FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33603

FusionGeneSummary for SGSM3_TNRC6B

check button Fusion gene summary
Fusion gene informationFusion gene name: SGSM3_TNRC6B
Fusion gene ID: 33603
HgeneTgene
Gene symbol

SGSM3

TNRC6B

Gene ID

27352

23112

Gene namesmall G protein signaling modulator 3trinucleotide repeat containing 6B
SynonymsCIP85|MAP|RABGAP5|RUSC3|RUTBC3|RabGAP-5|rabGAPLP-
Cytomap

22q13.1

22q13.1

Type of geneprotein-codingprotein-coding
Descriptionsmall G protein signaling modulator 3RUN and SH3 containing 3RUN and TBC1 domain containing 3RUN and TBC1 domain-containing protein 3merlin binding proteinmerlin-associated proteinrab-GTPase-activating protein-like proteinsmall G protein signaling trinucleotide repeat-containing gene 6B protein
Modification date2018052320180519
UniProtAcc

Q96HU1

Q9UPQ9

Ensembl transtripts involved in fusion geneENST00000248929, ENST00000454798, 
ENST00000301923, ENST00000402203, 
ENST00000454349, ENST00000335727, 
ENST00000497559, 
Fusion gene scores* DoF score5 X 2 X 4=407 X 11 X 5=385
# samples 511
** MAII scorelog2(5/40*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(11/385*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SGSM3 [Title/Abstract] AND TNRC6B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneSGSM3

GO:0043547

positive regulation of GTPase activity

17562788


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-55-8506-01ASGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000248929ENST00000301923SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000248929ENST00000402203SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000248929ENST00000454349SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000248929ENST00000335727SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
5CDS-3UTRENST00000248929ENST00000497559SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000454798ENST00000301923SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000454798ENST00000402203SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000454798ENST00000454349SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
In-frameENST00000454798ENST00000335727SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+
5CDS-3UTRENST00000454798ENST00000497559SGSM3chr22

40804846

+TNRC6Bchr22

40696459

+

Top

FusionProtFeatures for SGSM3_TNRC6B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SGSM3

Q96HU1

TNRC6B

Q9UPQ9

May play a cooperative role in NF2-mediated growthsuppression of cells. {ECO:0000269|PubMed:15541357}. Plays a role in RNA-mediated gene silencing by bothmicro-RNAs (miRNAs) and short interfering RNAs (siRNAs). Requiredfor miRNA-dependent translational repression and siRNA-dependentendonucleolytic cleavage of complementary mRNAs by argonautefamily proteins. As scaffoldng protein associates with argonauteproteins bound to partially complementary mRNAs and simultaneouslycan recruit CCR4-NOT and PAN deadenylase complexes.{ECO:0000269|PubMed:16289642, ECO:0000269|PubMed:19167051,ECO:0000269|PubMed:19304925, ECO:0000269|PubMed:21981923}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSGSM3chr22:40804846chr22:40696459ENST00000248929+1822415_439634750Coiled coilOntology_term=ECO:0000255
HgeneSGSM3chr22:40804846chr22:40696459ENST00000248929+1822114_305634750DomainRab-GAP TBC
HgeneSGSM3chr22:40804846chr22:40696459ENST00000248929+1822480_539634750DomainSH3
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+12241150_12204321030Compositional biasNote=Gln-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+1224825_8804321030Compositional biasNote=Pro-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+9211150_122011261724Compositional biasNote=Gln-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+12241150_12204321030Compositional biasNote=Gln-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+1224825_8804321030Compositional biasNote=Pro-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+12241648_17204321030DomainNote=RRM
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+9211648_172011261724DomainNote=RRM
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+12241648_17204321030DomainNote=RRM
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+11231648_172012361834DomainNote=RRM
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+12241472_14904321030RegionNote=PABPC1-interacting motif-2 (PAM2)
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+9211472_149011261724RegionNote=PABPC1-interacting motif-2 (PAM2)
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+12241472_14904321030RegionNote=PABPC1-interacting motif-2 (PAM2)
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+11231472_149012361834RegionNote=PABPC1-interacting motif-2 (PAM2)

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSGSM3chr22:40804846chr22:40696459ENST00000248929+1822555_718634750DomainRUN
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+12241_394321030Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+9211_3911261724Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+12241_394321030Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+11231_3912361834Coiled coilOntology_term=ECO:0000255
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+921825_88011261724Compositional biasNote=Pro-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+11231150_122012361834Compositional biasNote=Gln-rich
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+1123825_88012361834Compositional biasNote=Pro-rich


Top

FusionGeneSequence for SGSM3_TNRC6B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_1232aa
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVG
DLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHD
IELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTD
PKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEE
LLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQ
QQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTSMMEGLPSVATQ
EANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYVTP
GSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISS
RNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLT
QGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVGPALNLFGGSTGL

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_1232aa
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVG
DLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHD
IELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTD
PKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEE
LLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQ
QQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTSMMEGLPSVATQ
EANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYVTP
GSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISS
RNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLT
QGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVGPALNLFGGSTGL

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_1232aa
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVG
DLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHD
IELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTD
PKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEE
LLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQ
QQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTSMMEGLPSVATQ
EANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYVTP
GSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISS
RNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLT
QGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVGPALNLFGGSTGL

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_1232aa
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVG
DLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHD
IELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTD
PKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASVYSRLVLCKTFRLDEDGKVLTPEE
LLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQRKISQAVRQQQEQQLARMVSALQQ
QQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTSMMEGLPSVATQ
EANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPEFQPGVPWKGIQNIDPESDPYVTP
GSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISS
RNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQIDGSTLRTICMQHGPLLTFHLNLT
QGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSLETGQNQSDPVGPALNLFGGSTGL

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_1165aa
MEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAK
QIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTD
QRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTL
SDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIK
QTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHC
WVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASV
YSRLVLCKTFRLDEDGKVLTPEELLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQR
KISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKE
AGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPE
FQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTW
SPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQI
DGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSL

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_1165aa
MEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAK
QIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTD
QRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTL
SDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIK
QTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHC
WVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASV
YSRLVLCKTFRLDEDGKVLTPEELLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQR
KISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKE
AGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPE
FQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTW
SPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQI
DGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSL

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_1165aa
MEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAK
QIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTD
QRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTL
SDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIK
QTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHC
WVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASV
YSRLVLCKTFRLDEDGKVLTPEELLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQR
KISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKE
AGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPE
FQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTW
SPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQI
DGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSL

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_1165aa
MEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAK
QIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTTLLGVQTD
QRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDLFFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTL
SDIPSQMEDAELLLGVAMRLAGSLTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEALKAKNIK
QTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHC
WVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFASV
YSRLVLCKTFRLDEDGKVLTPEELLYRVSASMLKQFPNSGLSPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQLLQNQR
KISQAVRQQQEQQLARMVSALQQQQQQQQRQPGMKHSPSHPVGPKPHLDNMVPNALNVGLPDLQTKGPIPGYGSGFSSGGMDYGMVGGKE
AGTESRFKQWTSMMEGLPSVATQEANMHKNGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWPPE
FQPGVPWKGIQNIDPESDPYVTPGSVLGGTATSPIVDTDHQLLRDNTTGSNSSLNTSLPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTW
SPDPIGHNPTHLSNKMWKNHISSRNTTPLPRPPPGLTNPKPSSPWSSTAPRSVRGWGTQDSRLASASTWSDGGSVRPSYWLVLHNLTPQI
DGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTILAEFATDDEVSRFLAQAQPPTPAATPSAPAAGWQSL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_3696nt
ATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAGTACACGCAG
AAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGT
CTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGG
GATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGG
CCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAAC
GATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGG
GTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGC
CTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACC
CTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGAC
ATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTG
TTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCG
GCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCC
CTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTC
ACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCA
CTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGAC
CCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGC
CACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTG
TCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGC
AGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCC
CTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTC
GAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAG
CTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCT
CCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAG
CAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAG
CAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCC
AACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTAT
GGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAG
GAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGT
GACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGC
AATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCA
GGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCC
CTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTC
CCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCC
AGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTC
AGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTT
CACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACC
CAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACC
ATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCA
GCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTC
GGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTA
TGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCA

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_3696nt
ATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAGTACACGCAG
AAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGT
CTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGG
GATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGG
CCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAAC
GATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGG
GTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGC
CTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACC
CTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGAC
ATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTG
TTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCG
GCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCC
CTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTC
ACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCA
CTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGAC
CCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGC
CACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTG
TCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGC
AGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCC
CTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTC
GAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAG
CTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCT
CCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAG
CAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAG
CAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCC
AACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTAT
GGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAG
GAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGT
GACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGC
AATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCA
GGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCC
CTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTC
CCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCC
AGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTC
AGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTT
CACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACC
CAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACC
ATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCA
GCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTC
GGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTA
TGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCA

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_3696nt
ATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAGTACACGCAG
AAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGT
CTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGG
GATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGG
CCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAAC
GATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGG
GTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGC
CTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACC
CTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGAC
ATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTG
TTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCG
GCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCC
CTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTC
ACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCA
CTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGAC
CCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGC
CACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTG
TCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGC
AGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCC
CTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTC
GAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAG
CTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCT
CCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAG
CAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAG
CAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCC
AACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTAT
GGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAG
GAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGT
GACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGC
AATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCA
GGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCC
CTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTC
CCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCC
AGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTC
AGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTT
CACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACC
CAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACC
ATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCA
GCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTC
GGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTA
TGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCA

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_3696nt
ATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAGTACACGCAG
AAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGT
CTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGG
GATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGG
CCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAAC
GATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGG
GTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGC
CTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACC
CTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGAC
ATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTG
TTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCG
GCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCC
CTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTC
ACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCA
CTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGAC
CCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGC
CACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTG
TCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGC
AGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCC
CTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTC
GAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAG
CTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCT
CCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAG
CAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAG
CAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCC
AACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTAT
GGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAG
GAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGT
GACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGC
AATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCA
GGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCC
CTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTC
CCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCC
AGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTC
AGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTT
CACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACC
CAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACC
ATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCA
GCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTC
GGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTA
TGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_3495nt
ATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATCTCACCTGGGACAAGATT
GCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCACAGCTGTGGATGCGGCTC
TCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATGAGACCATCGCTGCCAAG
CAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGCCCCGCCTGCGCAGGGTG
CTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCCTGCTGTTCCTGGAGGAG
GAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGCTGGGTGTCCAGACTGAC
CAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTGAGCTGTCCCTGATCACA
CTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTTTCTACGAGGGCTCCCGG
GTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCTCCATCTTCAACACGCTA
TCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCACCGATGTGGCCGTGGAG
ACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCAACCTCTCTCAGGTTGTT
CGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCAAGGCCAAGAACATCAAG
CAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCAAAAACTGCAGCGTGGAG
CTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACCGGCGCCGAGCCAAGGCC
CTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTCAGAAGGACGAGCACTGC
TGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCAAAGAGTACTCCATCGCG
GGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGTTCGAACATGGACTGAAG
AAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGAGAGACTTTGCCTCCGTG
TATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGCTCTACCGGGTTTCTGCC
TCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTCAACAAATTGCCATGCTG
AGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGTTGTTACAGAACCAGAGA
AAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGCAGCAGCAGCAGCAGAGG
CAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACGCATTGAATGTGGGGCTC
CCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCATGGTTGGTGGGAAGGAG
GCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAGCCAATATGCACAAAAAT
GGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACACACTGGGTGGCCATACG
GGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATGCCAGTTGGCCTCCAGAA
TTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAAGTGTGCTGGGGGGTACA
GCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCAACACCTCGCTGCCTTCA
CCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTGATTACAAATCAACATGG
TCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGAACACTACACCGCTGCCC
CGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGGGGTGGGGGACACAGGAC
TCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACAATCTCACCCCACAGATT
GATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGA
TACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACT
GATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTG
GAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCT
GGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_3495nt
ATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATCTCACCTGGGACAAGATT
GCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCACAGCTGTGGATGCGGCTC
TCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATGAGACCATCGCTGCCAAG
CAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGCCCCGCCTGCGCAGGGTG
CTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCCTGCTGTTCCTGGAGGAG
GAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGCTGGGTGTCCAGACTGAC
CAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTGAGCTGTCCCTGATCACA
CTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTTTCTACGAGGGCTCCCGG
GTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCTCCATCTTCAACACGCTA
TCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCACCGATGTGGCCGTGGAG
ACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCAACCTCTCTCAGGTTGTT
CGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCAAGGCCAAGAACATCAAG
CAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCAAAAACTGCAGCGTGGAG
CTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACCGGCGCCGAGCCAAGGCC
CTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTCAGAAGGACGAGCACTGC
TGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCAAAGAGTACTCCATCGCG
GGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGTTCGAACATGGACTGAAG
AAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGAGAGACTTTGCCTCCGTG
TATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGCTCTACCGGGTTTCTGCC
TCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTCAACAAATTGCCATGCTG
AGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGTTGTTACAGAACCAGAGA
AAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGCAGCAGCAGCAGCAGAGG
CAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACGCATTGAATGTGGGGCTC
CCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCATGGTTGGTGGGAAGGAG
GCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAGCCAATATGCACAAAAAT
GGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACACACTGGGTGGCCATACG
GGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATGCCAGTTGGCCTCCAGAA
TTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAAGTGTGCTGGGGGGTACA
GCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCAACACCTCGCTGCCTTCA
CCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTGATTACAAATCAACATGG
TCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGAACACTACACCGCTGCCC
CGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGGGGTGGGGGACACAGGAC
TCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACAATCTCACCCCACAGATT
GATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGA
TACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACT
GATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTG
GAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCT
GGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_3495nt
ATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATCTCACCTGGGACAAGATT
GCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCACAGCTGTGGATGCGGCTC
TCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATGAGACCATCGCTGCCAAG
CAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGCCCCGCCTGCGCAGGGTG
CTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCCTGCTGTTCCTGGAGGAG
GAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGCTGGGTGTCCAGACTGAC
CAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTGAGCTGTCCCTGATCACA
CTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTTTCTACGAGGGCTCCCGG
GTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCTCCATCTTCAACACGCTA
TCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCACCGATGTGGCCGTGGAG
ACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCAACCTCTCTCAGGTTGTT
CGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCAAGGCCAAGAACATCAAG
CAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCAAAAACTGCAGCGTGGAG
CTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACCGGCGCCGAGCCAAGGCC
CTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTCAGAAGGACGAGCACTGC
TGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCAAAGAGTACTCCATCGCG
GGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGTTCGAACATGGACTGAAG
AAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGAGAGACTTTGCCTCCGTG
TATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGCTCTACCGGGTTTCTGCC
TCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTCAACAAATTGCCATGCTG
AGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGTTGTTACAGAACCAGAGA
AAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGCAGCAGCAGCAGCAGAGG
CAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACGCATTGAATGTGGGGCTC
CCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCATGGTTGGTGGGAAGGAG
GCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAGCCAATATGCACAAAAAT
GGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACACACTGGGTGGCCATACG
GGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATGCCAGTTGGCCTCCAGAA
TTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAAGTGTGCTGGGGGGTACA
GCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCAACACCTCGCTGCCTTCA
CCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTGATTACAAATCAACATGG
TCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGAACACTACACCGCTGCCC
CGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGGGGTGGGGGACACAGGAC
TCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACAATCTCACCCCACAGATT
GATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGA
TACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACT
GATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTG
GAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCT
GGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_3495nt
ATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATCTCACCTGGGACAAGATT
GCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCACAGCTGTGGATGCGGCTC
TCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATGAGACCATCGCTGCCAAG
CAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGCCCCGCCTGCGCAGGGTG
CTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCCTGCTGTTCCTGGAGGAG
GAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGCTGGGTGTCCAGACTGAC
CAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTGAGCTGTCCCTGATCACA
CTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTTTCTACGAGGGCTCCCGG
GTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCTCCATCTTCAACACGCTA
TCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCACCGATGTGGCCGTGGAG
ACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCAACCTCTCTCAGGTTGTT
CGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCAAGGCCAAGAACATCAAG
CAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCAAAAACTGCAGCGTGGAG
CTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACCGGCGCCGAGCCAAGGCC
CTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTCAGAAGGACGAGCACTGC
TGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCAAAGAGTACTCCATCGCG
GGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGTTCGAACATGGACTGAAG
AAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGAGAGACTTTGCCTCCGTG
TATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGCTCTACCGGGTTTCTGCC
TCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTCAACAAATTGCCATGCTG
AGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGTTGTTACAGAACCAGAGA
AAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGCAGCAGCAGCAGCAGAGG
CAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACGCATTGAATGTGGGGCTC
CCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCATGGTTGGTGGGAAGGAG
GCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAGCCAATATGCACAAAAAT
GGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACACACTGGGTGGCCATACG
GGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATGCCAGTTGGCCTCCAGAA
TTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAAGTGTGCTGGGGGGTACA
GCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCAACACCTCGCTGCCTTCA
CCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTGATTACAAATCAACATGG
TCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGAACACTACACCGCTGCCC
CGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGGGGTGGGGGACACAGGAC
TCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACAATCTCACCCCACAGATT
GATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGGGCACTGCCCTGATCCGA
TACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCCTTGCTGAGTTTGCCACT
GATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTGCGGGGTGGCAGTCGCTG
GAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGCAGTGGAGCAGCAGCGCT
GGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGGGAGTCCCAACGGTGGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_16451nt
CCGCTGAGCGCTGACTGGGTGCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTC
TGGACCAGATGAAGCCTGAGGAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCC
ACCAGCACAATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAG
TACACGCAGAAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCT
GGCTCCAGTCTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCAC
GATGTGGGGGATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACAT
GGCATGAGGCCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAAC
AGCTCCAACGATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGT
AGCATCGGGGTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTG
GCCGCCTGCCTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTC
AGCACCACCCTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAG
GAGCATGACATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATC
TGGGACCTGTTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCA
GAGAACTCGGCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTG
GCCGGCTCCCTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCC
GGCACCCTCACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGAC
CTGGAGGCACTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAG
TGCACAGACCCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGC
TCACGCAGCCACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATC
ACAATCGTGTCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTG
GATGAGCGCAGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCC
CTTAAGGCCCTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGC
CGGGAGGTCGAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACC
CCGGAGGAGCTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCC
CAGTTATCTCCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAG
CAACAGCAGCAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCA
CTGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAAC
ATGGTACCCAACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGC
ATGGACTATGGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTA
GCCACACAGGAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATC
ATCCCTGGTGACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGT
AAATCCAGCAATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTAT
GTCACCCCAGGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCT
AATTCTTCCCTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCA
GCAAAGTTCCCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCAT
ATTTCCTCCAGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCC
CGATCAGTCAGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGG
CTGGTTCTTCACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTG
AATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGA
AACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCA
AGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCC
ACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCT
TCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGG
TCGGATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTT
TTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATA
GTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGC
CAACCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTT
TTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGT
CCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAA
AACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAA
CTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGT
GTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTT
TATTTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAG
TGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAG
TAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTA
AGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTG
ATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTG
AGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAG
CTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTAC
TTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAG
GCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAAT
TTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATC
ACCAACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAAC
CAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGA
CATTTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAG
GGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGG
TGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCC
CTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCAT
GAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTG
CAATTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGG
AGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCA
GGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTC
CTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTG
TTTACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAA
CTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTT
AACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTT
TTTTGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTC
AGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACA
CATAGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAG
AGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTT
TCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAA
GAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTT
AGGAAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGA
ATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCA
GCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTT
CAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATT
AAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTG
CCTTCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCAC
CCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATAT
GCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTG
TGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCT
TTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGG
ATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAA
ATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAA
AACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTA
CATCTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACAC
CAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAA
GAAATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCA
GTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTA
TAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTT
CTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGA
AGCACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTT
TTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTA
TATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAG
AGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTT
TTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAG
ATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGT
GTATGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTC
CTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACC
TCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTC
AAGAAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAG
ACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTT
TTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAA
TAACAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACG
AGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGG
GACCAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCA
AAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGT
TTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTG
TGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCG
TTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGC
CAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGA
AAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTC
CTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCC
AGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCA
AAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATG
ACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTA
CTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGAC
GGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGT
GTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGC
AGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAG
CACTGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCA
GCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGG
TATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCT
TCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTAT
CTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGAT
TCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATT
ATTATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCC
ACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGG
AAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTG
GTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTG
CAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGT
GTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAA
TCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCT
TAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCT
CTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTC
CTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTA
AGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTG
ATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACA
ACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCC
TCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTG
AAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATG
TTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAG
CAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATC
TGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTG
GTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCC
AGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGC
CATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTT
CTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCA
CAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTT
ACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTC
GAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATG
AAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGA
AGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCA
CCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCA
TGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACC
ACCACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCAC
AGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACA
AAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTC
ACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGG
ACTATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACA
TCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGA
GAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGG
TGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAA
AATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCT
TTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAA
GTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAG
AGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTT
GCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAAC
AATAAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCA
TGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAA
GGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAA
CAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTA

