FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3479

FusionGeneSummary for ATP6V1F_CPED1

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP6V1F_CPED1
Fusion gene ID: 3479
HgeneTgene
Gene symbol

ATP6V1F

CPED1

Gene ID

9296

79974

Gene nameATPase H+ transporting V1 subunit Fcadherin like and PC-esterase domain containing 1
SynonymsATP6S14|VATF|Vma7C7orf58
Cytomap

7q32.1

7q31.31

Type of geneprotein-codingprotein-coding
DescriptionV-type proton ATPase subunit FATPase, H+ transporting, lysosomal 14kDa, V1 subunit FATPase, vacuolar, 14 kDH(+)-transporting two-sector ATPase, 14kD subunitV-ATPase 14 kDa subunitV-ATPase F subunitV-ATPase subunit Fadenosinetriphosphatase 14k chaincadherin-like and PC-esterase domain-containing protein 1
Modification date2018052320180519
UniProtAcc

Q16864

A4D0V7

Ensembl transtripts involved in fusion geneENST00000249289, ENST00000492758, 
ENST00000310396, ENST00000450913, 
ENST00000423795, ENST00000495036, 
ENST00000340646, 
Fusion gene scores* DoF score1 X 1 X 1=14 X 3 X 4=48
# samples 14
** MAII scorelog2(1/1*10)=3.32192809488736log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ATP6V1F [Title/Abstract] AND CPED1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLUSCTCGA-39-5011-01AATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000249289ENST00000310396ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000249289ENST00000450913ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000249289ENST00000423795ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000249289ENST00000495036ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000249289ENST00000340646ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
In-frameENST00000492758ENST00000310396ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000492758ENST00000450913ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000492758ENST00000423795ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000492758ENST00000495036ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+
5CDS-intronENST00000492758ENST00000340646ATP6V1Fchr7

128503116

+CPED1chr7

120935494

+

Top

FusionProtFeatures for ATP6V1F_CPED1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP6V1F

Q16864

CPED1

A4D0V7

Subunit of the peripheral V1 complex of vacuolar ATPaseessential for assembly or catalytic function. V-ATPase isresponsible for acidifying a variety of intracellular compartmentsin eukaryotic cells.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ATP6V1F_CPED1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP6V1F_ENST00000249289_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_123aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRXXNQSYPKNITLLKXKDQEIISWEDISAIKANYNKAL

>In-frame_ATP6V1F_ENST00000492758_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_123aa
MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRXXNQSYPKNITLLKXKDQEIISWEDISAIKANYNKAL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP6V1F_ENST00000249289_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_371nt
ATGGCGGGGAGGGGTAAGCTCATCGCAGTGATCGGAGACGAGGACACGGTGACTGGTTTCCTGCTGGGCGGCATAGGGGAGCTTAACAAG
AACCGCCATCCCAATTTCCTGGTGGTGGAGAAGGATACAACCATCAATGAGATCGAAGACACTTTCCGGTAGTGAAATCAAAGTTATCCA
AAGAATATAACTTTATTAAAATGAAAAGATCAAGAAATCATATCATGGGAAGATATTTCAGCAATCAAAGCAAACTACAACAAGGCACTG
TAACAAATTTTCGATCGCCATATCATGTCAGAGGTCCAATAAATCAGGTTTGTTCTGAAATCCTTCTCAGCAGGATGTGTGCAAATAAAA

