FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 34690

FusionGeneSummary for SLIT3_ITPR2

check button Fusion gene summary
Fusion gene informationFusion gene name: SLIT3_ITPR2
Fusion gene ID: 34690
HgeneTgene
Gene symbol

SLIT3

ITPR2

Gene ID

6586

3709

Gene nameslit guidance ligand 3inositol 1,4,5-trisphosphate receptor type 2
SynonymsMEGF5|SLIL2|SLIT1|Slit-3|slit2ANHD|CFAP48|INSP3R2|IP3R2
Cytomap

5q34-q35.1

12p11.23

Type of geneprotein-codingprotein-coding
Descriptionslit homolog 3 proteinmultiple EGF-like domains protein 5multiple epidermal growth factor-like domains protein 5slit homolog 3inositol 1,4,5-trisphosphate receptor type 2IP3 receptorIP3R 2cilia and flagella associated protein 48type 2 InsP3 receptor
Modification date2018052220180523
UniProtAcc

O75094

Q14571

Ensembl transtripts involved in fusion geneENST00000519560, ENST00000332966, 
ENST00000404867, ENST00000521130, 
ENST00000381340, ENST00000545902, 
ENST00000242737, 
Fusion gene scores* DoF score7 X 5 X 4=14016 X 16 X 8=2048
# samples 718
** MAII scorelog2(7/140*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/2048*10)=-3.50814690367033
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SLIT3 [Title/Abstract] AND ITPR2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSLIT3

GO:0007411

axon guidance

11748139

HgeneSLIT3

GO:0021834

chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration

11748139

HgeneSLIT3

GO:0048846

axon extension involved in axon guidance

16840550

HgeneSLIT3

GO:0050919

negative chemotaxis

11748139

TgeneITPR2

GO:0001666

response to hypoxia

19120137


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSARCTCGA-DX-A1KZ-01ASLIT3chr5

168620483

-ITPR2chr12

26943160

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000519560ENST00000381340SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000519560ENST00000545902SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000519560ENST00000242737SLIT3chr5

168620483

-ITPR2chr12

26943160

-
In-frameENST00000332966ENST00000381340SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000332966ENST00000545902SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000332966ENST00000242737SLIT3chr5

168620483

-ITPR2chr12

26943160

-
In-frameENST00000404867ENST00000381340SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000404867ENST00000545902SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5CDS-intronENST00000404867ENST00000242737SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5UTR-3CDSENST00000521130ENST00000381340SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5UTR-intronENST00000521130ENST00000545902SLIT3chr5

168620483

-ITPR2chr12

26943160

-
5UTR-intronENST00000521130ENST00000242737SLIT3chr5

168620483

-ITPR2chr12

26943160

-

Top

FusionProtFeatures for SLIT3_ITPR2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SLIT3

O75094

ITPR2

Q14571

May act as molecular guidance cue in cellular migration,and function may be mediated by interaction with roundabouthomolog receptors. Receptor for inositol 1,4,5-trisphosphate, a secondmessenger that mediates the release of intracellular calcium. Thisrelease is regulated by cAMP both dependently and independently ofPKA (By similarity). {ECO:0000250|UniProtKB:Q9Z329}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-43634_611371473DomainNote=LRRNT
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-43634_611371524DomainNote=LRRNT
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436110_1311371473RepeatNote=LRR 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-43662_831371473RepeatNote=LRR 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-43686_1071371473RepeatNote=LRR 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436110_1311371524RepeatNote=LRR 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-43662_831371524RepeatNote=LRR 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-43686_1071371524RepeatNote=LRR 2
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06112_16630182DomainMIR 1
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06173_22330182DomainMIR 2
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06231_28730182DomainMIR 3
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06294_37230182DomainMIR 4
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06378_43430182DomainMIR 5
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057112_166302702DomainMIR 1
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057173_223302702DomainMIR 2
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057231_287302702DomainMIR 3
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057294_372302702DomainMIR 4
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057378_434302702DomainMIR 5
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06265_26930182RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06507_51030182RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-06567_56930182RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057265_269302702RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057507_510302702RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-057567_569302702RegionInositol 1%2C4%2C5-trisphosphate binding
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062249_226030182Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062282_230730182Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062329_235130182Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062373_239430182Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062416_252130182Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062543_270130182Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572249_2260302702Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572282_2307302702Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572329_2351302702Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572373_2394302702Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572416_2521302702Topological domainExtracellular
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572543_2701302702Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062228_224830182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062261_228130182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062308_232830182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062352_237230182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062395_241530182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-062522_254230182TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572228_2248302702TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572261_2281302702TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572308_2328302702TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572352_2372302702TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572395_2415302702TransmembraneHelical
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0572522_2542302702TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361034_10721371473DomainEGF-like 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361074_11101371473DomainEGF-like 5
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361119_11551371473DomainEGF-like 6
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361158_13321371473DomainLaminin G-like
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361340_13651371473DomainEGF-like 7
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361368_14031371473DomainEGF-like 8
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361408_14441371473DomainEGF-like 9
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-4361449_15231371473DomainCTCK
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436215_2651371473DomainNote=LRRCT 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436271_3071371473DomainNote=LRRNT 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436437_4871371473DomainNote=LRRCT 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436496_5321371473DomainNote=LRRNT 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436663_7131371473DomainNote=LRRCT 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436716_7521371473DomainNote=LRRNT 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436857_9071371473DomainNote=LRRCT 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436918_9531371473DomainEGF-like 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436955_9941371473DomainEGF-like 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436996_10321371473DomainEGF-like 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361034_10721371524DomainEGF-like 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361074_11101371524DomainEGF-like 5
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361119_11551371524DomainEGF-like 6
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361158_13321371524DomainLaminin G-like
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361340_13651371524DomainEGF-like 7
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361368_14031371524DomainEGF-like 8
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361408_14441371524DomainEGF-like 9
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-4361449_15231371524DomainCTCK
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436215_2651371524DomainNote=LRRCT 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436271_3071371524DomainNote=LRRNT 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436437_4871371524DomainNote=LRRCT 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436496_5321371524DomainNote=LRRNT 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436663_7131371524DomainNote=LRRCT 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436716_7521371524DomainNote=LRRNT 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436857_9071371524DomainNote=LRRCT 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436918_9531371524DomainEGF-like 1
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436955_9941371524DomainEGF-like 2
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436996_10321371524DomainEGF-like 3
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436134_1551371473RepeatNote=LRR 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436158_1791371473RepeatNote=LRR 5
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436182_2031371473RepeatNote=LRR 6
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436308_3291371473RepeatNote=LRR 7
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436332_3531371473RepeatNote=LRR 8
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436356_3771371473RepeatNote=LRR 9
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436380_4011371473RepeatNote=LRR 10
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436404_4251371473RepeatNote=LRR 11
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436533_5541371473RepeatNote=LRR 12
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436558_5791371473RepeatNote=LRR 13
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436582_6031371473RepeatNote=LRR 14
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436606_6271371473RepeatNote=LRR 15
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436630_6511371473RepeatNote=LRR 16
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436753_7751371473RepeatNote=LRR 17
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436776_7971371473RepeatNote=LRR 18
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436800_8211371473RepeatNote=LRR 19
HgeneSLIT3chr5:168620483chr12:26943160ENST00000404867-436824_8451371473RepeatNote=LRR 20
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436134_1551371524RepeatNote=LRR 4
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436158_1791371524RepeatNote=LRR 5
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436182_2031371524RepeatNote=LRR 6
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436308_3291371524RepeatNote=LRR 7
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436332_3531371524RepeatNote=LRR 8
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436356_3771371524RepeatNote=LRR 9
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436380_4011371524RepeatNote=LRR 10
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436404_4251371524RepeatNote=LRR 11
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436533_5541371524RepeatNote=LRR 12
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436558_5791371524RepeatNote=LRR 13
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436582_6031371524RepeatNote=LRR 14
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436606_6271371524RepeatNote=LRR 15
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436630_6511371524RepeatNote=LRR 16
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436753_7751371524RepeatNote=LRR 17
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436776_7971371524RepeatNote=LRR 18
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436800_8211371524RepeatNote=LRR 19
HgeneSLIT3chr5:168620483chr12:26943160ENST00000519560-436824_8451371524RepeatNote=LRR 20
TgeneITPR2chr5:168620483chr12:26943160ENST00000242737-061_222730182Topological domainCytoplasmic
TgeneITPR2chr5:168620483chr12:26943160ENST00000381340-0571_2227302702Topological domainCytoplasmic


