FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34693

FusionGeneSummary for SLIT3_PPARGC1B

check button Fusion gene summary
Fusion gene informationFusion gene name: SLIT3_PPARGC1B
Fusion gene ID: 34693
HgeneTgene
Gene symbol

SLIT3

PPARGC1B

Gene ID

6586

133522

Gene nameslit guidance ligand 3PPARG coactivator 1 beta
SynonymsMEGF5|SLIL2|SLIT1|Slit-3|slit2ERRL1|PERC|PGC-1(beta)|PGC1B
Cytomap

5q34-q35.1

5q32

Type of geneprotein-codingprotein-coding
Descriptionslit homolog 3 proteinmultiple EGF-like domains protein 5multiple epidermal growth factor-like domains protein 5slit homolog 3peroxisome proliferator-activated receptor gamma coactivator 1-betaPGC-1-related estrogen receptor alpha coactivatorPPAR-gamma coactivator 1-betaPPARGC-1-betaPPARgamma coactivator 1 betaperoxisome proliferator-activated receptor gamma, coactivator 1
Modification date2018052220180523
UniProtAcc

O75094

Q86YN6

Ensembl transtripts involved in fusion geneENST00000519560, ENST00000332966, 
ENST00000404867, ENST00000521130, 
ENST00000360453, ENST00000394320, 
ENST00000461780, ENST00000309241, 
ENST00000403750, 
Fusion gene scores* DoF score7 X 5 X 4=1405 X 5 X 4=100
# samples 75
** MAII scorelog2(7/140*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SLIT3 [Title/Abstract] AND PPARGC1B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSLIT3

GO:0007411

axon guidance

11748139

HgeneSLIT3

GO:0021834

chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration

11748139

HgeneSLIT3

GO:0048846

axon extension involved in axon guidance

16840550

HgeneSLIT3

GO:0050919

negative chemotaxis

11748139

TgenePPARGC1B

GO:0006355

regulation of transcription, DNA-templated

23836911

TgenePPARGC1B

GO:0030520

intracellular estrogen receptor signaling pathway

11854298

TgenePPARGC1B

GO:0045944

positive regulation of transcription by RNA polymerase II

11854298


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-3B-A9HS-01ASLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000519560ENST00000360453SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
Frame-shitENST00000519560ENST00000394320SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000519560ENST00000461780SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000519560ENST00000309241SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000519560ENST00000403750SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
In-frameENST00000332966ENST00000360453SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
Frame-shitENST00000332966ENST00000394320SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000332966ENST00000461780SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000332966ENST00000309241SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000332966ENST00000403750SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
In-frameENST00000404867ENST00000360453SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
Frame-shitENST00000404867ENST00000394320SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000404867ENST00000461780SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000404867ENST00000309241SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5CDS-intronENST00000404867ENST00000403750SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5UTR-3CDSENST00000521130ENST00000360453SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5UTR-3CDSENST00000521130ENST00000394320SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5UTR-intronENST00000521130ENST00000461780SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5UTR-intronENST00000521130ENST00000309241SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+
5UTR-intronENST00000521130ENST00000403750SLIT3chr5

168671709

-PPARGC1Bchr5

149225323

+

Top

FusionProtFeatures for SLIT3_PPARGC1B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLIT3

O75094

PPARGC1B

Q86YN6

May act as molecular guidance cue in cellular migration,and function may be mediated by interaction with roundabouthomolog receptors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-33634_611131473DomainNote=LRRNT
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-33634_611131524DomainNote=LRRNT
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-33662_831131473RepeatNote=LRR 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-33686_1071131473RepeatNote=LRR 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-33662_831131524RepeatNote=LRR 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-33686_1071131524RepeatNote=LRR 2
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+811902_976899985DomainRRM
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+811902_976874960DomainRRM