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_4004nt
CCGCTGAGCGCTGACTGGGTGCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTC
TGGACCAGATGAAGCCTGAGGAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCC
ACCAGCACAATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAG
TACACGCAGAAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCT
GGCTCCAGTCTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCAC
GATGTGGGGGATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACAT
GGCATGAGGCCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAAC
AGCTCCAACGATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGT
AGCATCGGGGTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTG
GCCGCCTGCCTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTC
AGCACCACCCTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAG
GAGCATGACATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATC
TGGGACCTGTTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCA
GAGAACTCGGCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTG
GCCGGCTCCCTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCC
GGCACCCTCACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGAC
CTGGAGGCACTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAG
TGCACAGACCCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGC
TCACGCAGCCACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATC
ACAATCGTGTCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTG
GATGAGCGCAGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCC
CTTAAGGCCCTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGC
CGGGAGGTCGAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACC
CCGGAGGAGCTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCC
CAGTTATCTCCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAG
CAACAGCAGCAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCA
CTGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAAC
ATGGTACCCAACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGC
ATGGACTATGGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTA
GCCACACAGGAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATC
ATCCCTGGTGACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGT
AAATCCAGCAATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTAT
GTCACCCCAGGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCT
AATTCTTCCCTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCA
GCAAAGTTCCCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCAT
ATTTCCTCCAGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCC
CGATCAGTCAGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGG
CTGGTTCTTCACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTG
AATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGA
AACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCA
AGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCC
ACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCT
TCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGG
TCGGATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTT

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_16451nt
CCGCTGAGCGCTGACTGGGTGCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTC
TGGACCAGATGAAGCCTGAGGAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCC
ACCAGCACAATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAG
TACACGCAGAAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCT
GGCTCCAGTCTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCAC
GATGTGGGGGATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACAT
GGCATGAGGCCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAAC
AGCTCCAACGATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGT
AGCATCGGGGTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTG
GCCGCCTGCCTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTC
AGCACCACCCTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAG
GAGCATGACATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATC
TGGGACCTGTTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCA
GAGAACTCGGCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTG
GCCGGCTCCCTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCC
GGCACCCTCACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGAC
CTGGAGGCACTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAG
TGCACAGACCCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGC
TCACGCAGCCACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATC
ACAATCGTGTCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTG
GATGAGCGCAGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCC
CTTAAGGCCCTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGC
CGGGAGGTCGAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACC
CCGGAGGAGCTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCC
CAGTTATCTCCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAG
CAACAGCAGCAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCA
CTGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAAC
ATGGTACCCAACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGC
ATGGACTATGGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTA
GCCACACAGGAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATC
ATCCCTGGTGACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGT
AAATCCAGCAATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTAT
GTCACCCCAGGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCT
AATTCTTCCCTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCA
GCAAAGTTCCCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCAT
ATTTCCTCCAGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCC
CGATCAGTCAGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGG
CTGGTTCTTCACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTG
AATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGA
AACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCA
AGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCC
ACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCT
TCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGG
TCGGATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTT
TTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATA
GTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGC
CAACCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTT
TTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGT
CCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAA
AACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAA
CTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGT
GTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTT
TATTTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAG
TGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAG
TAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTA
AGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTG
ATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTG
AGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAG
CTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTAC
TTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAG
GCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAAT
TTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATC
ACCAACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAAC
CAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGA
CATTTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAG
GGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGG
TGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCC
CTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCAT
GAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTG
CAATTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGG
AGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCA
GGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTC
CTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTG
TTTACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAA
CTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTT
AACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTT
TTTTGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTC
AGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACA
CATAGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAG
AGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTT
TCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAA
GAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTT
AGGAAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGA
ATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCA
GCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTT
CAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATT
AAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTG
CCTTCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCAC
CCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATAT
GCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTG
TGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCT
TTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGG
ATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAA
ATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAA
AACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTA
CATCTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACAC
CAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAA
GAAATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCA
GTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTA
TAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTT
CTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGA
AGCACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTT
TTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTA
TATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAG
AGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTT
TTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAG
ATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGT
GTATGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTC
CTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACC
TCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTC
AAGAAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAG
ACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTT
TTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAA
TAACAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACG
AGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGG
GACCAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCA
AAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGT
TTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTG
TGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCG
TTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGC
CAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGA
AAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTC
CTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCC
AGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCA
AAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATG
ACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTA
CTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGAC
GGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGT
GTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGC
AGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAG
CACTGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCA
GCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGG
TATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCT
TCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTAT
CTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGAT
TCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATT
ATTATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCC
ACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGG
AAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTG
GTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTG
CAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGT
GTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAA
TCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCT
TAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCT
CTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTC
CTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTA
AGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTG
ATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACA
ACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCC
TCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTG
AAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATG
TTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAG
CAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATC
TGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTG
GTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCC
AGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGC
CATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTT
CTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCA
CAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTT
ACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTC
GAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATG
AAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGA
AGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCA
CCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCA
TGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACC
ACCACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCAC
AGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACA
AAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTC
ACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGG
ACTATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACA
TCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGA
GAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGG
TGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAA
AATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCT
TTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAA
GTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAG
AGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTT
GCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAAC
AATAAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCA
TGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAA
GGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAA
CAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTA

>In-frame_SGSM3_ENST00000248929_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_16452nt
CCGCTGAGCGCTGACTGGGTGCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTC
TGGACCAGATGAAGCCTGAGGAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCC
ACCAGCACAATGTCAGGAAGCCATACACCTGCCTGTGGCCCTTTCTCAGCCCTGACTCCGAGCATATGGCCCCAGGAGATCTTGGCCAAG
TACACGCAGAAGGAAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCT
GGCTCCAGTCTGCTGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCAC
GATGTGGGGGATCTCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACAT
GGCATGAGGCCACAGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAAC
AGCTCCAACGATGAGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGT
AGCATCGGGGTGCCCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTG
GCCGCCTGCCTCCTGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTC
AGCACCACCCTGCTGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAG
GAGCATGACATTGAGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATC
TGGGACCTGTTTTTCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCA
GAGAACTCGGCCTCCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTG
GCCGGCTCCCTCACCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCC
GGCACCCTCACCAACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGAC
CTGGAGGCACTCAAGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAG
TGCACAGACCCCAAAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGC
TCACGCAGCCACCGGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATC
ACAATCGTGTCTCAGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTG
GATGAGCGCAGCAAAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCC
CTTAAGGCCCTGTTCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGC
CGGGAGGTCGAGAGAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACC
CCGGAGGAGCTGCTCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCC
CAGTTATCTCCTCAACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAG
CAACAGCAGCAGTTGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCA
CTGCAGCAGCAGCAGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAAC
ATGGTACCCAACGCATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGC
ATGGACTATGGCATGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTA
GCCACACAGGAAGCCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATC
ATCCCTGGTGACACACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGT
AAATCCAGCAATGCCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTAT
GTCACCCCAGGAAGTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCT
AATTCTTCCCTCAACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCA
GCAAAGTTCCCTGATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCAT
ATTTCCTCCAGGAACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCC
CGATCAGTCAGGGGGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGG
CTGGTTCTTCACAATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTG
AATCTAACCCAGGGCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGA
AACACTACCATCCTTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCA
AGTGCGCCAGCTGCGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCC
ACTGGGCTCGGGCAGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCT
TCTAGCTTATGGGGAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGG
TCGGATTCAATCTGAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTT
TTTTCAACTTGCAATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATA
GTTGCCTCCCTTATAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGC
CAACCTAGAAAGACAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTT
TTTTCATGTTATATGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGT
CCTTAGGTCTACCATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAA
AACAAAAACACAAAAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAA
CTGCCCAGGCATGCTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGT
GTTCTTCCCTTCTCCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTT
TATTTTATTTTTTTAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAG
TGCTTTTTAATGATGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAG
TAGAGTGGAGCACTGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTA
AGTGAATGGCCACCAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTG
ATGATGCGATGTCTCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTG
AGTTACATATTTCTGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAG
CTACTCCCTCTGCTCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTAC
TTAACGAATGTTCTTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAG
GCAGGTATAACTTAGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAAT
TTCGGTATTTAAATACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATC
ACCAACATGTATGTACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAAC
CAGATAGGGTGGGGGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGA
CATTTTGTACCAGCAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAG
GGAGTTTTTCTTTCTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGG
TGGGTGGGTGGGTGTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCC
CTTCTGGCTTACCCTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCAT
GAGCCCTCTGTGGGTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTG
CAATTTGAATCACCACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGG
AGCAAAGTGCTGTCGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCA
GGAGCATATCCCAAGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTC
CTCCTGCCTGTTGGTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTG
TTTACAAGACATAATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAA
CTAAAAACTTTAAAAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTT
AACAGTGTTTTTTGTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTT
TTTTGAAGATGGTTTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTC
AGAAAGTTTAAACAATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACA
CATAGAAATATTTTTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAG
AGCTCGATCATGGATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTT
TCCATTTGAGACTGAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAA
GAAAGGAAGGAAGGAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTT
AGGAAATATAGGTTAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGA
ATGTCTGTCTTACCTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCA
GCTACTGTTGTGCTCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTT
CAGTTTTTGGTGATGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATT
AAGCTTCCCAGTGGGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTG
CCTTCGTACATACACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCAC
CCATAAAGGAAATTGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATAT
GCTTATGTCTCAGTAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTG
TGACAACTGCAGTGATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCT
TTTCCCCCAGACCTCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGG
ATGTCATGGAAGAGAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAA
ATTCAGTGAGAGTGCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAA
AACATTTTGATTATGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTA
CATCTCCTGAACATCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACAC
CAGACAGAGGACCTCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAA
GAAATGGATGGCTCATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCA
GTGTTGCAAGTTAAGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTA
TAGCAACTTGATTTCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTT
CTTCCAAACTCCTGTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGA
AGCACCTTTATTAACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTT
TTTTTTGGGTGAGGGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTA
TATTCTGCCATCTTGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAG
AGTAAACAGGATGTTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTT
TTTCCCCATCCTCAGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAG
ATCTTTAGAAGTGAGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGT
GTATGCATTAACTATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTC
CTCCTGTGAGTGGACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACC
TCATGGTCGTTAAGAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTC
AAGAAACACACAGATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAG
ACCCTGTGATAACAGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTT
TTTTTTCTTAAGTTTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAA
TAACAATAAAAATTCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACG
AGGTGGTAAAGGGGGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGG
GACCAGATCCCGAGTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCA
AAAAAGTAACGAAAGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGT
TTTTAACAAGAAACTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTG
TGACAAATGCTTATCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCG
TTTAAAGCACTTTGTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGC
CAATATCAACAAGTTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGA
AAGTTGTCAAGGTGGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTC
CTTCCCCTTCGGCTACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCC
AGGACTAGCCCTACAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCA
AAACAAAATAAAAACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATG
ACACTTCTTGCCAGAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTA
CTTAAGTATAGTATTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGAC
GGTCAGCTTTAGTCATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGT
GTAGAGTTGAGTGGAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGC
AGGTTTACACATCTGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAG
CACTGGAGAATTGGAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCA
GCACGCTTTTACCCTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGG
TATTACACACAAGGAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCT
TCAGAGCTATTATAGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTAT
CTTCTAAAGAAATATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGAT
TCCTTCAGCTTCATTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATT
ATTATGCAAATGTGAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCC
ACATGTGGTCATCGTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGG
AAGGGAGTAGCGTTGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTG
GTAAGGTCAGCACAGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTG
CAGTTCCTGTCAACCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGT
GTTCTCTGGAAAAAGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAA
TCTTTAGGTCGATTTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCT
TAGTTATAAGGAACTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCT
CTGCTTCCCTTGCATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTC
CTAACAATTCCTTTGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTA
AGCGAGAGATTGTTCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTG
ATCACAGTCTCCTCGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACA
ACAAAAAAATAAAATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCC
TCTCTCCTTTCTGACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTG
AAAGTAACCCTAAAATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATG
TTTAAGAAGAAAGAGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAG
CAGACCAGTATGTAAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATC
TGAGGTCAGGAGTTTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTG
GTCCCAGCTGCTCGGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCC
AGTGTGGGCAACAGAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGC
CATCTCTTCCAGCAATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTT
CTCCACACAATACCTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCA
CAGAAGGATGTAGTCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTT
ACTTGGGAGGAAACTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTC
GAAGCGACATTAAGTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATG
AAGCAGGGTTGGAATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGA
AGCCCTTTTCAGTTGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCA
CCCACCTTCTGATTTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCA
TGGGTTCTGCCTGCCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACC
ACCACCCTTTGCACACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCAC
AGAGACACGTGCACAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACA
AAAAACCCTTCTGGGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTC
ACATTCTATGCCCTCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGG
ACTATTTTATCTGTCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACA
TCCTACCAAATCAGGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGA
GAAGTACCATTTTAATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGG
TGCAGAAAAGGGCATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAA
AATCCTCTCATCTGAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCT
TTAAGTGTTTTTTTTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAA
GTAGATAATGGGATTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAG
AGGTTTAATCAAACTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTT
GCATGGCAGGCTGGGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAAC
AATAAAATGTTAAACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCA
TGCTGGATTTCAAAAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAA
GGAATTAAGTCGTCGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAA
CAGCTTATTTTTGTTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000301923_chr22_40696459_+_16348nt
GCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTCTGGACCAGATGAAGCCTGAG
GAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCCACCAGCACAATGTCAGAAGG
AAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGTCTGC
TGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATC
TCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCAC
AGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATG
AGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGC
CCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCC
TGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGC
TGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTG
AGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTT
TCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCT
CCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCA
CCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCA
ACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCA
AGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCA
AAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACC
GGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTC
AGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCA
AAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGT
TCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGA
GAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGC
TCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTC
AACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGT
TGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGC
AGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACG
CATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCA
TGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAG
CCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACA
CACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATG
CCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAA
GTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCA
ACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTG
ATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGA
ACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGG
GGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACA
ATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGG
GCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCC
TTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTG
CGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGC
AGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGG
GAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCT
GAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCA
ATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTA
TAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGA
CAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATA
TGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACC
ATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAA
AAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATG
CTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCT
CCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTT
TAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGA
TGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCAC
TGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCAC
CAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTC
TCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTC
TGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGC
TCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTC
TTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTT
AGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAA
TACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATG
TACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGG
GGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAG
CAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTT
CTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGT
GTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACC
CTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGG
GTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCAC
CACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGT
CGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCA
AGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTG
GTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATA
ATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAA
AAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTT
GTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGT
TTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAAC
AATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTT
TTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGG
ATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACT
GAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAG
GAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGT
TAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTAC
CTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGC
TCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGA
TGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTG
GGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATAC
ACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAAT
TGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAG
TAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGT
GATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACC
TCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGA
GAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGT
GCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTA
TGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACA
TCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACC
TCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCT
CATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTA
AGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATT
TCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCT
GTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTA
ACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAG
GGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCT
TGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATG
TTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTC
AGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTG
AGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACT
ATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGG
ACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAA
GAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAG
ATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAAC
AGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGT
TTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAAT
TCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGG
GGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGA
GTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAA
AGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAA
CTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTA
TCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTT
GTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAG
TTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGT
GGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGC
TACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTA
CAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAA
ACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCA
GAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTA
TTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGT
CATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTG
GAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATC
TGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTG
GAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACC
CTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAG
GAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTAT
AGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAAT
ATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCA
TTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGT
GAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATC
GTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGT
TGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCAC
AGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAA
CCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAA
AGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGAT
TTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAA
CTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGC
ATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTT
TGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGT
TCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCT
CGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAA
ATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTG
ACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAA
AATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAG
AGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGT
AAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGT
TTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTC
GGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACA
GAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGC
AATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATAC
CTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAG
TCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAA
CTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAA
GTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGA
ATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGT
TGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGAT
TTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTG
CCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCA
CACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCA
CAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTG
GGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCC
TCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTG
TCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCA
GGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTT
AATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGC
ATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCT
GAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTT
TTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGA
TTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAA
CTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTG
GGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAA
ACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAA
AAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGT
CGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTG
TTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000402203_chr22_40696459_+_3901nt
GCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTCTGGACCAGATGAAGCCTGAG
GAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCCACCAGCACAATGTCAGAAGG
AAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGTCTGC
TGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATC
TCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCAC
AGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATG
AGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGC
CCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCC
TGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGC
TGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTG
AGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTT
TCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCT
CCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCA
CCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCA
ACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCA
AGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCA
AAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACC
GGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTC
AGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCA
AAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGT
TCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGA
GAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGC
TCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTC
AACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGT
TGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGC
AGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACG
CATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCA
TGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAG
CCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACA
CACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATG
CCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAA
GTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCA
ACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTG
ATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGA
ACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGG
GGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACA
ATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGG
GCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCC
TTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTG
CGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGC
AGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGG
GAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCT
GAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000454349_chr22_40696459_+_16348nt
GCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTCTGGACCAGATGAAGCCTGAG
GAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCCACCAGCACAATGTCAGAAGG
AAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGTCTGC
TGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATC
TCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCAC
AGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATG
AGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGC
CCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCC
TGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGC
TGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTG
AGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTT
TCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCT
CCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCA
CCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCA
ACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCA
AGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCA
AAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACC
GGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTC
AGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCA
AAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGT
TCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGA
GAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGC
TCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTC
AACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGT
TGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGC
AGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACG
CATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCA
TGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAG
CCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACA
CACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATG
CCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAA
GTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCA
ACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTG
ATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGA
ACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGG
GGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACA
ATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGG
GCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCC
TTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTG
CGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGC
AGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGG
GAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCT
GAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCA
ATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTA
TAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGA
CAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATA
TGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACC
ATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAA
AAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATG
CTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCT
CCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTT
TAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGA
TGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCAC
TGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCAC
CAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTC
TCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTC
TGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGC
TCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTC
TTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTT
AGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAA
TACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATG
TACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGG
GGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAG
CAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTT
CTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGT
GTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACC
CTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGG
GTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCAC
CACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGT
CGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCA
AGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTG
GTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATA
ATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAA
AAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTT
GTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGT
TTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAAC
AATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTT
TTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGG
ATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACT
GAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAG
GAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGT
TAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTAC
CTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGC
TCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGA
TGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTG
GGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATAC
ACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAAT
TGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAG
TAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGT
GATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACC
TCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGA
GAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGT
GCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTA
TGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACA
TCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACC
TCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCT
CATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTA
AGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATT
TCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCT
GTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTA
ACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAG
GGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCT
TGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATG
TTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTC
AGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTG
AGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACT
ATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGG
ACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAA
GAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAG
ATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAAC
AGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGT
TTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAAT
TCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGG
GGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGA
GTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAA
AGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAA
CTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTA
TCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTT
GTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAG
TTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGT
GGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGC
TACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTA
CAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAA
ACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCA
GAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTA
TTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGT
CATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTG
GAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATC
TGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTG
GAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACC
CTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAG
GAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTAT
AGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAAT
ATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCA
TTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGT
GAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATC
GTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGT
TGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCAC
AGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAA
CCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAA
AGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGAT
TTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAA
CTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGC
ATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTT
TGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGT
TCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCT
CGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAA
ATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTG
ACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAA
AATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAG
AGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGT
AAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGT
TTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTC
GGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACA
GAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGC
AATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATAC
CTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAG
TCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAA
CTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAA
GTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGA
ATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGT
TGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGAT
TTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTG
CCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCA
CACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCA
CAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTG
GGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCC
TCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTG
TCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCA
GGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTT
AATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGC
ATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCT
GAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTT
TTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGA
TTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAA
CTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTG
GGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAA
ACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAA
AAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGT
CGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTG
TTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATA

>In-frame_SGSM3_ENST00000454798_chr22_40804846_+_TNRC6B_ENST00000335727_chr22_40696459_+_16349nt
GCGAGTGGGGAAGCTGCTAACCCGACCCGGATTGGCGCTGAGGTGGCCCGTGGGGCAGGGCAGATGATTCTGGACCAGATGAAGCCTGAG
GAGCCTTCCAGCTCTAAGATAGCAGGATAGGAGACTTCTAAGATTGGAGCTGCAGAAGACTTGCCAGCCCACCAGCACAATGTCAGAAGG
AAGAGTCAGCAGAGCAACCAGAGTTCTACTACGATGAGTTTGGTTTCCGTGTGTACAAGGAAGAAGGTGATGAGCCTGGCTCCAGTCTGC
TGGCGAACTCCCCTCTGATGGAGGATGCTCCACAGAGGCTGCGGTGGCAGGCCCACCTGGAGTTCACCCATAACCACGATGTGGGGGATC
TCACCTGGGACAAGATTGCCGTCTCCCTACCCCGCTCTGAGAAGCTCCGCTCCCTGGTGCTGGCCGGCATCCCACATGGCATGAGGCCAC
AGCTGTGGATGCGGCTCTCTGGGGCCCTGCAGAAGAAGAGGAACTCTGAGCTGTCCTACCGCGAGATTGTGAAGAACAGCTCCAACGATG
AGACCATCGCTGCCAAGCAGATCGAGAAGGACCTGCTCCGCACCATGCCCAGCAACGCCTGCTTCGCCAGCATGGGTAGCATCGGGGTGC
CCCGCCTGCGCAGGGTGCTCCGGGCCCTGGCCTGGCTCTACCCAGAGATCGGCTACTGCCAGGGCACCGGCATGGTGGCCGCCTGCCTCC
TGCTGTTCCTGGAGGAGGAGGACGCCTTCTGGATGATGTCTGCCATCATCGAGGACCTGCTCCCCGCCTCCTACTTCAGCACCACCCTGC
TGGGTGTCCAGACTGACCAGCGGGTCCTGCGCCACCTCATTGTCCAGTACCTGCCTCGCCTGGACAAGCTGCTCCAGGAGCATGACATTG
AGCTGTCCCTGATCACACTGCACTGGTTCCTCACGGCCTTCGCCAGCGTGGTGGACATCAAGCTGCTCCTGCGCATCTGGGACCTGTTTT
TCTACGAGGGCTCCCGGGTGCTGTTCCAGCTCACGCTGGGCATGCTGCACCTCAAGGAGGAAGAGCTGATCCAGTCAGAGAACTCGGCCT
CCATCTTCAACACGCTATCGGATATCCCGTCGCAGATGGAGGACGCGGAGCTGCTTCTGGGGGTGGCCATGCGGCTGGCCGGCTCCCTCA
CCGATGTGGCCGTGGAGACTCAGCGCCGCAAGCACCTGGCCTATCTCATTGCAGACCAGGGCCAGCTCCTGGGGGCCGGCACCCTCACCA
ACCTCTCTCAGGTTGTTCGCCGCAGGACCCAGCGGAGGAAGTCCACCATCACTGCTCTGCTCTTCGGGGAGGATGACCTGGAGGCACTCA
AGGCCAAGAACATCAAGCAGACGGAACTGGTGGCTGACCTCCGGGAAGCCATCCTGCGCGTGGCACGCCACTTCCAGTGCACAGACCCCA
AAAACTGCAGCGTGGAGCTGACTCCAGACTATAGCATGGAGAGCCACCAGCGGGACCACGAGAACTACGTGGCGTGCTCACGCAGCCACC
GGCGCCGAGCCAAGGCCCTGCTGGACTTTGAGCGGCACGACGACGACGAGCTGGGCTTCCGCAAGAACGACATCATCACAATCGTGTCTC
AGAAGGACGAGCACTGCTGGGTGGGGGAGCTCAACGGCCTGCGAGGCTGGTTTCCAGCCAAGTTCGTGGAAGTCCTGGATGAGCGCAGCA
AAGAGTACTCCATCGCGGGGGATGACTCGGTGACGGAGGGGGTCACAGACCTCGTGCGAGGGACCCTCTGCCCGGCCCTTAAGGCCCTGT
TCGAACATGGACTGAAGAAGCCATCCCTGCTTGGGGGCGCCTGCCACCCCTGGCTGTTTATCGAGGAGGCTGCAGGCCGGGAGGTCGAGA
GAGACTTTGCCTCCGTGTATTCCCGTCTGGTGCTCTGTAAGACCTTCAGGTTGGATGAAGATGGCAAAGTCCTGACCCCGGAGGAGCTGC
TCTACCGGGTTTCTGCCTCAATGCTCAAGCAGTTTCCCAACAGTGGCCTGAGTCCAGGTCTTTTCAATGTGGGGCCCCAGTTATCTCCTC
AACAAATTGCCATGCTGAGCCAGCTTCCACAAATTCCCCAGTTTCAGTTGGCATGTCAGCTTCTCTTGCAGCAGCAGCAACAGCAGCAGT
TGTTACAGAACCAGAGAAAGATTTCTCAAGCTGTACGCCAACAGCAAGAGCAGCAGCTGGCTCGAATGGTGAGTGCACTGCAGCAGCAGC
AGCAGCAGCAGCAGAGGCAGCCAGGCATGAAGCACTCGCCCTCTCATCCTGTTGGGCCCAAGCCGCATCTGGACAACATGGTACCCAACG
CATTGAATGTGGGGCTCCCAGACCTTCAAACCAAAGGGCCAATACCTGGATATGGTTCTGGCTTCAGCTCTGGCGGCATGGACTATGGCA
TGGTTGGTGGGAAGGAGGCTGGAACCGAGTCTCGCTTTAAACAGTGGACCTCCATGATGGAGGGGCTGCCCTCTGTAGCCACACAGGAAG
CCAATATGCACAAAAATGGCGCTATAGTGGCCCCTGGTAAAACCCGGGGAGGGTCACCGTACAACCAGTTTGATATCATCCCTGGTGACA
CACTGGGTGGCCATACGGGTCCTGCTGGTGATAGCTGGTTACCTGCCAAATCTCCACCAACAAATAAAATCGGAAGTAAATCCAGCAATG
CCAGTTGGCCTCCAGAATTCCAACCAGGAGTGCCATGGAAAGGTATCCAAAACATTGACCCTGAATCTGACCCCTATGTCACCCCAGGAA
GTGTGCTGGGGGGTACAGCCACATCTCCCATTGTAGATACTGACCACCAACTGCTGCGGGATAACACCACAGGGTCTAATTCTTCCCTCA
ACACCTCGCTGCCTTCACCTGGTGCCTGGCCCTACAGTGCCTCTGACAACTCCTTTACCAACGTTCATAGCACTTCAGCAAAGTTCCCTG
ATTACAAATCAACATGGTCCCCAGATCCCATAGGACACAACCCCACTCATCTCTCCAACAAGATGTGGAAAAACCATATTTCCTCCAGGA
ACACTACACCGCTGCCCCGCCCACCTCCTGGTCTGACCAACCCCAAACCATCATCTCCCTGGAGCAGCACAGCACCCCGATCAGTCAGGG
GGTGGGGGACACAGGACTCACGGCTCGCCTCGGCCTCTACCTGGAGTGATGGTGGCTCAGTTCGTCCTAGTTACTGGCTGGTTCTTCACA
ATCTCACCCCACAGATTGATGGGTCAACCTTGAGAACGATCTGCATGCAGCATGGCCCACTGCTGACATTCCATCTGAATCTAACCCAGG
GCACTGCCCTGATCCGATACAGCACCAAACAGGAGGCGGCCAAGGCCCAAACTGCACTGCACATGTGTGTGTTGGGAAACACTACCATCC
TTGCTGAGTTTGCCACTGATGATGAAGTCAGCCGCTTTCTGGCACAAGCTCAGCCCCCTACACCTGCAGCAACCCCAAGTGCGCCAGCTG
CGGGGTGGCAGTCGCTGGAGACCGGCCAGAACCAGTCAGATCCCGTGGGACCTGCTCTGAATCTTTTTGGTGGGTCCACTGGGCTCGGGC
AGTGGAGCAGCAGCGCTGGTGGCAGCAGCGGGGCCGATCTTGCTGGCGCTTCATTGTGGGGGCCCCCAAACTATTCTTCTAGCTTATGGG
GAGTCCCAACGGTGGAAGATCCCCATAGGATGGGCAGCCCTGCTCCTTTACTACCTGGTGACCTTCTGGGAGGAGGGTCGGATTCAATCT
GAACTTAGAACTTTCAACTCTGACCTCGTGACCTTTTTTGGAACAGCAGCAGCACTAACTTGACCTTTTCGTTTTTTTTTTCAACTTGCA
ATAAATACATTTTTAAAAGGAAAAAAGAAAACGGAGAGAAAAAAAGGTGGGTCATTGACAGACTGTCTGAGCACATAGTTGCCTCCCTTA
TAACTTCAGTTTTTTCGTTTGGAATATGAATCCAAAAAGAGAACATATCACTCTTGAAATACTTGAATCATGAACGCCAACCTAGAAAGA