Top

FusionGeneSequence for SLIT3_ITPR2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SLIT3_ENST00000519560_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_2809aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMNRTSAQKQTW
KAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKTLTVNKRLPALLEKNAMRVSLDAAGNEGSWFTI
HPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKTSSTREDVLKGGDVVRLFHAEQEKFLTC
DETEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNTLAAELNPDTRDAQNEGKNVRDGVPPTSKKK
RQAGEKIMTTLVSVPHGNDIASLFELDATTLQRADCLVPRNSTVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVS
VPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILK
APFKEKAGEGSMLRLEDLGDQRTAPYKYMLRLCYRVLRHSQQDYRKNQETIAKNFCVMQSQIGTDILAEDTITALLHNNRKLLEKHITAK
EIETFVSLLRRNREPRFLDTLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLTWIDSNKE
PHGKAIRHLAQEAKEGTKADLEVLTTYRYQLNLFARMCLDRQTLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQE
SVVPVRTARLWTEIPTKITIHETDSITDSSRNDMKRKFALTMEFVEETLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFTSFSELL
RLTRTLLAILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTEHEDVTVMDTKLKI
IEILQFILSVRLDTRISTMLSITKKEFGEDNDNAETSASGSPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIH
LIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNTENGEIGESQVKGGEEPI
EESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPTEKNDEKMNEVMNLAHTFLQ
NFCRGNPQNQVLLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKTVKKCQDMVMT
ELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAT
VNFVNHCTVDTEVEMKEITTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTSLQTHQPVFIQLL
QSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNII
EKLQDVVASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFVEEGN
TLRKILLNRYFKGDTSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLE
GGNTQTQTSFYQQLHEQKKSEKFFKVLTDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLKEGMKGQLTEASSA
TSKATCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVALVNQNLESLTETCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLAIME
SRHDSENAERILFNMRPRELVDVMKNATNQGLECDHGDDEGGDDGVSPKDVGHNITILAHQLARHNKLLQQMLKPGSDPDEGDEALKTTA
NHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSIS
FNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPVGIRPFLVSIMLRSITTIGLGPTLILLGAANLCNKIVFL
VSFVGNRGTFTRGYRAVILDMAFLTHVATVLVCMLGLFVHEFFTSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIG
FLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEETEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDV
LRRPSKDEPLFAARVVTDLLFTFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHTL
YFIVLVKVKDPTEYTGPESTVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQR

>In-frame_SLIT3_ENST00000332966_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_2809aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMNRTSAQKQTW
KAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKTLTVNKRLPALLEKNAMRVSLDAAGNEGSWFTI
HPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKTSSTREDVLKGGDVVRLFHAEQEKFLTC
DETEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNTLAAELNPDTRDAQNEGKNVRDGVPPTSKKK
RQAGEKIMTTLVSVPHGNDIASLFELDATTLQRADCLVPRNSTVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVS
VPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILK
APFKEKAGEGSMLRLEDLGDQRTAPYKYMLRLCYRVLRHSQQDYRKNQETIAKNFCVMQSQIGTDILAEDTITALLHNNRKLLEKHITAK
EIETFVSLLRRNREPRFLDTLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLTWIDSNKE
PHGKAIRHLAQEAKEGTKADLEVLTTYRYQLNLFARMCLDRQTLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQE
SVVPVRTARLWTEIPTKITIHETDSITDSSRNDMKRKFALTMEFVEETLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFTSFSELL
RLTRTLLAILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTEHEDVTVMDTKLKI
IEILQFILSVRLDTRISTMLSITKKEFGEDNDNAETSASGSPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIH
LIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNTENGEIGESQVKGGEEPI
EESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPTEKNDEKMNEVMNLAHTFLQ
NFCRGNPQNQVLLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKTVKKCQDMVMT
ELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAT
VNFVNHCTVDTEVEMKEITTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTSLQTHQPVFIQLL
QSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNII
EKLQDVVASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFVEEGN
TLRKILLNRYFKGDTSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLE
GGNTQTQTSFYQQLHEQKKSEKFFKVLTDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLKEGMKGQLTEASSA
TSKATCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVALVNQNLESLTETCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLAIME
SRHDSENAERILFNMRPRELVDVMKNATNQGLECDHGDDEGGDDGVSPKDVGHNITILAHQLARHNKLLQQMLKPGSDPDEGDEALKTTA
NHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSIS
FNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPVGIRPFLVSIMLRSITTIGLGPTLILLGAANLCNKIVFL
VSFVGNRGTFTRGYRAVILDMAFLTHVATVLVCMLGLFVHEFFTSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIG
FLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEETEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDV
LRRPSKDEPLFAARVVTDLLFTFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHTL
YFIVLVKVKDPTEYTGPESTVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQR

>In-frame_SLIT3_ENST00000404867_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_2809aa
MAPGWAGVGAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIPRNAERLDLDRNNITRITKMDFAGLKNLRVL
HLEDNQVSVIERGAFQDLKQLERLRLNKNKLQVLPELLFQSTPKLTRLLVDDRCVVHPEAGDLANPPKKFRDCLFKVCPMNRTSAQKQTW
KAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNVIQLLHIKSNKTLTVNKRLPALLEKNAMRVSLDAAGNEGSWFTI
HPFWKLRSEGDNIVVGDKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKTSSTREDVLKGGDVVRLFHAEQEKFLTC
DETEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWNSLFRFKHLATGNTLAAELNPDTRDAQNEGKNVRDGVPPTSKKK
RQAGEKIMTTLVSVPHGNDIASLFELDATTLQRADCLVPRNSTVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTCQTKEDKEAFAIVS
VPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLIFFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILK
APFKEKAGEGSMLRLEDLGDQRTAPYKYMLRLCYRVLRHSQQDYRKNQETIAKNFCVMQSQIGTDILAEDTITALLHNNRKLLEKHITAK
EIETFVSLLRRNREPRFLDTLSDLCVSNTTAIPVTQELICKFMLSPGNADILIQTKVVSMQADNPMESSILSDDIDDEEVWLTWIDSNKE
PHGKAIRHLAQEAKEGTKADLEVLTTYRYQLNLFARMCLDRQTLAINQISTQLSVDLILRCVSDESLPFDLRASFCRLMLHMHVDRDPQE
SVVPVRTARLWTEIPTKITIHETDSITDSSRNDMKRKFALTMEFVEETLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFTSFSELL
RLTRTLLAILDIVQAPMSSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTEHEDVTVMDTKLKI
IEILQFILSVRLDTRISTMLSITKKEFGEDNDNAETSASGSPDTLLPSAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIH
LIMHDYPPLLSGALQLLFKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNTENGEIGESQVKGGEEPI
EESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCRNQHQRLLKNMGAHSVVLDLLQIPTEKNDEKMNEVMNLAHTFLQ
NFCRGNPQNQVLLHKHLNLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKADGKTVKKCQDMVMT
ELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVELLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAT
VNFVNHCTVDTEVEMKEITTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNSTSLQTHQPVFIQLL
QSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVNTLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNII
EKLQDVVASLEHQFSPMMQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLREMLEKKDSFVEEGN
TLRKILLNRYFKGDTSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGISMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLE
GGNTQTQTSFYQQLHEQKKSEKFFKVLTDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLKEGMKGQLTEASSA
TSKATCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQPILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCIC
GSTTGGLGLLGLYINEKNVALVNQNLESLTETCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQLKNNASKLLLAIME
SRHDSENAERILFNMRPRELVDVMKNATNQGLECDHGDDEGGDDGVSPKDVGHNITILAHQLARHNKLLQQMLKPGSDPDEGDEALKTTA
NHTAQIEIVRHDRTMEQIVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALFWFSRHISLWGSIS
FNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFFFSKPVGIRPFLVSIMLRSITTIGLGPTLILLGAANLCNKIVFL
VSFVGNRGTFTRGYRAVILDMAFLTHVATVLVCMLGLFVHEFFTSFLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIIG
FLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPTIPASNTADEETEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDV
LRRPSKDEPLFAARVVTDLLFTFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKSEHNMWHTL
YFIVLVKVKDPTEYTGPESTVAQMIVEKNLDWFPRMRAMSLVSNEGDSEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SLIT3_ENST00000519560_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_8427nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAG
CTGCAAGTCCTTCCAGAATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCC
GGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGG
AAAGCAAAGCAAGCCAAACAAGGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAAT
GAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACT
GTCAACAAGAGATTACCTGCTTTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATT
CATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTA
CATGCCAGCAACATAGAGCTTCTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTC
ATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGT
GATGAATATGAGAAAAAACAGCACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAA
ATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTAT
TTAGCTGCAGAGCTTAATCCTGATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAA
CGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACT
CTTCAGAGAGCTGACTGCCTGGTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATC
CCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCT
GTTCCACTGTCTGAAGTTCGAGACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACA
ATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTT
CTGGATGTGGTTATCACTAAGCCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAA
GCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTG
CGGCTCTGTTACCGCGTCCTGAGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCC
CAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAA
GAAATAGAAACATTTGTCAGTTTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACT
GCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATG
CAAGCAGACAACCCCATGGAGAGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAA
CCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAG
CTAAACCTCTTTGCAAGGATGTGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGG
TGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAG
TCCGTGGTGCCTGTTCGCTATGCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCC
AGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGG
GATAAAGAAAAAAATAAACTGACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTA
AGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGA
GGAAACAATGTGATGAGAACCATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTG
CCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATC
ATTGAGATTTTGCAGTTTATCCTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGAC
AATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAG
GCAGAAACTATGTTTGCGGGAAGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCAT
CTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCA
TTTAAGCAGGTGCAATTACTGGTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTA
GAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATT
GAGGAATCAAACATTTTAAGTCCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAG
GAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCAT
TCGGTGGTGTTGGATCTTCTGCAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAG
AATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACC
ATGCGGCACATCTTCATGAACAATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACAT
GGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACA
GAGTTGATAAATGGGGGTGAAGACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGA
GACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACT
GAAATCAAGTGTAATTCCCTTCTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTAT
GTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAAC
TTCTTGGTGGATATGGCAAGGGTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATA
ATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTG
CAATCTGCCTTCAGAATTTACAATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTG
GCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGA
GCAGCAATGGGTTGGAGACTATCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATT
GAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTAC
AGTCCAGAACTGCTGTTCCCTGAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTA
ATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAAC
ACATTAAGAAAGATACTTCTGAATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACT
GCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGT
GCATCAGAACTTGTCATCGATGTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAA
GGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGA
ATGAAGGCTGCTCAGAAAGAAATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTG
ATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCA
ACATCCAAAGCATATTGTGTATACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAA
AAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAAC
CGGGAATTGCAGAACTTCTTGAGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGT
GGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACT
GAGTATTGCCAGGGCCCTTGCCATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTG
AATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAA
AGCAGACATGACAGTGAGAATGCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAA
GGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCAT
CAGTTGGCCCGCCACAATAAACTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCC
AACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACT
CGAGAATCCAAGTGCCGTGTGTTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTC
TACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCC
TTCAACCTGGCTGTGTTCATCAATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTC
TCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCA
ATAATGCTCAGATCAATATATACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTG
GTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTC
CTGGTTTGCATGCTGGGCCTTTTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAAT
GTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGG
TTCCTTTTTTTGAAGGATGACTTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATG
ACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGAT
GGAATTGAAAGGACGTGTGACACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTG
CTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTG
AACTTGATTTTTGGTGTTATCATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTC
ATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTG
TACTTCATAGTCCTGGTGAAAGTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTG
GATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTG
GAATCGACCATGAGTCTGGTCAAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGA

>In-frame_SLIT3_ENST00000332966_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_8427nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAG
CTGCAAGTCCTTCCAGAATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCC
GGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGG
AAAGCAAAGCAAGCCAAACAAGGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAAT
GAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACT
GTCAACAAGAGATTACCTGCTTTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATT
CATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTA
CATGCCAGCAACATAGAGCTTCTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTC
ATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGT
GATGAATATGAGAAAAAACAGCACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAA
ATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTAT
TTAGCTGCAGAGCTTAATCCTGATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAA
CGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACT
CTTCAGAGAGCTGACTGCCTGGTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATC
CCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCT
GTTCCACTGTCTGAAGTTCGAGACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACA
ATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTT
CTGGATGTGGTTATCACTAAGCCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAA
GCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTG
CGGCTCTGTTACCGCGTCCTGAGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCC
CAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAA
GAAATAGAAACATTTGTCAGTTTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACT
GCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATG
CAAGCAGACAACCCCATGGAGAGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAA
CCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAG
CTAAACCTCTTTGCAAGGATGTGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGG
TGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAG
TCCGTGGTGCCTGTTCGCTATGCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCC
AGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGG
GATAAAGAAAAAAATAAACTGACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTA
AGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGA
GGAAACAATGTGATGAGAACCATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTG
CCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATC
ATTGAGATTTTGCAGTTTATCCTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGAC
AATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAG
GCAGAAACTATGTTTGCGGGAAGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCAT
CTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCA
TTTAAGCAGGTGCAATTACTGGTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTA
GAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATT
GAGGAATCAAACATTTTAAGTCCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAG
GAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCAT
TCGGTGGTGTTGGATCTTCTGCAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAG
AATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACC
ATGCGGCACATCTTCATGAACAATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACAT
GGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACA
GAGTTGATAAATGGGGGTGAAGACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGA
GACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACT
GAAATCAAGTGTAATTCCCTTCTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTAT
GTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAAC
TTCTTGGTGGATATGGCAAGGGTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATA
ATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTG
CAATCTGCCTTCAGAATTTACAATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTG
GCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGA
GCAGCAATGGGTTGGAGACTATCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATT
GAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTAC
AGTCCAGAACTGCTGTTCCCTGAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTA
ATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAAC
ACATTAAGAAAGATACTTCTGAATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACT
GCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGT
GCATCAGAACTTGTCATCGATGTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAA
GGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGA
ATGAAGGCTGCTCAGAAAGAAATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTG
ATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCA
ACATCCAAAGCATATTGTGTATACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAA
AAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAAC
CGGGAATTGCAGAACTTCTTGAGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGT
GGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACT
GAGTATTGCCAGGGCCCTTGCCATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTG
AATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAA
AGCAGACATGACAGTGAGAATGCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAA
GGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCAT
CAGTTGGCCCGCCACAATAAACTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCC
AACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACT
CGAGAATCCAAGTGCCGTGTGTTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTC
TACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCC
TTCAACCTGGCTGTGTTCATCAATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTC
TCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCA
ATAATGCTCAGATCAATATATACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTG
GTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTC
CTGGTTTGCATGCTGGGCCTTTTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAAT
GTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGG
TTCCTTTTTTTGAAGGATGACTTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATG
ACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGAT
GGAATTGAAAGGACGTGTGACACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTG
CTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTG
AACTTGATTTTTGGTGTTATCATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTC
ATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTG
TACTTCATAGTCCTGGTGAAAGTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTG
GATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTG
GAATCGACCATGAGTCTGGTCAAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGA

