FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 345

FusionGeneSummary for ACAP2_APOD

check button Fusion gene summary
Fusion gene informationFusion gene name: ACAP2_APOD
Fusion gene ID: 345
HgeneTgene
Gene symbol

ACAP2

APOD

Gene ID

23527

347

Gene nameArfGAP with coiled-coil, ankyrin repeat and PH domains 2apolipoprotein D
SynonymsCENTB2|CNT-B2-
Cytomap

3q29

3q29

Type of geneprotein-codingprotein-coding
Descriptionarf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2Arf GAP with coiled coil, ANK repeat and PH domains 2centaurin-beta-2apolipoprotein Dapo-D
Modification date2018052320180523
UniProtAcc

Q15057

P05090

Ensembl transtripts involved in fusion geneENST00000326793, ENST00000472860, 
ENST00000343267, 
Fusion gene scores* DoF score9 X 7 X 10=6303 X 3 X 3=27
# samples 133
** MAII scorelog2(13/630*10)=-2.27684020535882
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ACAP2 [Title/Abstract] AND APOD [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAPOD

GO:0000302

response to reactive oxygen species

18419796

TgeneAPOD

GO:0006006

glucose metabolic process

19176353

TgeneAPOD

GO:0006629

lipid metabolic process

19176353

TgeneAPOD

GO:0010642

negative regulation of platelet-derived growth factor receptor signaling pathway

14551159

TgeneAPOD

GO:0042308

negative regulation of protein import into nucleus

14551159

TgeneAPOD

GO:0048662

negative regulation of smooth muscle cell proliferation

14551159

TgeneAPOD

GO:0060588

negative regulation of lipoprotein lipid oxidation

18419796

TgeneAPOD

GO:0071638

negative regulation of monocyte chemotactic protein-1 production

18842892

TgeneAPOD

GO:1900016

negative regulation of cytokine production involved in inflammatory response

18842892

TgeneAPOD

GO:2000405

negative regulation of T cell migration

18842892


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVOVTCGA-24-2262-01AACAP2chr3

195101738

-APODchr3

195300842

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000326793ENST00000343267ACAP2chr3

195101738

-APODchr3

195300842

-
intron-3CDSENST00000472860ENST00000343267ACAP2chr3

195101738

-APODchr3

195300842

-

Top

FusionProtFeatures for ACAP2_APOD


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ACAP2

Q15057

APOD

P05090

GTPase-activating protein (GAP) for ADP ribosylationfactor 6 (ARF6). {ECO:0000269|PubMed:11062263}. APOD occurs in the macromolecular complex with lecithin-cholesterol acyltransferase. It is probably involved in thetransport and binding of bilin. Appears to be able to transport avariety of ligands in a number of different contexts.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-4231_22695779DomainNote=BAR
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423266_36195779DomainPH
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423399_52095779DomainArf-GAP
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423640_66995779RepeatNote=ANK 1
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423673_70295779RepeatNote=ANK 2
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423706_73595779RepeatNote=ANK 3
HgeneACAP2chr3:195101738chr3:195300842ENST00000326793-423414_43795779Zinc fingerC4-type