>In-frame_ATP6V1F_ENST00000492758_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_371nt
ATGGCGGGGAGGGGTAAGCTCATCGCAGTGATCGGAGACGAGGACACGGTGACTGGTTTCCTGCTGGGCGGCATAGGGGAGCTTAACAAG
AACCGCCATCCCAATTTCCTGGTGGTGGAGAAGGATACAACCATCAATGAGATCGAAGACACTTTCCGGTAGTGAAATCAAAGTTATCCA
AAGAATATAACTTTATTAAAATGAAAAGATCAAGAAATCATATCATGGGAAGATATTTCAGCAATCAAAGCAAACTACAACAAGGCACTG
TAACAAATTTTCGATCGCCATATCATGTCAGAGGTCCAATAAATCAGGTTTGTTCTGAAATCCTTCTCAGCAGGATGTGTGCAAATAAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP6V1F_ENST00000249289_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_2242nt
GCCGACGGGGCGCCGTACGGCGGAGGCGGGGTTTCAGTGGCTTCTGGTGCTCTAGGGTGAGCTCTGCCCGGCTGCAGGGATGGCGGGGAG
GGGTAAGCTCATCGCAGTGATCGGAGACGAGGACACGGTGACTGGTTTCCTGCTGGGCGGCATAGGGGAGCTTAACAAGAACCGCCATCC
CAATTTCCTGGTGGTGGAGAAGGATACAACCATCAATGAGATCGAAGACACTTTCCGGTAGTGAAATCAAAGTTATCCAAAGAATATAAC
TTTATTAAAATGAAAAGATCAAGAAATCATATCATGGGAAGATATTTCAGCAATCAAAGCAAACTACAACAAGGCACTGTAACAAATTTT
CGATCGCCATATCATGTCAGAGGTCCAATAAATCAGGTTTGTTCTGAAATCCTTCTCAGCAGGATGTGTGCAAATAAAAGGACTATGTAG
GCTCCCTGCAGGAGAGCTGAATCTGGAGCTGGAGACGAGCTAGTCACCCGGACAATGGTCTAGGAGCCAAGCGCTGCACATCGCACACAT
TTGGGATCGACCACACACACTTGTGCACACCAGCACATGCATGCACACCAGTACACACACAGTTAAATAATGATAACACTTCTTACAGCT
TTATGAATTCAAGATGTGACCTTGAACACCAGTCCATTTCACAGTGAAAGATATACCTAGAGAAACGTTACTTGAAGCATAATTATTAAC
CAGAACCACTGTGGGCCAGGTATGGCATTGTGATAATAAAGAGAAATATAGACACTTAAAATTATGTGAAAAAAAGGATAATGCTCTTTC
ATGTTGTCTTACCATATCTATAGGTACATCAATATTGAAAAGGAGAAAAACCAATGACATTCCACTGGCAAGTAGAAGTTGTCCTTTCAT
TCTTTACCAGGAGAAAATGTGATGTTTATGATGGCTTAGGCTTTGTGAATCTAATGCTTATGAAAAACATTTCTTCCTATACTTTTTAAA
TTTTATTACTGAAAGGAAAAGAACAGGAATGTTCCACAAGGGAATTTGAAGAGATTCTGTGAGAGAGATATGAAATATTTTATAGTTAAA
ACACCAATATATTCAACTTTACACTTCTTGTGTTTTTCATAAACATTCCCTCTTGTCTTATCTGTGTACTTCGATGGGTAACTGCAGTCT
GAATTAATGAAATATGTAATTTTAAAGTAAGTAACAAAATGTAGTTCCTCATGTATTACTGTACTATGTTTCATTGATGATATTACTTAA
ATCTTGTGTTTGCCATTACAGCCCTATGTAACTTAAAATTACAATTATATTTTATGTAAATATTTTGCAAAGGACTATGCATTCTGAAAT
GCATAGGTGCTTTTTCCCACCAAGCATTTGCATATGTCCACAAATAGTATTATGTTACTAGTATCTATATTTTGATTTTCCTGAGCAACT
GTATCAAATCCAAATTTAGATTAGACAAAAAATTATTATTTTAATTAAACTGTGGCATACATATAATACATACCTAATTATAGTAGTGAG
AACTATTTCTTTTATCTCTTTAGGTTCAAAATGGTGAATTTCTTTATTATATGAATGCTTTGTTGTGAGATAACATCACACTGTTACAAT
GGATTTTAGAGGTTTGTCTTTTTTGGGTGGGGTGGGAAGCTGAGAGGGTTAATTCAATACATGGCTGAAATTACCAAATGTATAAATACC
TCATTTTCACTACCATACAAGAAAAAAACACCTATTTTGATTGATCAGTTCTTTTGTATGAATATCCACCTCCTTTAAATACTCTATTTT
TATATATATTTTTATATGAAGATAAACATGAATTTATATTTAACTGTCTTAAATTATATTTACATAAATGCAAATATCACTTGATATAAA
CAATACAAATCTGCATCTTACAGATGATAATTTTTTTAGAAGAATGATACAGAATTAACTTTAAAAATAAAACTTTTCTAATATACACTT
AAATGCAAACATCATTTTTAAATTTTCAGTGATTTTTTTAATGACATAAAACGTTACCAATGTGTGCAGCCTCTCCATCATGTTTTAACA
TACTGTATACTCTATAGCAGTATTACAGTCAGTATTTCATATAATTTTCTTTAGACCTAACTGTTACCATCTGACTGAGGTTACTCTGGT