>In-frame_SLIT3_ENST00000404867_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_8427nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAG
CTGCAAGTCCTTCCAGAATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCC
GGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGG
AAAGCAAAGCAAGCCAAACAAGGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAAT
GAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACT
GTCAACAAGAGATTACCTGCTTTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATT
CATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTA
CATGCCAGCAACATAGAGCTTCTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTC
ATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGT
GATGAATATGAGAAAAAACAGCACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAA
ATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTAT
TTAGCTGCAGAGCTTAATCCTGATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAA
CGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACT
CTTCAGAGAGCTGACTGCCTGGTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATC
CCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCT
GTTCCACTGTCTGAAGTTCGAGACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACA
ATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTT
CTGGATGTGGTTATCACTAAGCCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAA
GCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTG
CGGCTCTGTTACCGCGTCCTGAGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCC
CAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAA
GAAATAGAAACATTTGTCAGTTTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACT
GCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATG
CAAGCAGACAACCCCATGGAGAGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAA
CCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAG
CTAAACCTCTTTGCAAGGATGTGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGG
TGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAG
TCCGTGGTGCCTGTTCGCTATGCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCC
AGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGG
GATAAAGAAAAAAATAAACTGACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTA
AGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGA
GGAAACAATGTGATGAGAACCATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTG
CCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATC
ATTGAGATTTTGCAGTTTATCCTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGAC
AATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAG
GCAGAAACTATGTTTGCGGGAAGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCAT
CTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCA
TTTAAGCAGGTGCAATTACTGGTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTA
GAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATT
GAGGAATCAAACATTTTAAGTCCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAG
GAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCAT
TCGGTGGTGTTGGATCTTCTGCAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAG
AATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACC
ATGCGGCACATCTTCATGAACAATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACAT
GGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACA
GAGTTGATAAATGGGGGTGAAGACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGA
GACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACT
GAAATCAAGTGTAATTCCCTTCTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTAT
GTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAAC
TTCTTGGTGGATATGGCAAGGGTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATA
ATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTG
CAATCTGCCTTCAGAATTTACAATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTG
GCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGA
GCAGCAATGGGTTGGAGACTATCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATT
GAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTAC
AGTCCAGAACTGCTGTTCCCTGAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTA
ATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAAC
ACATTAAGAAAGATACTTCTGAATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACT
GCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGT
GCATCAGAACTTGTCATCGATGTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAA
GGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGA
ATGAAGGCTGCTCAGAAAGAAATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTG
ATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCA
ACATCCAAAGCATATTGTGTATACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAA
AAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAAC
CGGGAATTGCAGAACTTCTTGAGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGT
GGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACT
GAGTATTGCCAGGGCCCTTGCCATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTG
AATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAA
AGCAGACATGACAGTGAGAATGCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAA
GGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCAT
CAGTTGGCCCGCCACAATAAACTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCC
AACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACT
CGAGAATCCAAGTGCCGTGTGTTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTC
TACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCC
TTCAACCTGGCTGTGTTCATCAATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTC
TCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCA
ATAATGCTCAGATCAATATATACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTG
GTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTC
CTGGTTTGCATGCTGGGCCTTTTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAAT
GTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGG
TTCCTTTTTTTGAAGGATGACTTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATG
ACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGAT
GGAATTGAAAGGACGTGTGACACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTG
CTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTG
AACTTGATTTTTGGTGTTATCATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTC
ATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTG
TACTTCATAGTCCTGGTGAAAGTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTG
GATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTG
GAATCGACCATGAGTCTGGTCAAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SLIT3_ENST00000519560_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_10835nt
GAGAGCGAGCGCCGGCCAGCTCACCCGGCCGCCCCGTGCCCCAGCCGCAGCCGCCGCGCTCCCCAGCCCAGCCCCAAGCCGGACCTCCCC
GGGCGCCACGCCCCATTGCGCTCGCCCCAGGTCCCCAACCCGGCCCGCGGGCCAGCGGGGCCAGGGGGCGCTCCGCACCTGGGCACTCCC
AGCGATGCGCAGCGGGGCAGCGCCGGCCCCGCCGATGGAGCTGCTGTTGCTGCCGCCGCCGCCGCCCGGAGCGCCCCGCTCCGCCCGCGC
CCCGTGCGCCTGAGCACCGAGCTCGCCCCTCCTCCGCGCTAACTCCGCCGCCCGCTCCCCAGGCCGCCCGCGCTCCCCGCGCGCCTCCTC
GGGCTCCACGCGTCTTGCCCCGCAGAGGCAGCCTCCTCCAGGAGCGGGGCCCTGCACACCATGGCCCCCGGGTGGGCAGGGGTCGGCGCC
GCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCAGCCGTCGCCTGCCCCACCAAGTGTACCTGC
TCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCCCGCAACGCTGAGCGCCTTGACCTGGACAGA
AATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTGCATCTGGAAGACAACCAGGTCAGCGTCATC
GAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAGCTGCAAGTCCTTCCAGAATTGCTTTTCCAG
AGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCCGGGGACCTTGCCAACCCTCCCAAGAAGTTC
AGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGGAAAGCAAAGCAAGCCAAACAAGGGAACCAC
ACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAATGAATCGGAGAATAAGAAACTGTTGGGAGAA
ATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACTGTCAACAAGAGATTACCTGCTTTACTGGAG
AAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATTCATCCGTTCTGGAAACTGAGAAGCGAGGGT
GACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTACATGCCAGCAACATAGAGCTTCTTGATAAC
CCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTCATGAAATATAGTTCCTATCGAGAGGATGTA
TTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGTGATGAATATGAGAAAAAACAGCACATTTTC
CTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAAATAGAGGTGGTTCATCATGACCCATGCCGT
GGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTATTTAGCTGCAGAGCTTAATCCTGATTATCGA
GATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAACGCCAGGCAGGGGAGAAGATCATGTATACT
TTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACTCTTCAGAGAGCTGACTGCCTGGTTCCAAGG
AACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATCCCCATAGACACAGATGAAGAGAGGCCTGTT
ATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCTGTTCCACTGTCTGAAGTTCGAGACTTAGAC
TTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACAATAACTCAGAATGAAAGGAGGTTTGTAACC
AAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTTCTGGATGTGGTTATCACTAAGCCAAACCGA
GAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAAGCACCCTTTAAAGAGAAAGCAGGAGAAGGC
TCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTGCGGCTCTGTTACCGCGTCCTGAGACACTCG
CAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCCCAGATTGGCTATGATATTTTGGCAGAAGAT
ACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAAGAAATAGAAACATTTGTCAGTTTACTCAGG
AGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACTGCTATCCCTGTAACTCAAGAACTCATCTGT
AAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATGCAAGCAGACAACCCCATGGAGAGCTCCATC
CTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAACCTCATGGCAAAGCTATCAGGCACCTTGCT
CAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAGCTAAACCTCTTTGCAAGGATGTGCTTGGAT
CGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGGTGTGTGTCGGATGAGAGCCTGCCGTTCGAC
CTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAGTCCGTGGTGCCTGTTCGCTATGCCAGGCTC
TGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCCAGAAATGATATGAAGAGGAAATTTGCCCTG
ACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGGGATAAAGAAAAAAATAAACTGACATTTGAG
GTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTAAGGCTAACAAGAACACTTCTGGCTATTTTA
GACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGAGGAAACAATGTGATGAGAACCATTCATGGG
GTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTGCCGGATGTGCCACCCAGCATCCACCCGAGC
AAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATCATTGAGATTTTGCAGTTTATCCTGAGTGTC
AGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGACAATGACAATGCGGAGACATCTGCCAGTGGA
TCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAGGCAGAAACTATGTTTGCGGGAAGAAAAGAA
AAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCATCTGATCATGCACGACTACCCGCCTTTGCTG
TCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCATTTAAGCAGGTGCAATTACTGGTGTCTAAT
CAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTAGAAAAGTCTGAGCTATGGGTGGAGAAGAGC
AGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATTGAGGAATCAAACATTTTAAGTCCAGTGCAG
GATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAGGAGATTTTGATCAGGCTAAGTAAACTCTGT
GTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCATTCGGTGGTGTTGGATCTTCTGCAGATACCC
TATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAGAATTTCTGTCGAGGAAATCCACAGAATCAA
GTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACCATGCGGCACATCTTCATGAACAATTACCAT
CTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACATGGCCGCCACGTGGAGTACCTGAGGTTTTTG
CAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACAGAGTTGATAAATGGGGGTGAAGACGTGCTG
ATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGAGACCGAGGGGATGAGAGTGGCCCCTTAGCC
TACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACTGAAATCAAGTGTAATTCCCTTCTCCCGCTG
GACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTATGTGAACTTTGTTAATCACTGTTATGTTGAC
ACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAACTTCTTGGTGGATATGGCAAGGGTTTGCAAC
ACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATAATGAATATTGTGAGCGGCTTCTTTAATTCT
CCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTGCAATCTGCCTTCAGAATTTACAATTGCACC
TGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTGGCAAAAAATCGTGGAATTGCCATTCCAGTG
GATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGAGCAGCAATGGGTTGGAGACTATCAGCTCGC
TCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATTGAAAAGTTACAGGATGTAGTGGCCTCCTTG
GAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTACAGTCCAGAACTGCTGTTCCCTGAGGGAAGC
GATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTAATGGAGAAAGAAGAAAAACTGTGCATTAAA
ATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAACACATTAAGAAAGATACTTCTGAATCGATAC
TTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACTGCACAGGTGGGAGGAAGCTTTTCTGGACAA
GATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGTGCATCAGAACTTGTCATCGATGTTATAGTG
AACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAAGGAGGAAATACACAAACACAGTATTCTTTC
TACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGAATGAAGGCTGCTCAGAAAGAAATAAGATCA
ACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTGATGACATCTGGTCCACGAATGAGAGTAAGA
GATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCAACATCCAAAGCATATTGTGTATACAGAAGA
GAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAAAAATCCGCAGAGGAAGTAACAATGAGTCCC
GCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAACCGGGAATTGCAGAACTTCTTGAGGAATCAA
AACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGTGGAAGTACAACCGGTGGCCTGGGCCTGTTG
GGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACTGAGTATTGCCAGGGCCCTTGCCATGAAAAT
CAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTGAATGACATAAACCCTCTTGGTAAATACCGA
ATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAAAGCAGACATGACAGTGAGAATGCAGAAAGA
ATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAAGGATTGGAATGTGACCATGGGGATGATGAG
GGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCATCAGTTGGCCCGCCACAATAAACTGTTGCAG
CAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCCAACCACACTGCACAGATTGAGATTGTCCGG
CATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACTCGAGAATCCAAGTGCCGTGTGTTCAATACA
ACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTCTACAATGAAATGAAGTGGCAGAAGAAAATC
AGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCCTTCAACCTGGCTGTGTTCATCAATTTAGCT
GTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTCTCGGTTCTTCTTTGGATAGCAGTTGCGATC
TGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCAATAATGCTCAGATCAATATATACAATAGGT
CTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTGGTGAGTTTTGTTGGAAATCGTGGCACGTTC
ACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTCCTGGTTTGCATGCTGGGCCTTTTTGTCCAT
GAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAATGTCATAAAAAGTGTCACACGAAATGGCCGC
TCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGGTTCCTTTTTTTGAAGGATGACTTCACTATG
GAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATGACTTTAACTACCATGATGGAAGCATGTGCC
AAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGATGGAATTGAAAGGACGTGTGACACTCTCCTT
ATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTGCTAAGAAGGCCATCGAAAGATGAGCCCTTG
TTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTGAACTTGATTTTTGGTGTTATCATCGATACT
TTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTCATCTGTGGACTTGAGAGAGACAAGTTTGAT
AATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTGTACTTCATAGTCCTGGTGAAAGTTAAAGAC
CCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTGGATTGGTTTCCTCGGATGCGAGCCATGTCC
CTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTGGAATCGACCATGAGTCTGGTCAAACAGCTG
TCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGACTGGGCTTCCTCGGATCAAACACACCCCAT
GTGAATCATCACATGCCACCACACTGATACCATGGGGGGAAGCCGTGACTAGCCTTTCATCAGTGTCCTGCCTGATCACTGAATAAAGAA
CTGAGATGGAGGGGAGTGAACAGTGCCTATTGTTGAAAAGTTAAAAACAACCAAGTGCCAAGATGTTGAGTGGGTTAGCTCCGAGAACAA
TTTATAACTGTGTTTTCATGGTTGCGAAGACCTAACCTCAAATGCATCTGCTAGAAAGCGTACATCACACATTCGCAATGCATCAGGAAG
AAAAGGCTTGCCCAAAAGGCTGGAGAGGGCAGGGAGCGGCAGGATGGAAGGAGACACGGGGCAGGGAGAACTCTCTTCTGCTAAATCGAT
AGGAGTCAGTTTTGTCTTAAATGCTGACTACAGCCACTGACATGGTTGGCTGGAATTTCTTTCTTTTAATTGTGGCATATAGGTTTGTGA
CACAAGAAGTCATACTTTGGTGGCTAAGTTTTACTAAGGAAAATAACTGAAAAGATTAAAAGTGAGAGCTGAAAAGAGAAATGATAATGC
TTCCAAACTGTAGCTGTCACAGGGCAATTTCTTTATTTATAACATGAAGCACAATGGATTTACAGCTCTAGGAACTTAGTACTTTGGAGC
TTTTGCCTCTCACACTGACAACATAACAGGATGTGATTGCCTTCTCTGGGATTCAGACAGGCTCTGTCAATGTGGAGCACAAAAGGAGAT
TTTCATATAACTTGTTAAAAACATGTTCTAAGTCATGTATAGGCTAAGATTTTAAGAAGATCTGGGGGAATAAAAAGCCAACAGTAAGCC
CCAGGAAAGGGTTTTTTGAGACCATATGTATGCTATTAAAATATATTGAGATTAATACATGAAAATGCTTAAAAGTGATAGGAATTATTG
AGAAACTTATGATGGTGGCATTGCCTTTTATAAACATGGAGTGAAAGCCATTTGACTCAACGTTTGCTGTGCTTAAAGAATTGCTTCAGG
ACCCGAGCGTTTTTATGTATGCTGTTCCTGCAGTTAGGAAAAAAAAATCCAAGAAATGTATTGAATACTCAAGAAAATGCCACATTTCAA
TTACATATTTAAAACTGTATCTGTAAGGGCTTTTCAAAATGTAGCAAGATAAAAATCTCTTATTCAAATTGTTTTTGTATTAAATCATGC
ACTCAGAATTTGTCGAGGGAGAGAATAACCTGGTGTGTTCAGGTTATTCTTAGAGACTACACATTTGGAATAGCAGAGCAAAATATGGAT
AATGAAAGTGTTGGGAAAAAAGTGATGTGACAGGGAGTGAAGACACTTGATACCAGACTCTGGGAGATACTCTGCAAGTTGACCTGGCCT
CTCCCCCACAGGAACAAAACACTGCCTCCAGAGTCTTTAAATTCTCAGTTATCAACGCCAAGGTTTAAGGTCTAGATAGGGTTTGCTATA
GGGTTTGCTCTGACAATTTTTAAAGCTTTTGGATTGTTCTAACATAGCTTAAGCTATTGGTTCCTAAAAATCCCAAATCAAGATCTATGT
AGAATATAAAGGAAGCCTGAACCAATCCTTCCACATACTGTTAAGATGTAGACTTGGAACAAAGCTGTTGGGACCCAGAGCAATGAATTT
TTGAACTGAAGCTACTGGTACTCCCCAGCACCACCTCATACTAAGAATTCCTCACTCTGACATGACAGTATTTTTTCTGACCAGGAGCTG
AAAGACCCTGACATTCATGATCCAAAGATATAAGAAATTTTGATATGTCTGCATGCAGCACAGAACTTTGAACCTAGGAGGCAGTCAATA
AATACATGAGAAATTCAGCTGTCATTCAGTTACTCTTAATTCTTTATAAAACTTTAAATGATACCACATATTTGTTTGTTTAAAATGGCT
TTCCCAAAATCAAAGTAGACTAAAGCAGCCATCTTTAAAATCCAGGATCATCAATGCTATTAACAGTATCAGGTAAAAAGTACACTTTAA