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361034_10721131473DomainEGF-like 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361074_11101131473DomainEGF-like 5
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361119_11551131473DomainEGF-like 6
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361158_13321131473DomainLaminin G-like
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361340_13651131473DomainEGF-like 7
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361368_14031131473DomainEGF-like 8
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361408_14441131473DomainEGF-like 9
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-3361449_15231131473DomainCTCK
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336215_2651131473DomainNote=LRRCT 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336271_3071131473DomainNote=LRRNT 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336437_4871131473DomainNote=LRRCT 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336496_5321131473DomainNote=LRRNT 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336663_7131131473DomainNote=LRRCT 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336716_7521131473DomainNote=LRRNT 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336857_9071131473DomainNote=LRRCT 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336918_9531131473DomainEGF-like 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336955_9941131473DomainEGF-like 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336996_10321131473DomainEGF-like 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361034_10721131524DomainEGF-like 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361074_11101131524DomainEGF-like 5
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361119_11551131524DomainEGF-like 6
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361158_13321131524DomainLaminin G-like
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361340_13651131524DomainEGF-like 7
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361368_14031131524DomainEGF-like 8
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361408_14441131524DomainEGF-like 9
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-3361449_15231131524DomainCTCK
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336215_2651131524DomainNote=LRRCT 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336271_3071131524DomainNote=LRRNT 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336437_4871131524DomainNote=LRRCT 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336496_5321131524DomainNote=LRRNT 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336663_7131131524DomainNote=LRRCT 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336716_7521131524DomainNote=LRRNT 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336857_9071131524DomainNote=LRRCT 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336918_9531131524DomainEGF-like 1
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336955_9941131524DomainEGF-like 2
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336996_10321131524DomainEGF-like 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336110_1311131473RepeatNote=LRR 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336134_1551131473RepeatNote=LRR 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336158_1791131473RepeatNote=LRR 5
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336182_2031131473RepeatNote=LRR 6
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336308_3291131473RepeatNote=LRR 7
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336332_3531131473RepeatNote=LRR 8
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336356_3771131473RepeatNote=LRR 9
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336380_4011131473RepeatNote=LRR 10
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336404_4251131473RepeatNote=LRR 11
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336533_5541131473RepeatNote=LRR 12
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336558_5791131473RepeatNote=LRR 13
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336582_6031131473RepeatNote=LRR 14
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336606_6271131473RepeatNote=LRR 15
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336630_6511131473RepeatNote=LRR 16
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336753_7751131473RepeatNote=LRR 17
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336776_7971131473RepeatNote=LRR 18
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336800_8211131473RepeatNote=LRR 19
HgeneSLIT3chr5:168671709chr5:149225323ENST00000404867-336824_8451131473RepeatNote=LRR 20
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336110_1311131524RepeatNote=LRR 3
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336134_1551131524RepeatNote=LRR 4
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336158_1791131524RepeatNote=LRR 5
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336182_2031131524RepeatNote=LRR 6
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336308_3291131524RepeatNote=LRR 7
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336332_3531131524RepeatNote=LRR 8
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336356_3771131524RepeatNote=LRR 9
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336380_4011131524RepeatNote=LRR 10
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336404_4251131524RepeatNote=LRR 11
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336533_5541131524RepeatNote=LRR 12
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336558_5791131524RepeatNote=LRR 13
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336582_6031131524RepeatNote=LRR 14
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336606_6271131524RepeatNote=LRR 15
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336630_6511131524RepeatNote=LRR 16
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336753_7751131524RepeatNote=LRR 17
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336776_7971131524RepeatNote=LRR 18
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336800_8211131524RepeatNote=LRR 19
HgeneSLIT3chr5:168671709chr5:149225323ENST00000519560-336824_8451131524RepeatNote=LRR 20
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+912430_4509381024Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+912772_8239381024Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+811430_450899985Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+811772_823899985Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+911430_4509381018Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+911772_8239381018Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+811430_450874960Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+811772_823874960Compositional biasNote=Glu-rich
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+912902_9769381024DomainRRM
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+911902_9769381018DomainRRM
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+912156_1609381024MotifNote=LXXLL motif 1
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+912691_6949381024MotifNote=HCFC1-binding-motif (HBM)
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+811156_160899985MotifNote=LXXLL motif 1
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+811691_694899985MotifNote=HCFC1-binding-motif (HBM)
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+911156_1609381018MotifNote=LXXLL motif 1
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+911691_6949381018MotifNote=HCFC1-binding-motif (HBM)
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+811156_160874960MotifNote=LXXLL motif 1
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+811691_694874960MotifNote=HCFC1-binding-motif (HBM)
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000309241+9121_919381024RegionNote=Abolishes DNA transcriptional activity when missing
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000360453+8111_91899985RegionNote=Abolishes DNA transcriptional activity when missing
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000394320+9111_919381018RegionNote=Abolishes DNA transcriptional activity when missing
TgenePPARGC1Bchr5:168671709chr5:149225323ENST00000403750+8111_91874960RegionNote=Abolishes DNA transcriptional activity when missing


Top

FusionGeneSequence for SLIT3_PPARGC1B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLIT3_ENST00000519560_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_199aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSK

>In-frame_SLIT3_ENST00000332966_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_199aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSK

>In-frame_SLIT3_ENST00000404867_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_199aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLGEKYGFITYRCSEHAALSLTKGAALRKRNEPSFQLSYGGLRHFCWPRYTDYDSNSEEALPASGKSK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLIT3_ENST00000519560_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_597nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTC
ATCACCTACCGGTGTTCTGAGCACGCGGCCCTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGC
TACGGAGGGCTCCGGCACTTCTGCTGGCCCAGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAG

>In-frame_SLIT3_ENST00000332966_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_597nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTC
ATCACCTACCGGTGTTCTGAGCACGCGGCCCTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGC
TACGGAGGGCTCCGGCACTTCTGCTGGCCCAGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAG

>In-frame_SLIT3_ENST00000404867_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_597nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTC
ATCACCTACCGGTGTTCTGAGCACGCGGCCCTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGC
TACGGAGGGCTCCGGCACTTCTGCTGGCCCAGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLIT3_ENST00000519560_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_1021nt
GAGAGCGAGCGCCGGCCAGCTCACCCGGCCGCCCCGTGCCCCAGCCGCAGCCGCCGCGCTCCCCAGCCCAGCCCCAAGCCGGACCTCCCC
GGGCGCCACGCCCCATTGCGCTCGCCCCAGGTCCCCAACCCGGCCCGCGGGCCAGCGGGGCCAGGGGGCGCTCCGCACCTGGGCACTCCC
AGCGATGCGCAGCGGGGCAGCGCCGGCCCCGCCGATGGAGCTGCTGTTGCTGCCGCCGCCGCCGCCCGGAGCGCCCCGCTCCGCCCGCGC
CCCGTGCGCCTGAGCACCGAGCTCGCCCCTCCTCCGCGCTAACTCCGCCGCCCGCTCCCCAGGCCGCCCGCGCTCCCCGCGCGCCTCCTC
GGGCTCCACGCGTCTTGCCCCGCAGAGGCAGCCTCCTCCAGGAGCGGGGCCCTGCACACCATGGCCCCCGGGTGGGCAGGGGTCGGCGCC
GCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCAGCCGTCGCCTGCCCCACCAAGTGTACCTGC
TCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCCCGCAACGCTGAGCGCCTTGACCTGGACAGA
AATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTGCATCTGGAAGACAACCAGGTCAGCGTCATC
GAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTCATCACCTACCGGTGTTCTGAGCACGCGGCC
CTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGCTACGGAGGGCTCCGGCACTTCTGCTGGCCC
AGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAGTATGAAGCCATGGATTTTGACAGCTTACTG

>In-frame_SLIT3_ENST00000332966_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_674nt
CGCGCGCCTCCTCGGGCTCCACGCGTCTTGCCCCGCAGAGGCAGCCTCCTCCAGGAGCGGGGCCCTGCACACCATGGCCCCCGGGTGGGC
AGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCAGCCGTCGCCTGCCCCAC
CAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCCCGCAACGCTGAGCGCCT
TGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTGCATCTGGAAGACAACCA
GGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTCATCACCTACCGGTGTTC
TGAGCACGCGGCCCTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGCTACGGAGGGCTCCGGCA
CTTCTGCTGGCCCAGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAGTATGAAGCCATGGATTT

>In-frame_SLIT3_ENST00000404867_chr5_168671709_-_PPARGC1B_ENST00000360453_chr5_149225323_+_601nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTAGGCGAGAAGTACGGCTTC
ATCACCTACCGGTGTTCTGAGCACGCGGCCCTCTCTTTGACAAAGGGCGCTGCCCTGAGGAAGCGCAACGAGCCCTCCTTCCAGCTGAGC
TACGGAGGGCTCCGGCACTTCTGCTGGCCCAGATACACTGACTACGATTCCAATTCAGAAGAGGCCCTTCCTGCGTCAGGGAAAAGCAAG


Top

FusionGenePPI for SLIT3_PPARGC1B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLIT3CAPN1, OTUB1PPARGC1BESR1, HNF4A, THRB, PPARA, ZNF200, ZNF212, ZFP64, ZNF513, ZBTB9, FOXA2, SRC, PIAS1, NR1H2, PNKD, SYVN1, PPARG, DNAJC10, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLIT3_PPARGC1B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLIT3_PPARGC1B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSLIT3C0019284Diaphragmatic Hernia1CTD_human
HgeneSLIT3C0036341Schizophrenia1PSYGENET
HgeneSLIT3C0041696Unipolar Depression1PSYGENET
HgeneSLIT3C1269683Major Depressive Disorder1PSYGENET
TgenePPARGC1BC0020473Hyperlipidemia1CTD_human
TgenePPARGC1BC1458155Mammary Neoplasms1CTD_human