>In-frame_ATP6V1F_ENST00000492758_chr7_128503116_+_CPED1_ENST00000310396_chr7_120935494_+_2164nt
GATGGCGGGGAGGGGTAAGCTCATCGCAGTGATCGGAGACGAGGACACGGTGACTGGTTTCCTGCTGGGCGGCATAGGGGAGCTTAACAA
GAACCGCCATCCCAATTTCCTGGTGGTGGAGAAGGATACAACCATCAATGAGATCGAAGACACTTTCCGGTAGTGAAATCAAAGTTATCC
AAAGAATATAACTTTATTAAAATGAAAAGATCAAGAAATCATATCATGGGAAGATATTTCAGCAATCAAAGCAAACTACAACAAGGCACT
GTAACAAATTTTCGATCGCCATATCATGTCAGAGGTCCAATAAATCAGGTTTGTTCTGAAATCCTTCTCAGCAGGATGTGTGCAAATAAA
AGGACTATGTAGGCTCCCTGCAGGAGAGCTGAATCTGGAGCTGGAGACGAGCTAGTCACCCGGACAATGGTCTAGGAGCCAAGCGCTGCA
CATCGCACACATTTGGGATCGACCACACACACTTGTGCACACCAGCACATGCATGCACACCAGTACACACACAGTTAAATAATGATAACA
CTTCTTACAGCTTTATGAATTCAAGATGTGACCTTGAACACCAGTCCATTTCACAGTGAAAGATATACCTAGAGAAACGTTACTTGAAGC
ATAATTATTAACCAGAACCACTGTGGGCCAGGTATGGCATTGTGATAATAAAGAGAAATATAGACACTTAAAATTATGTGAAAAAAAGGA
TAATGCTCTTTCATGTTGTCTTACCATATCTATAGGTACATCAATATTGAAAAGGAGAAAAACCAATGACATTCCACTGGCAAGTAGAAG
TTGTCCTTTCATTCTTTACCAGGAGAAAATGTGATGTTTATGATGGCTTAGGCTTTGTGAATCTAATGCTTATGAAAAACATTTCTTCCT
ATACTTTTTAAATTTTATTACTGAAAGGAAAAGAACAGGAATGTTCCACAAGGGAATTTGAAGAGATTCTGTGAGAGAGATATGAAATAT
TTTATAGTTAAAACACCAATATATTCAACTTTACACTTCTTGTGTTTTTCATAAACATTCCCTCTTGTCTTATCTGTGTACTTCGATGGG
TAACTGCAGTCTGAATTAATGAAATATGTAATTTTAAAGTAAGTAACAAAATGTAGTTCCTCATGTATTACTGTACTATGTTTCATTGAT
GATATTACTTAAATCTTGTGTTTGCCATTACAGCCCTATGTAACTTAAAATTACAATTATATTTTATGTAAATATTTTGCAAAGGACTAT
GCATTCTGAAATGCATAGGTGCTTTTTCCCACCAAGCATTTGCATATGTCCACAAATAGTATTATGTTACTAGTATCTATATTTTGATTT
TCCTGAGCAACTGTATCAAATCCAAATTTAGATTAGACAAAAAATTATTATTTTAATTAAACTGTGGCATACATATAATACATACCTAAT
TATAGTAGTGAGAACTATTTCTTTTATCTCTTTAGGTTCAAAATGGTGAATTTCTTTATTATATGAATGCTTTGTTGTGAGATAACATCA
CACTGTTACAATGGATTTTAGAGGTTTGTCTTTTTTGGGTGGGGTGGGAAGCTGAGAGGGTTAATTCAATACATGGCTGAAATTACCAAA
TGTATAAATACCTCATTTTCACTACCATACAAGAAAAAAACACCTATTTTGATTGATCAGTTCTTTTGTATGAATATCCACCTCCTTTAA
ATACTCTATTTTTATATATATTTTTATATGAAGATAAACATGAATTTATATTTAACTGTCTTAAATTATATTTACATAAATGCAAATATC
ACTTGATATAAACAATACAAATCTGCATCTTACAGATGATAATTTTTTTAGAAGAATGATACAGAATTAACTTTAAAAATAAAACTTTTC
TAATATACACTTAAATGCAAACATCATTTTTAAATTTTCAGTGATTTTTTTAATGACATAAAACGTTACCAATGTGTGCAGCCTCTCCAT
CATGTTTTAACATACTGTATACTCTATAGCAGTATTACAGTCAGTATTTCATATAATTTTCTTTAGACCTAACTGTTACCATCTGACTGA
GGTTACTCTGGTATTTATCTCTTCGCTGCTGAAATAATAATGGATTTTAGAAACAATTGTAATAATATCATTAATAAATGTCTTACTAGT


Top

FusionGenePPI for ATP6V1F_CPED1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP6V1FKIAA1377, ATP6V1D, ATP6V1E1, ATP6V1H, ATP6V1B2, ATP6V1A, SSSCA1, ZRANB2, SRXN1, ZPR1, IGBP1, UBXN7, HNRNPL, UBE2C, TTLL12, UFC1, UBE2B, UBE2D1, UBE4B, EIF2AK2, USP9X, UNK, DDB1, UBE2V1, TXN, UCHL3, ABCC1, MPV17, VDAC2, VASP, NNT, VPS26A, PICALM, CORO1B, SRSF2, DDX3X, UBR5, HYOU1, MOV10, ATP6AP2, ATP6V1C2, ATP6V1B1, AIMP1, CORO1C, NEDD8, TCTN2, TCTN3, TMEM17, TMEM216, GOLT1B, KIAA2013, ATP6V0A2, TRIM11, PLXDC2, ATP6V0D1CPED1APP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP6V1F_CPED1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP6V1F_CPED1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCPED1C0022336Creutzfeldt-Jakob disease1CTD_human