>In-frame_SLIT3_ENST00000332966_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_10488nt
CGCGCGCCTCCTCGGGCTCCACGCGTCTTGCCCCGCAGAGGCAGCCTCCTCCAGGAGCGGGGCCCTGCACACCATGGCCCCCGGGTGGGC
AGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCAGCCGTCGCCTGCCCCAC
CAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCCCGCAACGCTGAGCGCCT
TGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTGCATCTGGAAGACAACCA
GGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAGCTGCAAGTCCTTCCAGA
ATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCCGGGGACCTTGCCAACCC
TCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGGAAAGCAAAGCAAGCCAA
ACAAGGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAATGAATCGGAGAATAAGAA
ACTGTTGGGAGAAATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACTGTCAACAAGAGATTACC
TGCTTTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATTCATCCGTTCTGGAAACT
GAGAAGCGAGGGTGACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTACATGCCAGCAACATAGA
GCTTCTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTCATGAAATATAGTTCCTA
TCGAGAGGATGTATTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGTGATGAATATGAGAAAAA
ACAGCACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAAATAGAGGTGGTTCATCA
TGACCCATGCCGTGGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTATTTAGCTGCAGAGCTTAA
TCCTGATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAACGCCAGGCAGGGGAGAA
GATCATGTATACTTTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACTCTTCAGAGAGCTGACTG
CCTGGTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATCCCCATAGACACAGATGA
AGAGAGGCCTGTTATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCTGTTCCACTGTCTGAAGT
TCGAGACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACAATAACTCAGAATGAAAG
GAGGTTTGTAACCAAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTTCTGGATGTGGTTATCAC
TAAGCCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAAGCACCCTTTAAAGAGAA
AGCAGGAGAAGGCTCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTGCGGCTCTGTTACCGCGT
CCTGAGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCCCAGATTGGCTATGATAT
TTTGGCAGAAGATACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAAGAAATAGAAACATTTGT
CAGTTTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACTGCTATCCCTGTAACTCA
AGAACTCATCTGTAAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATGCAAGCAGACAACCCCAT
GGAGAGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAACCTCATGGCAAAGCTAT
CAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAGCTAAACCTCTTTGCAAG
GATGTGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGGTGTGTGTCGGATGAGAG
CCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAGTCCGTGGTGCCTGTTCG
CTATGCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCCAGAAATGATATGAAGAG
GAAATTTGCCCTGACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGGGATAAAGAAAAAAATAA
ACTGACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTAAGGCTAACAAGAACACT
TCTGGCTATTTTAGACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGAGGAAACAATGTGATGAG
AACCATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTGCCGGATGTGCCACCCAG
CATCCACCCGAGCAAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATCATTGAGATTTTGCAGTT
TATCCTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGACAATGACAATGCGGAGAC
ATCTGCCAGTGGATCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAGGCAGAAACTATGTTTGC
GGGAAGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCATCTGATCATGCACGACTA
CCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCATTTAAGCAGGTGCAATT
ACTGGTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTAGAAAAGTCTGAGCTATG
GGTGGAGAAGAGCAGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATTGAGGAATCAAACATTTT
AAGTCCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAGGAGATTTTGATCAGGCT
AAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCATTCGGTGGTGTTGGATCT
TCTGCAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAGAATTTCTGTCGAGGAAA
TCCACAGAATCAAGTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACCATGCGGCACATCTTCAT
GAACAATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACATGGCCGCCACGTGGAGTA
CCTGAGGTTTTTGCAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACAGAGTTGATAAATGGGGG
TGAAGACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGAGACCGAGGGGATGAGAG
TGGCCCCTTAGCCTACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACTGAAATCAAGTGTAATTC
CCTTCTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTATGTGAACTTTGTTAATCA
CTGTTATGTTGACACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAACTTCTTGGTGGATATGGC
AAGGGTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATAATGAATATTGTGAGCGG
CTTCTTTAATTCTCCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTGCAATCTGCCTTCAGAAT
TTACAATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTGGCAAAAAATCGTGGAAT
TGCCATTCCAGTGGATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGAGCAGCAATGGGTTGGAG
ACTATCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATTGAAAAGTTACAGGATGT
AGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTACAGTCCAGAACTGCTGTT
CCCTGAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTAATGGAGAAAGAAGAAAA
ACTGTGCATTAAAATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAACACATTAAGAAAGATACT
TCTGAATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACTGCACAGGTGGGAGGAAG
CTTTTCTGGACAAGATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGTGCATCAGAACTTGTCAT
CGATGTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAAGGAGGAAATACACAAAC
ACAGTATTCTTTCTACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGAATGAAGGCTGCTCAGAA
AGAAATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTGATGACATCTGGTCCACG
AATGAGAGTAAGAGATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCAACATCCAAAGCATATTG
TGTATACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAAAAATCCGCAGAGGAAGT
AACAATGAGTCCCGCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAACCGGGAATTGCAGAACTT
CTTGAGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGTGGAAGTACAACCGGTGG
CCTGGGCCTGTTGGGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACTGAGTATTGCCAGGGCCC
TTGCCATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTGAATGACATAAACCCTCT
TGGTAAATACCGAATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAAAGCAGACATGACAGTGA
GAATGCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAAGGATTGGAATGTGACCA
TGGGGATGATGAGGGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCATCAGTTGGCCCGCCACAA
TAAACTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCCAACCACACTGCACAGAT
TGAGATTGTCCGGCATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACTCGAGAATCCAAGTGCCG
TGTGTTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTCTACAATGAAATGAAGTG
GCAGAAGAAAATCAGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCCTTCAACCTGGCTGTGTT
CATCAATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTCTCGGTTCTTCTTTGGAT
AGCAGTTGCGATCTGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCAATAATGCTCAGATCAAT
ATATACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTGGTGAGTTTTGTTGGAAA
TCGTGGCACGTTCACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTCCTGGTTTGCATGCTGGG
CCTTTTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAATGTCATAAAAAGTGTCAC
ACGAAATGGCCGCTCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGGTTCCTTTTTTTGAAGGA
TGACTTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATGACTTTAACTACCATGAT
GGAAGCATGTGCCAAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGATGGAATTGAAAGGACGTG
TGACACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTGCTAAGAAGGCCATCGAA
AGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTGAACTTGATTTTTGGTGT
TATCATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTCATCTGTGGACTTGAGAG
AGACAAGTTTGATAATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTGTACTTCATAGTCCTGGT
GAAAGTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTGGATTGGTTTCCTCGGAT
GCGAGCCATGTCCCTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTGGAATCGACCATGAGTCT
GGTCAAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGACTGGGCTTCCTCGGATC
AAACACACCCCATGTGAATCATCACATGCCACCACACTGATACCATGGGGGGAAGCCGTGACTAGCCTTTCATCAGTGTCCTGCCTGATC
ACTGAATAAAGAACTGAGATGGAGGGGAGTGAACAGTGCCTATTGTTGAAAAGTTAAAAACAACCAAGTGCCAAGATGTTGAGTGGGTTA
GCTCCGAGAACAATTTATAACTGTGTTTTCATGGTTGCGAAGACCTAACCTCAAATGCATCTGCTAGAAAGCGTACATCACACATTCGCA
ATGCATCAGGAAGAAAAGGCTTGCCCAAAAGGCTGGAGAGGGCAGGGAGCGGCAGGATGGAAGGAGACACGGGGCAGGGAGAACTCTCTT
CTGCTAAATCGATAGGAGTCAGTTTTGTCTTAAATGCTGACTACAGCCACTGACATGGTTGGCTGGAATTTCTTTCTTTTAATTGTGGCA
TATAGGTTTGTGACACAAGAAGTCATACTTTGGTGGCTAAGTTTTACTAAGGAAAATAACTGAAAAGATTAAAAGTGAGAGCTGAAAAGA
GAAATGATAATGCTTCCAAACTGTAGCTGTCACAGGGCAATTTCTTTATTTATAACATGAAGCACAATGGATTTACAGCTCTAGGAACTT
AGTACTTTGGAGCTTTTGCCTCTCACACTGACAACATAACAGGATGTGATTGCCTTCTCTGGGATTCAGACAGGCTCTGTCAATGTGGAG
CACAAAAGGAGATTTTCATATAACTTGTTAAAAACATGTTCTAAGTCATGTATAGGCTAAGATTTTAAGAAGATCTGGGGGAATAAAAAG
CCAACAGTAAGCCCCAGGAAAGGGTTTTTTGAGACCATATGTATGCTATTAAAATATATTGAGATTAATACATGAAAATGCTTAAAAGTG
ATAGGAATTATTGAGAAACTTATGATGGTGGCATTGCCTTTTATAAACATGGAGTGAAAGCCATTTGACTCAACGTTTGCTGTGCTTAAA
GAATTGCTTCAGGACCCGAGCGTTTTTATGTATGCTGTTCCTGCAGTTAGGAAAAAAAAATCCAAGAAATGTATTGAATACTCAAGAAAA
TGCCACATTTCAATTACATATTTAAAACTGTATCTGTAAGGGCTTTTCAAAATGTAGCAAGATAAAAATCTCTTATTCAAATTGTTTTTG
TATTAAATCATGCACTCAGAATTTGTCGAGGGAGAGAATAACCTGGTGTGTTCAGGTTATTCTTAGAGACTACACATTTGGAATAGCAGA
GCAAAATATGGATAATGAAAGTGTTGGGAAAAAAGTGATGTGACAGGGAGTGAAGACACTTGATACCAGACTCTGGGAGATACTCTGCAA
GTTGACCTGGCCTCTCCCCCACAGGAACAAAACACTGCCTCCAGAGTCTTTAAATTCTCAGTTATCAACGCCAAGGTTTAAGGTCTAGAT
AGGGTTTGCTATAGGGTTTGCTCTGACAATTTTTAAAGCTTTTGGATTGTTCTAACATAGCTTAAGCTATTGGTTCCTAAAAATCCCAAA
TCAAGATCTATGTAGAATATAAAGGAAGCCTGAACCAATCCTTCCACATACTGTTAAGATGTAGACTTGGAACAAAGCTGTTGGGACCCA
GAGCAATGAATTTTTGAACTGAAGCTACTGGTACTCCCCAGCACCACCTCATACTAAGAATTCCTCACTCTGACATGACAGTATTTTTTC
TGACCAGGAGCTGAAAGACCCTGACATTCATGATCCAAAGATATAAGAAATTTTGATATGTCTGCATGCAGCACAGAACTTTGAACCTAG
GAGGCAGTCAATAAATACATGAGAAATTCAGCTGTCATTCAGTTACTCTTAATTCTTTATAAAACTTTAAATGATACCACATATTTGTTT
GTTTAAAATGGCTTTCCCAAAATCAAAGTAGACTAAAGCAGCCATCTTTAAAATCCAGGATCATCAATGCTATTAACAGTATCAGGTAAA

