FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33749

FusionGeneSummary for SHB_PAX5

check button Fusion gene summary
Fusion gene informationFusion gene name: SHB_PAX5
Fusion gene ID: 33749
HgeneTgene
Gene symbol

SHB

PAX5

Gene ID

6461

5079

Gene nameSH2 domain containing adaptor protein Bpaired box 5
SynonymsbA3J10.2ALL3|BSAP
Cytomap

9p13.1

9p13.2

Type of geneprotein-codingprotein-coding
DescriptionSH2 domain-containing adapter protein BSHB (Src homology 2 domain containing) adaptor protein BSHB adaptor protein (a Src homology 2 protein)Src homology 2 domain containing adaptor protein Bpaired box protein Pax-5B-cell lineage specific activatorpaired box homeotic gene 5paired domain gene 5transcription factor PAX 5
Modification date2018052320180520
UniProtAcc

Q15464

Q02548

Ensembl transtripts involved in fusion geneENST00000377707, ENST00000377700, 
ENST00000358127, ENST00000523241, 
ENST00000520154, ENST00000377852, 
ENST00000377853, ENST00000522003, 
ENST00000520281, ENST00000414447, 
ENST00000523145, ENST00000446742, 
ENST00000377847, 
Fusion gene scores* DoF score12 X 7 X 8=6727 X 5 X 5=175
# samples 137
** MAII scorelog2(13/672*10)=-2.36994960975031
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/175*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SHB [Title/Abstract] AND PAX5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-22-4609-01ASHBchr9

38016008

-PAX5chr9

37020798

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377707ENST00000358127SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377707ENST00000523241SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377707ENST00000520154SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377707ENST00000377852SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377707ENST00000377853SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000522003SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000520281SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000414447SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000523145SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000446742SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377707ENST00000377847SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377700ENST00000358127SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377700ENST00000523241SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377700ENST00000520154SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377700ENST00000377852SHBchr9

38016008

-PAX5chr9

37020798

-
In-frameENST00000377700ENST00000377853SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000522003SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000520281SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000414447SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000523145SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000446742SHBchr9

38016008

-PAX5chr9

37020798

-
5CDS-intronENST00000377700ENST00000377847SHBchr9

38016008

-PAX5chr9

37020798

-

Top

FusionProtFeatures for SHB_PAX5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SHB

Q15464

PAX5

Q02548

Adapter protein which regulates several signaltransduction cascades by linking activated receptors to downstreamsignaling components. May play a role in angiogenesis byregulating FGFR1, VEGFR2 and PDGFR signaling. May also play a rolein T-cell antigen receptor/TCR signaling, interleukin-2 signaling,apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 andIRS2 signaling in insulin-producing cells.{ECO:0000269|PubMed:10828022, ECO:0000269|PubMed:10837138,ECO:0000269|PubMed:12084069, ECO:0000269|PubMed:12464388,ECO:0000269|PubMed:12520086, ECO:0000269|PubMed:15026417,ECO:0000269|PubMed:15919073, ECO:0000269|PubMed:8806685,ECO:0000269|PubMed:9484780, ECO:0000269|PubMed:9751119}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePAX5chr9:38016008chr9:37020798ENST00000358127-01016_14215392DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000377847-0816_14215329DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000377852-0916_14215358DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000377853-0916_14215363DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000414447-0916_14215349DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000446742-0816_14215292DomainPaired
TgenePAX5chr9:38016008chr9:37020798ENST00000520281-0816_14215320DomainPaired

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSHBchr9:38016008chr9:37020798ENST00000377700-23410_504279298DomainSH2
HgeneSHBchr9:38016008chr9:37020798ENST00000377707-26410_504279510DomainSH2


Top

FusionGeneSequence for SHB_PAX5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_656aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD
MKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQTSSYNDSWRFPNPGLL

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_589aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQGVSFPGVPTATLSIPR

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_560aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQAPPTIIALPPEEPPHL

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_622aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_627aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_656aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD
MKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQTSSYNDSWRFPNPGLL

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_589aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQGVSFPGVPTATLSIPR

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_560aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQAPPTIIALPPEEPPHL

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_622aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_627aa
MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSAASASCGPATASCFSASSGSLPDDSGSTSDLIRAYRAQKER
DFEDPYNGPGSSLRKLRAMCRLDYCGGSGEPGGVQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGGAGDPLGGACAGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYME
PTEAQRIMTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRTTETGSIKPGVIGGSKPKVATPKVV
EKIAETKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILG
ITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTETSAMASLAGGLDD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_1968nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGAC
TTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTG
CCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTT

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_1767nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGT
ACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAG

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_1680nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTG

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_1866nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGGAGTGAG
TTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTAC

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_1881nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGAC
TTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTG

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_1968nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGAC
TTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTG
CCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTT

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_1767nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGT
ACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAG

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_1680nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTG

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_1866nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGGAGTGAG
TTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTAC

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_1881nt
ATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGCCGCCGCGGCCAGACTACCGCGAGCAG
CGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCTCGGCGTCCTGCGGTCCGGCCACCGCC
TCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCCGCGCCTACCGCGCGCAGAAGGAGCGA
GACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCCTGGACTACTGCGGCGGCAGCGGGGAG
CCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCGCCTCCTCGGGCGCGGGGGCCGCCGCG
TCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCACGCCGGCCGAGGTGCGCTACATCTCC
CCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGGGCGCCTGCGCGGGCGGCCGCACCTGG
AGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGAGCGGGGCCGGCAAGAAGGACAAGGTG
ACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAAAGGGGGAGAGTGCTGGCTACATGGAG
CCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTGTGAATGGACGGCCACTCCCGGATGTA
GTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGCTTCGGGTCAGCCATGGTTGTGTCAGC
AAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAACCAAAGGTCGCCACACCCAAAGTGGTG
GAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGCTGCTGGCAGAGCGGGTGTGTGACAAT
GACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCAACCAACCAGTCCCAGCTTCCAGTCAC
AGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGTCGTACTCCATCAGCGGCATCCTGGGC
ATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGGTGCCGAACGGCCACTCGCTTCCGGGC
AGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGGACCGCGTGTTTGAGAGGCAGCACTAC
TCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGAC
ATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGAC
TTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_9819nt
GCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCCTC
CGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCCCG
GCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCTCG
GACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGGCG
GAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCGCC
CCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCCGC
GCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGC
CGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCT
CGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCC
GCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCC
TGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCG
CCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCA
CGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGG
GCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGA
GCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAA
AGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTG
TGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGC
TTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAAC
CAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCA
ACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGT
CGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGG
TGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGG
ACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGG
CCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGT
CCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACT
CAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCT
GGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCT
ATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAG
CCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTT
GGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAA
TAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCCTG
GGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGACTGAGAAGACT
GCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCTGGGTGACCCTG
GCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTAGTATCTTTACG
AGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTCCTGGTTTCCTG
CCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGATTCCTCAGCTAC
TTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGATCATCTGATCC
CAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGGTCACTTCGGAC
ACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACAATAATTAACAC
AGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCCCGTCCTCGTGG
AGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTGATCTAAGGGGC
CGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGTCAGAGGAAGCC
AGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTGGGAGTGATTTT
GACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAACAGCCAGGTAGA
GCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTGTATGTCACCAG
GATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACATGTCTTTGCTG
TGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCACAGCTCTTTCC
TTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGGGGGTGGGCACC
TGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGACCTAGCCCAACT
TCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACCGCTAAGTATTT
TGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGACTGGTGGGGGTG
GGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAGGAGAGTTGACA
GTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCACCCAGGCCAGGG
ATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGTTGGGGCCAGAG
TCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCATCTCTCTCCCTG
CCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCTTCTTTTGGAAT
GATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAGCTGCCTGAGGC
ATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGTAATGAGCTCCC
CCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCCTGGGCTGCCAG
GCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCGTGGTCCAGCGG
AGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAACACAAGTCCGG
GGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTGGAAAAGGACAT
TGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACATCCCTTTCCCAA
GGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAAGAGCATGATGC
CTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGCCCCATTCTCTC
TCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAGACCCACAATCA
GGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTGAAACCTGCGGA
GTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTATCAGAGTCAAT
TCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCATGTGCTGTCCCC
CACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAGGGCCACCAGGG
TGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTAGCCTTGCCACT
CGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAAGTATGAAAACT
TGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAATGCCTGTCAAT
TGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCTTCAGGGTGTCC
AGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGCGCTTTGAAGAT
GGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTGGGCACCTTTCA
CATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAACGACTGCCCAG
CCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATCTTAAAAACCAA
CCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTTCCCGGGAGGGT
GGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGGCTCCACGGTGG
CCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACCAGCTCTCCTGG
GGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTATTGGAAAGTTG
GACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCCAAACCTCAGGG
TTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGGCGCCAGGTCCC
AAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAGCTGCCGGCCAG
GAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGATTGAAGGGAACC
TCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAGCCACCATTCAG
AAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATATCTACTGAGGG
ACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCACCCACCCATCAG
CTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTCCTCCCCGACTC
TGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGGCCGCTGGTCGC
CCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGGATGATGGATTT
TTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGAATACATTTTAA
TGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGCTAAAAAGAAAA
TAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCACGAGCATGTAA
ACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAACAGCACTGAGT
CTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGGGCTCAGGAAGA
GGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCCCACTTCTCAGC
CCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGCTGCCCTGGTTT
TTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAGACACATGCATT
TTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTATCCGCCAAAGT
TTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCACAATTGAATTGC
CTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATTCTTTTTTTCTA
GTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAATGTAATTACAG
CAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAGAAAACAGGGGT
GGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGGTTGACTGCAAC
ACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGGCTGTTACTTGT
GAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATAAAAGTAATTTT

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_2690nt
GCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCCTC
CGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCCCG
GCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCTCG
GACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGGCG
GAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCGCC
CCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCCGC
GCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGC
CGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCT
CGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCC
GCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCC
TGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCG
CCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCA
CGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGG
GCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGA
GCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAA
AGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTG
TGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGC
TTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAAC
CAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCA
ACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGT
CGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGG
TGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGG
ACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGGAGTGAGTTTTCCGGGAGTCC
CTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGC
CGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACC
TATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCC
CCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTAT
GAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAG

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_2603nt
GCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCCTC
CGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCCCG
GCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCTCG
GACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGGCG
GAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCGCC
CCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCCGC
GCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGC
CGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCT
CGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCC
GCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCC
TGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCG
CCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCA
CGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGG
GCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGA
GCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAA
AGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTG
TGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGC
TTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAAC
CAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCA
ACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGT
CGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGG
TGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGG
ACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGCTCCCCCTACTATTATAGCGC
TGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGC
ACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGC
TCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATC
TATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTC

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_2820nt
GCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCCTC
CGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCCCG
GCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCTCG
GACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGGCG
GAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCGCC
CCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCCGC
GCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGC
CGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCT
CGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCC
GCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCC
TGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCG
CCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCA
CGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGG
GCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGA
GCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAA
AGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTG
TGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGC
TTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAAC
CAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCA
ACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGT
CGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGG
TGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGG
ACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGG
CCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGT
CCTACCCCATTGTGACAGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCA
ACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACT
GACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCA
TGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTT
GGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTG
CAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAGCT

>In-frame_SHB_ENST00000377707_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_2835nt
GCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCCTC
CGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCCCG
GCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCTCG
GACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGGCG
GAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCGCC
CCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCCGC
GCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCAGC
CGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGCCT
CGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCATCC
GCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCGCC
TGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTGCG
CCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGCCA
CGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGGGG
GCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGAGA
GCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGGAA
AGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTTTG
TGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCAGC
TTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAAAC
CAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCGGC
TGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACCCA
ACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTCGT
CGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCCGG
TGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCTGG
ACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCATGG
CCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGT
CCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACT
CAGCACCGACGCTGACAGGGATGGTGCCTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTG
CCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGA
TAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCC
TTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAAC
CAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGC

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000358127_chr9_37020798_-_9821nt
GCGCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCC
TCCGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCC
CGGCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCT
CGGACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGG
CGGAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCG
CCCCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCC
GCGCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCA
GCCGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGC
CTCGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCAT
CCGCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCG
CCTGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTG
CGCCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGC
CACGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGG
GGGCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGA
GAGCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGG
AAAGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCAT
GGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCA
GTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTA
CTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTC
CTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGC
CTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGAT
AGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCT
TTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACC
AATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCC
TGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGACTGAGAAGA
CTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCTGGGTGACCC
TGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTAGTATCTTTA
CGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTCCTGGTTTCC
TGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGATTCCTCAGCT
ACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGATCATCTGAT
CCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGGTCACTTCGG
ACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACAATAATTAAC
ACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCCCGTCCTCGT
GGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTGATCTAAGGG
GCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGTCAGAGGAAG
CCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTGGGAGTGATT
TTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAACAGCCAGGTA
GAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTGTATGTCACC
AGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACATGTCTTTGC
TGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCACAGCTCTTT
CCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGGGGGTGGGCA
CCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGACCTAGCCCAA
CTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACCGCTAAGTAT
TTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGACTGGTGGGGG
TGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAGGAGAGTTGA
CAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCACCCAGGCCAG
GGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGTTGGGGCCAG
AGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCATCTCTCTCCC
TGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCTTCTTTTGGA
ATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAGCTGCCTGAG
GCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGTAATGAGCTC
CCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCCTGGGCTGCC
AGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCGTGGTCCAGC
GGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAACACAAGTCC
GGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTGGAAAAGGAC
ATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACATCCCTTTCCC
AAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAAGAGCATGAT
GCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGCCCCATTCTC
TCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAGACCCACAAT
CAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTGAAACCTGCG
GAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTATCAGAGTCA
ATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCATGTGCTGTCC
CCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAGGGCCACCAG
GGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTAGCCTTGCCA
CTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAAGTATGAAAA
CTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAATGCCTGTCA
ATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCTTCAGGGTGT
CCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGCGCTTTGAAG
ATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTGGGCACCTTT
CACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAACGACTGCCC
AGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATCTTAAAAACC
AACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTTCCCGGGAGG
GTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGGCTCCACGGT
GGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACCAGCTCTCCT
GGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTATTGGAAAGT
TGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCCAAACCTCAG
GGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGGCGCCAGGTC
CCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAGCTGCCGGCC
AGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGATTGAAGGGAA
CCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAGCCACCATTC
AGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATATCTACTGAG
GGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCACCCACCCATC
AGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTCCTCCCCGAC
TCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGGCCGCTGGTC
GCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGGATGATGGAT
TTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGAATACATTTT
AATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGCTAAAAAGAA
AATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCACGAGCATGT
AAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAACAGCACTGA
GTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGGGCTCAGGAA
GAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCCCACTTCTCA
GCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGCTGCCCTGGT
TTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAGACACATGCA
TTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTATCCGCCAAA
GTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCACAATTGAATT
GCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATTCTTTTTTTC
TAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAATGTAATTAC
AGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAGAAAACAGGG
GTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGGTTGACTGCA
ACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGGCTGTTACTT
GTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATAAAAGTAATT

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000523241_chr9_37020798_-_2692nt
GCGCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCC
TCCGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCC
CGGCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCT
CGGACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGG
CGGAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCG
CCCCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCC
GCGCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCA
GCCGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGC
CTCGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCAT
CCGCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCG
CCTGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTG
CGCCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGC
CACGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGG
GGGCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGA
GAGCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGG
AAAGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGGAGTGAGTTTTCCGGGAGT
CCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCT
GCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCA
CCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCT
CCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCT
ATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCC

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000520154_chr9_37020798_-_2605nt
GCGCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCC
TCCGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCC
CGGCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCT
CGGACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGG
CGGAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCG
CCCCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCC
GCGCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCA
GCCGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGC
CTCGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCAT
CCGCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCG
CCTGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTG
CGCCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGC
CACGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGG
GGGCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGA
GAGCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGG
AAAGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGGCTCCCCCTACTATTATAGC
GCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATG
GCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAA
GCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAA
TCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCC

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377852_chr9_37020798_-_2822nt
GCGCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCC
TCCGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCC
CGGCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCT
CGGACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGG
CGGAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCG
CCCCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCC
GCGCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCA
GCCGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGC
CTCGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCAT
CCGCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCG
CCTGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTG
CGCCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGC
CACGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGG
GGGCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGA
GAGCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGG
AAAGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCAT
GGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCA
GTCCTACCCCATTGTGACAGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCC
CAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCA
CTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCC
CATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCG
TTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCC
TGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAG

>In-frame_SHB_ENST00000377700_chr9_38016008_-_PAX5_ENST00000377853_chr9_37020798_-_2837nt
GCGCCGCCGGGACGGGCACGGGCGCGCGGGCTCCGGCGGGCGCCGGCTGCCTTCCTCCGTCGCTCGCTGTCTCTCCCGGCCGCATTCTCC
TCCGCTGCGGGGCCGAGCTCTCCCCAGCGCTCGCAGGAAGGAAGAAGGGAGCCGAGGACGCCGAGAAGTTCCCGCGGCAGCCGCGGATCC
CGGCCAAGGCGGAGGCTGCGGCTCCGACGGGGCAGGAGCGCGATCCACGGCGAGGGGCGTACGGCCAAAGGGTCCGCGGCGTGGAGCGCT
CGGACCTTCCGCTCTCCCCCGGGCGTGGGCCGGGACCCCATGAGACGCGCCCACGAGGGGCGCGAGATTCCTAGCTTGGGCGGCGCTAGG
CGGAGGGAGGTGTTGCAGCCGCCGGAGCCAGAGAGCTGCCGGCAGGAGGCGGCGGCGGCAAGAACTTGAACTTGGCGTCGGGAGCGGGCG
CCCCGGACGCCCCCCGCCGGGGCCGGGGCGCCGAGGGACCTGCGCCGCAGCGCTGCCCCCCGAATGGCCGCGGCGGCGGACCGGGCTCCC
GCGCCGCGGCCCTAGGCGGCCTCTCGCCATGGCCAAGTGGCTAAACAAGTACTTCAGCTTGGGCAACAGCAAGACCAAGAGCCCCCCGCA
GCCGCCGCGGCCAGACTACCGCGAGCAGCGGCGCCGAGGCGAGCGGCCTTCGCAGCCCCCCCAGGCCGTGCCGCAGGCCTCCTCCGCCGC
CTCGGCGTCCTGCGGTCCGGCCACCGCCTCCTGCTTCTCAGCCTCTTCGGGCTCGCTGCCCGACGACAGCGGCAGCACCAGCGACCTCAT
CCGCGCCTACCGCGCGCAGAAGGAGCGAGACTTCGAGGACCCCTACAACGGGCCTGGCTCGTCGCTGCGCAAACTGCGCGCCATGTGCCG
CCTGGACTACTGCGGCGGCAGCGGGGAGCCAGGCGGGGTCCAGCGCGCCTTCTCGGCCTCGTCCGCGTCGGGCGCCGCGGGCTGTTGCTG
CGCCTCCTCGGGCGCGGGGGCCGCCGCGTCCTCGTCCTCGTCCTCCGGCTCTCCGCATCTCTACCGCAGCAGCAGCGAGCGGCGGCCCGC
CACGCCGGCCGAGGTGCGCTACATCTCCCCCAAGCACCGCCTCATCAAAGTGGAGAGCGCCGCGGGCGGTGGGGCCGGGGACCCCCTGGG
GGGCGCCTGCGCGGGCGGCCGCACCTGGAGCCCGACGGCCTGCGGAGGCAAGAAACTGCTCAACAAGTGCGCCGCCTCAGCCGCGGAGGA
GAGCGGGGCCGGCAAGAAGGACAAGGTGACCATAGCCGATGACTACTCAGATCCCTTTGATGCCAAGAATGATCTCAAGAGCAAAGCAGG
AAAGGGGGAGAGTGCTGGCTACATGGAGCCCTATGAGGCACAGAGGATCATGACAGGACATGGAGGAGTGAATCAGCTTGGGGGGGTTTT
TGTGAATGGACGGCCACTCCCGGATGTAGTCCGCCAGAGGATAGTGGAACTTGCTCATCAAGGTGTCAGGCCCTGCGACATCTCCAGGCA
GCTTCGGGTCAGCCATGGTTGTGTCAGCAAAATTCTTGGCAGGTATTATGAGACAGGAAGCATCAAGCCTGGGGTAATTGGAGGATCCAA
ACCAAAGGTCGCCACACCCAAAGTGGTGGAAAAAATCGCTGAATATAAACGCCAAAATCCCACCATGTTTGCCTGGGAGATCAGGGACCG
GCTGCTGGCAGAGCGGGTGTGTGACAATGACACCGTGCCTAGCGTCAGTTCCATCAACAGGATCATCCGGACAAAAGTACAGCAGCCACC
CAACCAACCAGTCCCAGCTTCCAGTCACAGCATAGTGTCCACTGGCTCCGTGACGCAGGTGTCCTCGGTGAGCACGGATTCGGCCGGCTC
GTCGTACTCCATCAGCGGCATCCTGGGCATCACGTCCCCCAGCGCCGACACCAACAAGCGCAAGAGAGACGAAGGTATTCAGGAGTCTCC
GGTGCCGAACGGCCACTCGCTTCCGGGCAGAGACTTCCTCCGGAAGCAGATGCGGGGAGACTTGTTCACACAGCAGCAGCTGGAGGTGCT
GGACCGCGTGTTTGAGAGGCAGCACTACTCAGACATCTTCACCACCACAGAGCCCATCAAGCCCGAGCAGACCACAGAGTATTCAGCCAT
GGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCA
GTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTA
CTCAGCACCGACGCTGACAGGGATGGTGCCTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCAC
TGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCTCCTGAA
GATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTCTGGGGC
CCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCTCTGCAA
ACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACCACCCCA


Top

FusionGenePPI for SHB_PAX5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SHBKDR, IL2RB, IL2RG, JAK1, JAK3, LAT, PLCG1, LCP2, ZAP70, VAV1, GRB2, CRK, EPS8, SRC, PIK3R1, FGFR1, ABL1, NCK2, CDH1, WDYHV1, TRIM25PAX5TLE4, DAXX, RUNX1, MYB, ID3, EP300, TBP, RB1, MAPK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SHB_PAX5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SHB_PAX5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePAX5C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human;UNIPROT
TgenePAX5C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human