CAATGTGAAGCAAGTACACATACCATTTAAATTTAAACACAAAAAAATTAAAAAAATTAGTTTCTAGTTTTTCACTTTTTTCATGTTATA
TGGAAGTTGTTGCTAAGAAACATATATACTGAAAAAAAATAGCTTTTTAACTTTGTTTGCACTGGGTGTGTTTCCGTCCTTAGGTCTACC
ATGTTTGGGAGGGAGGGAAATTCAAAAGAATTGTTGGGGGAGGGGGGAGGGAAGACTTGACGGAGCCTCACTTTAAAAACAAAAACACAA
AAAACCTAAAAAAAAAAAAAAGGAAAAAATTTGTGATTGGCTGGTTGATAAATACCAGTGTGTTCTGGCACATGTAACTGCCCAGGCATG
CTCGTTCTGGTGTGTGTGTGCACGTGTGTTCATGTGCATTCGCGTGCATCCTTCTCTGTCTCTGTGTGTGTGCCTGTGTTCTTCCCTTCT
CCCCTGCCCCACCCTGACTTCTCAGAAAGCTGCATCGCTGACAGTCTGCAGGCTGGCTGGCCGGCCCATCTGCTTTTTATTTTATTTTTT
TAACTATGAGAACACACAGGCCCGGAGAGCCACTGCTACTAAAGCAACTCCATTGGGCTGCATTAAGATGAACAGAGTGCTTTTTAATGA
TGAAAGCAGGGAGCTCCTTTCCATTTGCAACTTAGCCTGAATGTGGGGTTTCTCTGGCTGTTCTTTTGACCTAGCAGTAGAGTGGAGCAC
TGCCAAGTCCAAAAAACTAGAGCAGGAGGTACCTCTTGGAGCAACGGTGTGTTTATTTCTGTTTTTTTTTTTTTTTAAGTGAATGGCCAC
CAGGCACATCTGAGTATCTGTTAAGTTTCATGCAGGCCTTTTCGTTAGTTTGAAATGGGAACGGAAGATAACTTTTGATGATGCGATGTC
TCAAAAACAGAGAAACTTTGTTCCCTCTTTCCTTATGATCAGGTTTGAGAAATTCTTCAAAAAATTAGGTGAAGTTGAGTTACATATTTC
TGTTGGTTGGTTCTCTTTTTCATTTTATGAAAACAGAAAAGAATAAGTGGTGAGCAGCCTCCTGAAAGCATCTGCAGCTACTCCCTCTGC
TCCTTTCTCGCCGAGCGTTACCTGTGCCAGGCCGTGGCGCGTTACAGCACCAGGCCATCACTGACAGAAACGTTTACTTAACGAATGTTC
TTAAACCAGTGTGTACTTCAAGCGTTTCCTTTTGTTTCTCTGTGTTGTGTATTTCCTGTGTATGTGGTTTTGCTTAGGCAGGTATAACTT
AGCGAAGACTTTTAAGTATTGCACCTTTTTTTGATTTTTGACCTCTTCCCCCCACCTTGTAATTTTGCTTTTTTAATTTCGGTATTTAAA
TACTTTTTTTTTTTTTTAAGCATCAATGTAGTAGTACTCTGGGCCGAACAGGGGTCAACGTTTAATCTACAGTTATCACCAACATGTATG
TACTTATGTCGGAATCAAAATGTATCAAACTGCTTATTGTGAAGAGAATTATAGCAGACCTGAAGGGGGCGAAAAACCAGATAGGGTGGG
GGGATGGATGCCGGTGACGTGCTAGCACTTGTGTGGACATCCCAGTCTGCATTATGCTGTTTAACATAAAGTGCCGACATTTTGTACCAG
CAAATACCTGCCCATTCCAACCCTTGGTGGGAGCAGACCTCTACTGTCCTCTGTAACTTGCTGCTATTGAGGACAAGGGAGTTTTTCTTT
CTTTAGCGTCTTCAGTGAAGGATACAATACAACAATGCCTAATGTATTTGACTTTTTAGCTTGTGTCTGTGTGTAGGTGGGTGGGTGGGT
GTGTATAGGAAAAGCCTAAAACAAGTTATTTGCATTTCAGTGGTTTTGTGAGACAAAGAATGGGAAATTCTGTAGCCCTTCTGGCTTACC
CTGTTGATTATAAACCTAGCCTCAAAAGAGATTGACAGGCATGACTCAAGTGAGTGTTCACATATACAAGCCTGCATGAGCCCTCTGTGG
GTAGGTGGTCACACTTGGCATCTGCAGCATTGACGTGGCCCCGCTGGGTGCCTTGAGCATGCCCTCTTCCTGCTCTGCAATTTGAATCAC
CACCGTGCCCCTTCCACCACTGTTCCCCATGCAAAAGCTCTGCTTCCAGCAGCCCCCACTGACCGCTCTCTGTGTGGAGCAAAGTGCTGT
CGTGCGGTGACCACCAGGTGAAGAGCAGCTTGTATTCAGACATCTAGAGAAGGTTAAATCTTAGTGTCCCTGGGCCAGGAGCATATCCCA
AGGCTCCTGCGAGCCAGTGGCGACCCTGTCCACTGCCGCTCTTGGTTCACTGCTGTGTCCTGCCCCACCCTCCTCTCCTCCTGCCTGTTG
GTTCCTTGACCTGCACTATGGGTTAGTTGAGTTCCTTACGATACTACGGTGAAAGCCGGGTGCTAGAGCCCCTCTTGTTTACAAGACATA
ATGAGGGATTTGAAATATGTAAAAATAAACATGAGAAGCTAAAATGTTCTTCCATCATAAGCTTAAAGGGAAAAAAACTAAAAACTTTAA
AAAAAAAAGACCAAAAAGTGCGTATATATATACATATAAATATATATTTTAGATGAAGACTAACTCTGGGAGCATTTAACAGTGTTTTTT
GTTTCTGTTTTTAACATTTGTTTTCCTGCTTTAAAATTTGCAAGCATTCTCAGGAATTCTAGGGTAGGAAGCCAGTTTTTTGAAGATGGT
TTATTTAACCATATCTTATCCTAGAGAGATGGCTGTTTCTTTCCTGTTAATAAACTTTTACAAGTTCCTGAAACTTCAGAAAGTTTAAAC
AATTTTTACTTAAAAAAATGTAAAAAGAAAAGTCTCCAAACATTATTGTCATACTGGGGATCACACATTTTAAAACACATAGAAATATTT
TTTAAAAATTATCAATTTAGCAGCAACAGGTAAATTCATTATCTTAAAAATATGGGAGAAGGATTAAGCTTTGTAAGAGCTCGATCATGG
ATTCTTTTGAAATTGTGTGTAGTTTAATGGGAGAGTGTTTGGTGTATATAGATGAGAATGCCATCACTTTGTTCCTTTCCATTTGAGACT
GAACTGAAATCTCCCCTAGTAATTTTTATTTTTTTAAAGGAACCCTTCTCCTTGTCCCCACAACCCCAGCAACAAAAGAAAGGAAGGAAG
GAAGAAACAACAGCTTAAAAAAAAAAGTAATCTGTAAAATAGTACAGTTGGATTGCTGAGAATCTATGTAAAGAGTTAGGAAATATAGGT
TAATAATTTTTGGAACAAATTTTAAATATAGGCATTACTAGAGGAAAATTATCTATGGACTGTCCTATTAATGAAGAATGTCTGTCTTAC
CTCCGTTTGTTTTGGGAGGAGGAGAAAATATAGAAGAATCTAATAAGGAACAAGTGATTTTACTTTTTTAGCTCCCAGCTACTGTTGTGC
TCGTTTTAATTGCTGTTTTGAAGATCTGCTGCTTAATTATCCCCATCCCTTAGCCGGAGATGTGGAGTGTTTCCTTTCAGTTTTTGGTGA
TGTTGAATTCTTTTGTATTCCCTCCTGGGGCCAGGGGTCAGAATTCCCAAGCATGACCACAGCTTCTTTTAAACATTAAGCTTCCCAGTG
GGAAGGAAACTCCAGCTCGACAGGTAAAGGGAGTGGGTGGGGTTGCTGCCTGCAATTTCTCTAAAACCGCTTTAGTGCCTTCGTACATAC
ACCCAGACATCCTGAGCAAGGGGGACGCACATGTGTGTGTGTGTGGTCCAGTCACTCCACAGATGTAAGATACTCACCCATAAAGGAAAT
TGGAGTGGTTCTGGACAGGCCCCAAAGGCAGTGGGCTGAATTTAAAATAAATAAACAAACGTCAAGCAAGTTAATATGCTTATGTCTCAG
TAATGTAGAATGCCAAGTTCCTTCCTGTGTCGTGTGCCCTCCATTACTGTGCATTGATTCCTCCAGGTGTGTAATTGTGACAACTGCAGT
GATTTGGAAAGTCTCTTTGTCTTGGGCAAATAGAAGGGGTTCCTGTTGTTCTGCTCTTGTCCTTCGTCTCCTCCCCTTTTCCCCCAGACC