>In-frame_SLIT3_ENST00000404867_chr5_168620483_-_ITPR2_ENST00000381340_chr12_26943160_-_10415nt
ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTGGCGCTGGCGAGCGTCCTGAGTGGGCCTCCA
GCCGTCGCCTGCCCCACCAAGTGTACCTGCTCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC
CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGACTTCGCTGGGCTCAAGAACCTCCGAGTCTTG
CATCTGGAAGACAACCAGGTCAGCGTCATCGAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAG
CTGCAAGTCCTTCCAGAATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTGTTAGTGGATGACAGATGTGTGGTGCACCCAGAGGCC
GGGGACCTTGCCAACCCTCCCAAGAAGTTCAGAGACTGCCTTTTCAAGGTGTGCCCTATGAACAGATATTCTGCCCAGAAGCAATATTGG
AAAGCAAAGCAAGCCAAACAAGGGAACCACACCGAGGCAGCCTTGCTGAAGAAACTACAGCACGCTGCAGAACTGGAACAAAAACAAAAT
GAATCGGAGAATAAGAAACTGTTGGGAGAAATTGTAAAATACAGTAATGTTATACAACTACTGCATATAAAAAGCAACAAATATCTTACT
GTCAACAAGAGATTACCTGCTTTACTGGAGAAGAATGCCATGCGTGTGTCCTTGGATGCTGCAGGAAATGAAGGGTCTTGGTTTTATATT
CATCCGTTCTGGAAACTGAGAAGCGAGGGTGACAATATTGTTGTAGGAGATAAAGTTGTTTTGATGCCTGTGAATGCAGGGCAGCCACTA
CATGCCAGCAACATAGAGCTTCTTGATAACCCAGGGTGTAAAGAGGTGAATGCTGTCAATTGCAACACCAGCTGGAAAATCACTTTATTC
ATGAAATATAGTTCCTATCGAGAGGATGTATTAAAAGGAGGGGACGTTGTTAGATTATTTCATGCGGAACAAGAGAAGTTTTTGACTTGT
GATGAATATGAGAAAAAACAGCACATTTTCCTTCGTACGACCTTGCGCCAATCAGCTACTTCTGCTACTAGTTCTAAAGCACTCTGGGAA
ATAGAGGTGGTTCATCATGACCCATGCCGTGGGGGTGCAGGACAGTGGAACAGCTTGTTCAGATTTAAGCATCTTGCAACTGGAAACTAT
TTAGCTGCAGAGCTTAATCCTGATTATCGAGATGCCCAAAATGAAGGAAAAAATGTGAGAGATGGAGTCCCTCCAACTTCAAAGAAAAAA
CGCCAGGCAGGGGAGAAGATCATGTATACTTTGGTTTCAGTCCCGCATGGCAATGACATTGCATCCCTTTTTGAACTAGATGCCACAACT
CTTCAGAGAGCTGACTGCCTGGTTCCAAGGAACTCATATGTTCGGTTAAGGCATTTATGCACCAACACATGGGTAACCAGTACTAGTATC
CCCATAGACACAGATGAAGAGAGGCCTGTTATGTTAAAGATTGGAACCTGCCAAACCAAAGAAGATAAAGAAGCGTTCGCAATCGTGTCT
GTTCCACTGTCTGAAGTTCGAGACTTAGACTTTGCCAATGATGCCAATAAAGTACTAGCGACCACAGTTAAAAAGCTAGAAAACGGCACA
ATAACTCAGAATGAAAGGAGGTTTGTAACCAAATTATTGGAAGATCTCATATTCTTTGTTGCTGATGTGCCTAATAATGGACAAGAAGTT
CTGGATGTGGTTATCACTAAGCCAAACCGAGAGCGTCAAAAATTGATGAGGGAACAAAACATACTGGCACAGGTATTTGGAATTCTTAAA
GCACCCTTTAAAGAGAAAGCAGGAGAAGGCTCGATGCTGAGACTTGAAGATCTGGGGGATCAAAGATATGCACCCTACAAGTACATGCTG
CGGCTCTGTTACCGCGTCCTGAGACACTCGCAGCAGGATTACCGGAAAAATCAGGAATATATTGCTAAGAATTTCTGTGTCATGCAGTCC
CAGATTGGCTATGATATTTTGGCAGAAGATACTATCACAGCTTTGTTGCACAACAACAGAAAACTACTAGAGAAACATATCACAGCAAAA
GAAATAGAAACATTTGTCAGTTTACTCAGGAGAAATCGGGAGCCAAGGTTTTTGGATTATTTGTCAGATCTGTGTGTGTCTAATACCACT
GCTATCCCTGTAACTCAAGAACTCATCTGTAAATTTATGTTGAGTCCAGGCAATGCAGACATTCTCATTCAAACTAAGGTGGTCTCAATG
CAAGCAGACAACCCCATGGAGAGCTCCATCCTTTCAGATGACATTGATGATGAAGAAGTTTGGCTCTATTGGATTGACAGCAACAAGGAA
CCTCATGGCAAAGCTATCAGGCACCTTGCTCAAGAGGCAAAAGAAGGCACCAAAGCTGACTTAGAAGTTCTTACCTATTACAGGTACCAG
CTAAACCTCTTTGCAAGGATGTGCTTGGATCGCCAGTATCTGGCCATAAACCAGATTTCTACACAGCTGTCTGTAGACCTGATCCTGCGG
TGTGTGTCGGATGAGAGCCTGCCGTTCGACCTCCGAGCGTCCTTCTGTCGCCTCATGCTCCACATGCACGTTGACCGGGATCCCCAGGAG
TCCGTGGTGCCTGTTCGCTATGCCAGGCTCTGGACAGAAATCCCCACAAAGATCACAATTCATGAATATGATTCTATAACAGACTCTTCC
AGAAATGATATGAAGAGGAAATTTGCCCTGACAATGGAATTTGTTGAAGAATATTTGAAAGAAGTTGTAAACCAGCCCTTTCCTTTTGGG
GATAAAGAAAAAAATAAACTGACATTTGAGGTGGTCCACTTGGCTCGGAATCTTATATACTTTGGATTTTATAGTTTCAGTGAGTTATTA
AGGCTAACAAGAACACTTCTGGCTATTTTAGACATTGTACAGGCCCCCATGTCATCATACTTTGAAAGATTAAGCAAATTTCAAGATGGA
GGAAACAATGTGATGAGAACCATTCATGGGGTGGGAGAGATGATGACCCAGATGGTACTCAGTAGAGGCTCCATCTTCCCCATGAGCGTG
CCGGATGTGCCACCCAGCATCCACCCGAGCAAGCAAGGGAGCCCCACCGAGCACGAGGATGTGACTGTGATGGACACCAAGCTGAAGATC
ATTGAGATTTTGCAGTTTATCCTGAGTGTCAGACTGGATTATAGGATCTCATATATGCTGTCAATATATAAGAAGGAGTTTGGAGAGGAC
AATGACAATGCGGAGACATCTGCCAGTGGATCTCCAGACACTTTACTACCATCAGCTATTGTTCCTGATATAGATGAAATTGCAGCTCAG
GCAGAAACTATGTTTGCGGGAAGAAAAGAAAAAAATCCAGTTCAACTTGACGATGAAGGAGGCAGGACGTTTTTACGGGTCCTCATTCAT
CTGATCATGCACGACTACCCGCCTTTGCTGTCTGGAGCCCTGCAGCTGTTGTTTAAGCACTTCAGCCAGAGGGCAGAGGTTTTACAGGCA
TTTAAGCAGGTGCAATTACTGGTGTCTAATCAAGACGTAGATAACTACAAGCAAATCAAGGCAGATCTAGACCAGCTTCGACTGACAGTA
GAAAAGTCTGAGCTATGGGTGGAGAAGAGCAGCAACTATGAGAATGGAGAAATAGGGGAAAGTCAAGTGAAAGGTGGTGAAGAGCCAATT
GAGGAATCAAACATTTTAAGTCCAGTGCAGGATGGAACAAAGAAACCTCAGATTGACAGCAACAAGAGCAATAACTACCGGATTGTAAAG
GAGATTTTGATCAGGCTAAGTAAACTCTGTGTGCAGAATAAAAAGTGTCGGAATCAACATCAACGATTACTGAAAAATATGGGGGCGCAT
TCGGTGGTGTTGGATCTTCTGCAGATACCCTATGAAAAGAATGATGAAAAGATGAATGAAGTAATGAATCTAGCCCATACATTTCTGCAG
AATTTCTGTCGAGGAAATCCACAGAATCAAGTTCTTCTTCATAAACATCTGAATTTGTTTTTAACTCCAGGTCTCCTTGAAGCAGAAACC
ATGCGGCACATCTTCATGAACAATTACCATCTGTGCAACGAAATTAGCGAGAGAGTTGTACAACACTTTGTGCACTGCATTGAGACACAT
GGCCGCCACGTGGAGTACCTGAGGTTTTTGCAAACAATTGTAAAAGCAGATGGTAAATATGTGAAGAAATGCCAGGATATGGTAATGACA
GAGTTGATAAATGGGGGTGAAGACGTGCTGATATTTTACAATGATAGAGCATCATTTCCAATCCTTCTCCATATGATGTGTTCAGAGAGA
GACCGAGGGGATGAGAGTGGCCCCTTAGCCTACCACATCACCCTGGTGGAGTTGCTGGCAGCATGCACAGAGGGGAAAAATGTCTACACT
GAAATCAAGTGTAATTCCCTTCTCCCGCTGGACGACATAGTGAGGGTGGTGACCCATGACGACTGCATCCCTGAGGTTAAAATTGCTTAT
GTGAACTTTGTTAATCACTGTTATGTTGACACTGAAGTGGAAATGAAAGAAATCTATACAAGTAACCACATTTGGAAATTATTTGAGAAC
TTCTTGGTGGATATGGCAAGGGTTTGCAACACAACTACAGACAGGAAACATGCAGACATCTTTTTGGAAAAGTGTGTTACTGAGTCAATA
ATGAATATTGTGAGCGGCTTCTTTAATTCTCCCTTTTCAGACAATAGTACCAGCCTCCAGACACATCAGCCAGTTTTTATTCAGCTACTG
CAATCTGCCTTCAGAATTTACAATTGCACCTGGCCAAACCCAGCGCAGAAAGCCTCAGTGGAATCCTGTATCAGAACTTTGGCTGAAGTG
GCAAAAAATCGTGGAATTGCCATTCCAGTGGATTTGGACAGCCAAGTTAATACTCTTTTCATGAAGAGCCATTCAAATATGGTGCAGAGA
GCAGCAATGGGTTGGAGACTATCAGCTCGCTCTGGGCCACGCTTTAAGGAAGCTCTTGGAGGGCCTGCTTGGGATTACAGAAATATTATT
GAAAAGTTACAGGATGTAGTGGCCTCCTTGGAGCACCAGTTCAGCCCAATGATGCAGGCTGAATTCTCAGTGTTGGTTGATGTATTGTAC
AGTCCAGAACTGCTGTTCCCTGAGGGAAGCGATGCAAGAATAAGATGTGGCGCTTTCATGTCGAAGTTGATTAATCATACAAAGAAACTA
ATGGAGAAAGAAGAAAAACTGTGCATTAAAATTCTTCAGACATTACGAGAAATGTTAGAGAAGAAAGACAGCTTTGTGGAAGAGGGTAAC
ACATTAAGAAAGATACTTCTGAATCGATACTTTAAAGGTGATTATAGTATTGGTGTGAATGGACACCTATCAGGAGCCTACTCCAAAACT
