCCTGGTCCTGGGTCTCAGGATGGGTCCTGGGGGCCTCGTGTTCATCAAGACACCCCTCTGCCC
AGCTCACCACATCTTCATCACCAGCAAACGCCAGGACTTGGCTCCCCCATCCTCAGAACTCACAAGCCATTGCTCCCCAGCTGGGGAACC
TCAACCTCCCCCCTGCCTCGGTTGGTGACAGAGGGGGTGGGACAGGGGCGGGGGGTTCCCCCTGTACATACCCTGCCATACCAACCCCAG


Top

FusionGenePPI for SMARCE1_RARA


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SMARCE1RELB, NR3C1, KLF1, GATA1, TFE3, NCOA1, ESR2, ESR1, STAT2, SMARCA4, SMARCB1, SMARCA2, SMARCC2, SMARCC1, ACTB, ACTL6A, MECP2, ARID1A, NR4A1, BANF1, PBRM1, PGR, ARID2, BRD7, SMARCD1, DPF2, BCL7C, AR, PRMT5, SIN3A, SIN3B, RCOR1, REST, HDAC1, HDAC2, ZMIZ2, NR0B2, IKZF1, CHD4, CARM1, TRIP12, CHD7, DISC1, TNIK, SMARCAD1, ARID1B, PHF10, SMARCD2, SMARCD3, TFAP4, CUL3, CAND1, BRMS1, TOP2B, RBBP5, HMGB1, NCOR1, HMGXB4, DPF1, SMAD1, ITCH, WWOX, HAUS2, CEP76, CDR2, EPS8, GOLGA2, KIFC3, KRT15, KRT31, MEOX2, STX11, TRIP10, JAKMIP2, SPAG5, RALBP1, EXOC7, MTUS2, NUP62, TFIP11, MED4, AMOTL2, TRIM54, RINT1, CCDC136, CEP63, CEP70, USHBP1, ING5, SYCE1, MRFAP1L1, KRT40, MIPOL1, TXLNA, NBPF22P, CCDC172, KRTAP10-9, NOTCH2NL, CEP170P1, ENO1, MOV10, NXF1, RNF2, DPF3, BCL7B, SS18, SS18L1, RARB, EWSR1, MDM2, XPO1, HIST1H3E, NUP153, BRAP, FOS, JUN, TCF4, FOXN1, NFATC1, NFATC2, BCL7A, DLDRARANRBF2, ZBTB16, MECR, RXRG, RXRB, NCOA6, GADD45G, GADD45A, NRIP1, KAT2B, HDAC3, HDAC4, TDG, PML, TRIP4, KDM5A, RXRA, POU2F1, NCOR2, NR0B2, BAG1, TADA3, NCOR1, NKX2-1, TRIM24, IRX4, SP1, NPAS2, CLOCK, ARNTL, NR2E3, CCND3, NCOA2, SRC, AJUBA, LIMD1, WTIP, SKI, HR, PIN1, SUV39H1, PSMC5, EP300, PARP1, MED6, TOP2B, SAP130, HNRNPU, RFC4, NPM1, MRTO4, SNRNP40, MED1, NCOA1, HMGA1, RUVBL1, RUNX1, SIAH1, RARA, HDAC2, NCOA3, CREBBP, LRIF1, KLF5, SMARCD3, ARID1A, SPI1, PRDX6, NR1H2, ITGB1BP2, MED25, MAPK6, FOXO1, MAPK1, TRIM32, PHF8, TNIP1, HACE1, SQSTM1, UBQLN1, ARID5A, UBE3A, PRAM1, FAS, PRAME, TBL1XR1, SUZ12, EZH2, USP7, TMEM54, MMS19, AKT1, FN1, WWOX, E2F1, MBD3, MTA2, CBX5, CEBPA, HDAC1, NSD1, TEKT4, SNW1, SIRT1, ACTN4, SRF, MDM2, ZNF131, RARG, RARB, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SMARCE1_RARA


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneRARAP10276DB00210AdapaleneRetinoic acid receptor alphasmall moleculeapproved
TgeneRARAP10276DB00459AcitretinRetinoic acid receptor alphasmall moleculeapproved
TgeneRARAP10276DB00982IsotretinoinRetinoic acid receptor alphasmall moleculeapproved
TgeneRARAP10276DB00523AlitretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational
TgeneRARAP10276DB00799TazaroteneRetinoic acid receptor alphasmall moleculeapproved|investigational
TgeneRARAP10276DB00755TretinoinRetinoic acid receptor alphasmall moleculeapproved|investigational|nutraceutical

Top

RelatedDiseases for SMARCE1_RARA


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSMARCE1C0010606Adenoid Cystic Carcinoma1CTD_human
HgeneSMARCE1C0265338Coffin-Siris syndrome1CTD_human;ORPHANET
HgeneSMARCE1C1333989Familial meningioma1CTD_human
TgeneRARAC0023487Acute Promyelocytic Leukemia22CTD_human;HPO;ORPHANET
TgeneRARAC0036341Schizophrenia3PSYGENET
TgeneRARAC0005586Bipolar Disorder1PSYGENET
TgeneRARAC0010701Phyllodes Tumor1CTD_human
TgeneRARAC0085183Neoplasms, Second Primary1CTD_human
TgeneRARAC0149940Sciatic Neuropathy1CTD_human
TgeneRARAC0206650Fibroadenoma1CTD_human
TgeneRARAC0525045Mood Disorders1PSYGENET
TgeneRARAC1458155Mammary Neoplasms1CTD_human
TgeneRARAC2239176Liver carcinoma1CTD_human