Top

FusionGeneSequence for ACAP2_APOD


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_APOD_ENST00000343267_chr3_195300842_-_244aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFMNGIRDLAQTSSNDAVVETSLTKFSDSLQEM
INFHTTLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_APOD_ENST00000343267_chr3_195300842_-_732nt
ATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGACTCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAA
TTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATTGCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATG
AATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGATGCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATG
ATAAATTTTCACACATATCTCGGAAGATGGTACGAAATTGAGAAGATCCCAACAACCTTTGAGAATGGACGCTGCATCCAGGCCAACTAC
TCACTAATGGAAAACGGAAAGATCAAAGTGTTAAACCAGGAGTTGAGAGCTGATGGAACTGTGAATCAAATCGAAGGTGAAGCCACCCCA
GTTAACCTCACAGAGCCTGCCAAGCTGGAAGTTAAGTTTTCCTGGTTTATGCCATCGGCACCGTACTGGATCCTGGCCACCGACTATGAG
AACTATGCCCTCGTGTATTCCTGTACCTGCATCATCCAACTTTTTCACGTGGATTTTGCTTGGATCTTGGCAAGAAACCCTAATCTCCCT
CCAGAAACAGTGGACTCTCTAAAAAATATCCTGACTTCTAATAACATTGATGTCAAGAAAATGACGGTCACAGACCAGGTGAACTGCCCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_ACAP2_ENST00000326793_chr3_195101738_-_APOD_ENST00000343267_chr3_195300842_-_1161nt
CGTTTCCCTGCGGCCAGCGCTCTACTTGGGGCGGGAGGAAGAGGGGCGGGACTGGGGCCTGACTAGTCGTCGCCGTCTTCGCGGCTGCTA
TGACCAGCGGGCGAGGCGCCCTTCGCAGCTCCGCGCAACGCTAGTCGCGGCCGTGCGCCCGCCGTAGCCGTCTGCGTCCCAGCGCGGCCG
CTCCCGCGGCCCCCTCGGCTTTGCCAGCGCCGCCTGCGAGGCGGAGGCAGGATGAAGATGACTGTGGATTTCGAGGAGTGTCTGAAGGAC
TCGCCCCGCTTCAGGGCAGCTTTGGAAGAAGTAGAAGGTGATGTGGCAGAATTGGAACTAAAACTTGATAAGCTTGTGAAACTTTGTATT
GCAATGATTGATACTGGAAAAGCCTTTTGTGTTGCAAATAAACAGTTCATGAATGGGATTCGAGACCTGGCTCAGTATTCTAGTAATGAT
GCTGTCGTTGAGACAAGTTTGACCAAGTTTTCTGACAGTCTTCAAGAAATGATAAATTTTCACACATATCTCGGAAGATGGTACGAAATT
GAGAAGATCCCAACAACCTTTGAGAATGGACGCTGCATCCAGGCCAACTACTCACTAATGGAAAACGGAAAGATCAAAGTGTTAAACCAG
GAGTTGAGAGCTGATGGAACTGTGAATCAAATCGAAGGTGAAGCCACCCCAGTTAACCTCACAGAGCCTGCCAAGCTGGAAGTTAAGTTT
TCCTGGTTTATGCCATCGGCACCGTACTGGATCCTGGCCACCGACTATGAGAACTATGCCCTCGTGTATTCCTGTACCTGCATCATCCAA
CTTTTTCACGTGGATTTTGCTTGGATCTTGGCAAGAAACCCTAATCTCCCTCCAGAAACAGTGGACTCTCTAAAAAATATCCTGACTTCT
AATAACATTGATGTCAAGAAAATGACGGTCACAGACCAGGTGAACTGCCCCAAGCTCTCGTAACCAGGTTCTACAGGGAGGCTGCACCCA
CTCCATGTTACTTCTGCTTCGCTTTCCCCTACCCCCCCCCCATAAAGACAAACCAATCAACCACGACAAAGGAAGTTGACCTGAACATGT


Top

FusionGenePPI for ACAP2_APOD


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ACAP2SMURF1, HSPB1, RAB11FIP3, MED4, PDK3, SOAT1, NDUFS1, NDUFA9, PIGS, MBOAT7, EHBP1, GDI1, GPAA1, CYLDAPODSTK24, POLR2M, APOD, APOA2, CUL2, CDK2, SHBG, ESR1, APOA1, CDK19, VAPA, RPE, HAX1, DPPA4, SUMF2, RNF126, CREB3, ATF6, ATP2B2, DHX57, KIAA0355, ARHGAP36, ALCAM, EFEMP1, MAZ, MTMR9, VNN2, GK, ZIC1, GPR3, TSNARE1, CYR61, RNASE13, SERPINE2, SLC35C1, PVRL2, TOR1A, FAM60A, FCRL1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ACAP2_APOD


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneAPODP05090DB00162Vitamin AApolipoprotein Dsmall moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for ACAP2_APOD


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAPODC0036341Schizophrenia3PSYGENET
TgeneAPODC0005586Bipolar Disorder1PSYGENET
TgeneAPODC0017638Glioma1CTD_human
TgeneAPODC0023186Learning Disorders1CTD_human
TgeneAPODC0086439Hypokinesia1CTD_human
TgeneAPODC0524851Neurodegenerative Disorders1CTD_human