GCACAGGTGGGAGGAAGCTTTTCTGGACAAGATTCAGATAAGATGGGGATATCAATGTCAGACATTCAGTGTCTGCTGGATAAAGAAGGT
GCATCAGAACTTGTCATCGATGTTATAGTGAACACCAAAAATGACAGAATTTTTTCAGAAGGCATTTTCCTCGGCATTGCCTTGCTTGAA
GGAGGAAATACACAAACACAGTATTCTTTCTACCAGCAGTTGCATGAACAAAAAAAGTCAGAAAAATTCTTTAAAGTTCTCTATGATCGA
ATGAAGGCTGCTCAGAAAGAAATAAGATCAACAGTGACAGTTAATACCATAGATTTAGGTAACAAAAAAAGGGACGATGACAATGAATTG
ATGACATCTGGTCCACGAATGAGAGTAAGAGATTCAACACTACATTTAAAAGAGGGAATGAAAGGGCAATTAACAGAAGCTTCTTCAGCA
ACATCCAAAGCATATTGTGTATACAGAAGAGAAATGGATCCAGAAATAGACATTATGTGCACAGGACCAGAAGCGGGAAACACTGAGGAA
AAATCCGCAGAGGAAGTAACAATGAGTCCCGCAATTGCCATCATGCAGCCAATACTGAGATTTCTTCAGTTACTGTGTGAGAATCACAAC
CGGGAATTGCAGAACTTCTTGAGGAATCAAAACAACAAAACAAATTACAACCTAGTCTGTGAGACCCTTCAGTTTCTGGACTGCATTTGT
GGAAGTACAACCGGTGGCCTGGGCCTGTTGGGTCTCTACATCAATGAGAAGAATGTAGCGCTGGTCAACCAGAACCTGGAGAGCTTGACT
GAGTATTGCCAGGGCCCTTGCCATGAAAATCAGACCTGTATCGCTACACATGAGTCTAATGGGATTGATATCATCATTGCTTTGATTCTG
AATGACATAAACCCTCTTGGTAAATACCGAATGGACCTGGTGCTCCAGCTAAAGAACAATGCATCTAAACTTTTGCTGGCCATTATGGAA
AGCAGACATGACAGTGAGAATGCAGAAAGAATTCTTTTTAACATGAGACCCAGAGAACTGGTGGATGTGATGAAGAATGCCTATAACCAA
GGATTGGAATGTGACCATGGGGATGATGAGGGTGGAGATGATGGTGTTTCTCCAAAAGATGTTGGACACAATATCTATATTCTGGCCCAT
CAGTTGGCCCGCCACAATAAACTGTTGCAGCAGATGCTCAAACCAGGATCGGATCCAGATGAAGGAGATGAAGCCTTAAAGTATTATGCC
AACCACACTGCACAGATTGAGATTGTCCGGCATGATAGGACCATGGAACAAATAGTTTTTCCTGTCCCCAATATATGTGAATACCTCACT
CGAGAATCCAAGTGCCGTGTGTTCAATACAACTGAAAGGGATGAACAAGGAAGTAAAGTGAATGACTTTTTCCAGCAAACAGAAGATCTC
TACAATGAAATGAAGTGGCAGAAGAAAATCAGGAATAACCCTGCACTGTTCTGGTTCTCGAGGCACATCTCTCTCTGGGGGAGCATTTCC
TTCAACCTGGCTGTGTTCATCAATTTAGCTGTTGCTCTCTTCTACCCATTTGGGGATGATGGAGATGAAGGTACACTTTCTCCATTGTTC
TCGGTTCTTCTTTGGATAGCAGTTGCGATCTGCACATCTATGCTGTTTTTCTTCTCCAAGCCTGTGGGTATTCGGCCGTTTCTTGTATCA
ATAATGCTCAGATCAATATATACAATAGGTCTTGGGCCTACATTAATACTTCTTGGTGCAGCTAATCTTTGTAATAAAATTGTTTTTCTG
GTGAGTTTTGTTGGAAATCGTGGCACGTTCACCCGTGGGTACCGAGCAGTCATCCTGGATATGGCCTTTCTCTATCACGTGGCGTATGTC
CTGGTTTGCATGCTGGGCCTTTTTGTCCATGAATTCTTCTATAGCTTCCTGCTTTTTGATTTGGTGTACAGGGAAGAGACTTTGCTGAAT
GTCATAAAAAGTGTCACACGAAATGGCCGCTCTATTATTCTAACTGCAGTCCTGGCTCTCATCCTCGTCTACCTGTTTTCCATTATTGGG
TTCCTTTTTTTGAAGGATGACTTCACTATGGAAGTTGATAGGCTGAAAAACCGAACTCCTGTTACAGGCAGTCATCAAGTGCCTACTATG
ACTTTAACTACCATGATGGAAGCATGTGCCAAGGAGAACTGTTCACCCACAATTCCAGCTTCAAATACAGCTGATGAAGAGTATGAAGAT
GGAATTGAAAGGACGTGTGACACTCTCCTTATGTGCATTGTCACCGTGCTGAACCAGGGCCTCAGGAATGGCGGTGGTGTGGGGGATGTG
CTAAGAAGGCCATCGAAAGATGAGCCCTTGTTTGCTGCCCGAGTGGTTTATGACCTTCTTTTTTATTTCATTGTTATCATTATTGTTCTG
AACTTGATTTTTGGTGTTATCATCGATACTTTTGCTGATCTCAGAAGCGAAAAACAGAAAAAAGAAGAAATTCTAAAGACAACTTGTTTC
ATCTGTGGACTTGAGAGAGACAAGTTTGATAATAAAACGGTTTCATTTGAGGAGCACATTAAGTCAGAACACAATATGTGGCATTATTTG
TACTTCATAGTCCTGGTGAAAGTTAAAGACCCAACAGAATACACTGGACCTGAAAGTTATGTGGCTCAAATGATTGTGGAGAAGAATTTG
GATTGGTTTCCTCGGATGCGAGCCATGTCCCTCGTTAGCAATGAAGGCGACAGTGAGCAAAATGAAATTCGGAGCCTTCAGGAGAAGTTG
GAATCGACCATGAGTCTGGTCAAACAGCTGTCGGGTCAGCTGGCGGAGCTCAAGGAGCAGATGACAGAACAAAGGAAGAATAAGCAGAGA
CTGGGCTTCCTCGGATCAAACACACCCCATGTGAATCATCACATGCCACCACACTGATACCATGGGGGGAAGCCGTGACTAGCCTTTCAT
CAGTGTCCTGCCTGATCACTGAATAAAGAACTGAGATGGAGGGGAGTGAACAGTGCCTATTGTTGAAAAGTTAAAAACAACCAAGTGCCA
AGATGTTGAGTGGGTTAGCTCCGAGAACAATTTATAACTGTGTTTTCATGGTTGCGAAGACCTAACCTCAAATGCATCTGCTAGAAAGCG
TACATCACACATTCGCAATGCATCAGGAAGAAAAGGCTTGCCCAAAAGGCTGGAGAGGGCAGGGAGCGGCAGGATGGAAGGAGACACGGG
GCAGGGAGAACTCTCTTCTGCTAAATCGATAGGAGTCAGTTTTGTCTTAAATGCTGACTACAGCCACTGACATGGTTGGCTGGAATTTCT
TTCTTTTAATTGTGGCATATAGGTTTGTGACACAAGAAGTCATACTTTGGTGGCTAAGTTTTACTAAGGAAAATAACTGAAAAGATTAAA
AGTGAGAGCTGAAAAGAGAAATGATAATGCTTCCAAACTGTAGCTGTCACAGGGCAATTTCTTTATTTATAACATGAAGCACAATGGATT
TACAGCTCTAGGAACTTAGTACTTTGGAGCTTTTGCCTCTCACACTGACAACATAACAGGATGTGATTGCCTTCTCTGGGATTCAGACAG
GCTCTGTCAATGTGGAGCACAAAAGGAGATTTTCATATAACTTGTTAAAAACATGTTCTAAGTCATGTATAGGCTAAGATTTTAAGAAGA
TCTGGGGGAATAAAAAGCCAACAGTAAGCCCCAGGAAAGGGTTTTTTGAGACCATATGTATGCTATTAAAATATATTGAGATTAATACAT
GAAAATGCTTAAAAGTGATAGGAATTATTGAGAAACTTATGATGGTGGCATTGCCTTTTATAAACATGGAGTGAAAGCCATTTGACTCAA
CGTTTGCTGTGCTTAAAGAATTGCTTCAGGACCCGAGCGTTTTTATGTATGCTGTTCCTGCAGTTAGGAAAAAAAAATCCAAGAAATGTA
TTGAATACTCAAGAAAATGCCACATTTCAATTACATATTTAAAACTGTATCTGTAAGGGCTTTTCAAAATGTAGCAAGATAAAAATCTCT
TATTCAAATTGTTTTTGTATTAAATCATGCACTCAGAATTTGTCGAGGGAGAGAATAACCTGGTGTGTTCAGGTTATTCTTAGAGACTAC
ACATTTGGAATAGCAGAGCAAAATATGGATAATGAAAGTGTTGGGAAAAAAGTGATGTGACAGGGAGTGAAGACACTTGATACCAGACTC
TGGGAGATACTCTGCAAGTTGACCTGGCCTCTCCCCCACAGGAACAAAACACTGCCTCCAGAGTCTTTAAATTCTCAGTTATCAACGCCA
AGGTTTAAGGTCTAGATAGGGTTTGCTATAGGGTTTGCTCTGACAATTTTTAAAGCTTTTGGATTGTTCTAACATAGCTTAAGCTATTGG
TTCCTAAAAATCCCAAATCAAGATCTATGTAGAATATAAAGGAAGCCTGAACCAATCCTTCCACATACTGTTAAGATGTAGACTTGGAAC
AAAGCTGTTGGGACCCAGAGCAATGAATTTTTGAACTGAAGCTACTGGTACTCCCCAGCACCACCTCATACTAAGAATTCCTCACTCTGA
CATGACAGTATTTTTTCTGACCAGGAGCTGAAAGACCCTGACATTCATGATCCAAAGATATAAGAAATTTTGATATGTCTGCATGCAGCA
CAGAACTTTGAACCTAGGAGGCAGTCAATAAATACATGAGAAATTCAGCTGTCATTCAGTTACTCTTAATTCTTTATAAAACTTTAAATG
ATACCACATATTTGTTTGTTTAAAATGGCTTTCCCAAAATCAAAGTAGACTAAAGCAGCCATCTTTAAAATCCAGGATCATCAATGCTAT


Top

FusionGenePPI for SLIT3_ITPR2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SLIT3CAPN1, OTUB1ITPR2TRPC4, NXF1, CCDC8, CA8, CACNG2, P2RY12, TESPA1, BBOX1, PSMC3, LPAR1, HERC2, CAPZA2, MYH9, NUP107, CTDNEP1, RAB29, L3MBTL2, FAM19A4, ZNRF4, CHRNA3, IPPK


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SLIT3_ITPR2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SLIT3_ITPR2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSLIT3C0019284Diaphragmatic Hernia1CTD_human
HgeneSLIT3C0036341Schizophrenia1PSYGENET
HgeneSLIT3C0041696Unipolar Depression1PSYGENET
HgeneSLIT3C1269683Major Depressive Disorder1PSYGENET
TgeneITPR2C0018800Cardiomegaly1CTD_human
TgeneITPR2C1527348Brain Hypoxia1CTD_human
TgeneITPR2C1862871ANHIDROSIS, ISOLATED, WITH NORMAL SWEAT GLANDS1ORPHANET;UNIPROT