TCCCCCTTCTTTTTGTCAACTTGCTGGGAGCTTTGCTTTATTGGTTGGCAGTGACCTAAGAACAGGATATGGTGAGGATGTCATGGAAGA
GAAGAGCTCTTTCCGTGGTATTCTTTGGCAAGAGCCATGTCTACTAAGAGGTTAGATGACTTCAGTATACTTATAAAATTCAGTGAGAGT
GCCTTCTTCTCTTCTACCACACTCTGGCATAGATACAGGCTTGCTGGTCACCTCTCATTACATAGATTTATTTTAAAAACATTTTGATTA
TGTTAATTTGAGCTTTCCCTTTTTTTTTTTTAACTACTTTTTAAAACACTTGATTACTAGTGGCTTAGAGGTGTGTACATCTCCTGAACA
TCACAAACTTGGTTTCTACCTACCACACGAGTAGCCAAAAGAAAAGAAGCACTAATAGAGAAAGGGGTGTCTCACACCAGACAGAGGACC
TCTGCTGTCAATTAGATCCAGTATCATGACCTAACTTTAAGTGTGGAAAAGAGTTCAGATCTCTGAGACACTGTGAAGAAATGGATGGCT
CATGTAACATCTCTGATCCCTCAGTCCCCAACCCTGGACGTGTTTCATTTACAACATTCATAGGAGTTAACTTAGCAGTGTTGCAAGTTA
AGGTTCCAAACCAAATTATTTAATCAGTGTCCCCCCAATAAATCACTTATCCATTTATTGCTAGTTAGTTTTATTTATAGCAACTTGATT
TCCTATGAGTATGGCTCCTGTTGTAAGAATTTTCCCACCTCTTCTGACATGAATGTAGCATAAGTTAGCAATCGGTTCTTCCAAACTCCT
GTGGGTTGAATATGGTATAGAAGGTATGCAAGAGGAAAAAGAAAGGAAAAGATAAAACTCCTGCCTGAGAATTTGGAAGCACCTTTATTA
ACACATATATCTCGCAGAAACTAGAAGCTCATAGGCTGTTAACTTTTTGCAACTATTCACTCATTTTTACCACTTTTTTTTTTGGGTGAG
GGGGTGATTTTTGTAAGGTTAACAGCCAGATTCCATTTTGACCTCAGATGCTGTGTACTTTTTAATTTCATTTTTTATATTCTGCCATCT
TGACTCTTCTCTAAAACAGAATGAAAATGTCTGCATGCTGAGCAAAATGCTTACGCCAAGCCTGTTTTTCTCTGCAGAGTAAACAGGATG
TTTTCAGCAGACTTGGCTCTAATAGCCATCTCTAAGATTAGGGAACAATTGAGTCTTTATGTAGAAAAGATCCATTTTTTCCCCATCCTC
AGAGTTAAAATTCAACATTTAAAGCTTTATCGGTTATTGTTTTAGATTTGAGATTTTTGTTTTTAAGTATCTATAAGATCTTTAGAAGTG
AGATAAATTTTTCGCTGGTTAAAAAAAATCAAACTTTCCTCTGCAGTGTTTTTGCCAAGTTTTGTCACACTTCATGTGTATGCATTAACT
ATACTTCTTAGTGTTACTGCAAAAAAAAAAAACAAAAACAAAACAAAAAAAAGCCTTGTTCTTTAATTGTGTTTTTCCTCCTGTGAGTGG
ACAACTAAAGCCGCGTGATGATGCGGATGAAAATATTCTGGTCTGTGTGTATACAATGAATTGTCAGTCTTCAGACCTCATGGTCGTTAA
GAAAATAGGGAACTCACAAACCCTGCTGCGCACTACATTTACTTCTTTATCTGCAAGTACAGGGAGTCCATACAGTCAAGAAACACACAG
ATACACATAATGCTATTGAGGACATTGTCATTCTGTAAGAAAACAGAATATTATCTAGATTTCCAGAGTTAGTGCAGACCCTGTGATAAC
AGTCTGTGGGTTTGTGGCCAGCGCCAAAGGTGTGTGTATTTTCAGAAATGGTCCCTATTTGTCAGTGATAGTGTTTTTTTTTTCTTAAGT
TTGACAAAGGGGGTGGTAATATCACATTCTTTAGATTTGAAATAATTATCAGCTCCAAGAATCTGTGAACATAGTAATAACAATAAAAAT
TCAACATCGACCCTCCCTAACCTGCTCACCATACCTCCCCACCCCATGCCTCTGAAGAAAGAGGCCATGAACCTACGAGGTGGTAAAGGG
GGACACAGGTCAGGGAGTGGAGAGCTACTCCTCCAGCAGCTCAGCACCCACACTGCCCGCATGCGTGTGGCCACCGGGACCAGATCCCGA
GTGATTGTGGCATACCCCTAATATTTGAGTAGTTTTTAAGCTGTCAGTCTCTTGTCATAACCTCCTACCGCCACCCAAAAAAGTAACGAA
AGTTGCAGTAACTGCCAGTGTTTGCCTCACCAAATTTAAATCGTTCCCTTTTCAGTTAGCTATATACCTGAATTTGTTTTTAACAAGAAA
CTGTACATGGCCAGGAAAAATGGTACTACCTTGGCCAAAGGGTCTTTGCAAAAAGCTCAGTCTTCAGTTCTTCACTGTGACAAATGCTTA
TCTTGTTCATGGGAGGGGAAAGATCAGATAAATAGGCAAGAAGTACTCTGTTTTAAATAAAGAATAAATAGTGTCCGTTTAAAGCACTTT
GTGCCTCAACTTCATTTTTAAACTGTAAATCATTGCTTTGGAAATAAATTCCCAATTATAATTGACCCATATCTAGCCAATATCAACAAG
TTGGGATGGTTTTTGTTTTTTTCTTTTTTTTCAAAAAGGGAAATTCCTCTTTACTGCTCACAGTAAGCTGCAAAAGAAAGTTGTCAAGGT
GGCTTATGATGCTGTTGTAGCAGAGCTGTGAAAGGAAGTGCTTTGCTTTCTCTCCCGCCTTCCGGAATCTGGCGTTCCTTCCCCTTCGGC
TACTGAAAGGTGTGTACAACTCCCAGAGGGGTGGCTGTAAAAGTTGACTGGAGGCAAAGTGGAGTGGCCTTATTGCCAGGACTAGCCCTA
CAGAAGAGCTTTACAGAGAGGAGGACAGTACATCCTATGTGTGTTCGCCAAAAATGGGAAAGGTGGGTATTTAGGCAAAACAAAATAAAA
ACCTTTGGAACCCTTTAAGAAGTTACATACCTTTTAAAGGTAGTATAGTTTCTCACCAAGTGATGCATTTTAGCATGACACTTCTTGCCA
GAAATTTTGGGATAAGTTGGAATAAATGTGTTTAAAACATCATCCACCGCCCTTTTTAAATTTTGTCTAAGGAATTACTTAAGTATAGTA
TTTCTGAATGTGCCTTTGTGAGTACAGAGACCGTCCGTTCTAGGAAGAAGCTATCCGTTGGATACAAACAAACAGACGGTCAGCTTTAGT
CATTAGGGAAGTCAAAGTTCCTCCTGGAAGTCCCAGGAGCAGCTGTTGAGATTTCATTAGCATCAATATTGCACAGTGTAGAGTTGAGTG
GAAGAGATTCTGGGACTTGGGAGAGGAGACAGGGGAAGGTACCCAGGCGACGCAGACCCACGTTAGTCCAAGAGCGCAGGTTTACACATC
TGCATTCCCTAGTTTTCTCCGTCTGTATGTTTGTGCTCATGTGGCTTTGGCTGTTTTGTTTTTTGTTTTTCTGTAAGCACTGGAGAATTG
GAATATGGTGATACTTGTGACACATTCATGCATGTAAACAAGGCATTTTCCAGCTTCTGCCGTGTGCAGAGCGGGCAGCACGCTTTTACC
CTTTGAGTCTGTGTCCTGAGGCGGCCATTACATTCCCACATGGGCGTCACATCACGTTGCTGTTGATGCAAACAGGGTATTACACACAAG
GAAAAGGGGTTTTGAAGAGTTAAGATTGAAGTGTTTGAGAAAGAAAAGAGAAAAATCTGAAATCATATTTTATTTCTTCAGAGCTATTAT
AGTTGAACACAGAAATCTGCAGTGTCTTTATTTGTTTTTATGTTTTAAACAATTTCACCTCTTCTCCCCACTCCTATCTTCTAAAGAAAT
ATCAAGCAAATGCTAAGGGCCATTTCCATGATTCCTCAGAGCTCCCCCAAAGAGGAGAACAGTCCCTCCCACTCGATTCCTTCAGCTTCA
TTCAGGAAGACACAGGGAGGAGAGATGCTGCTTCTGCGCTTTGCTCTCATTCCTCTCTCATGGCCTTGAAATGTATTATTATGCAAATGT
GAATTTTGATACTGAATTTAAGAAGAGGTTGTTGGATTTTTTTTTTTTTTTTTTTTTTTTTCAAAAAAAAAAGTCCCACATGTGGTCATC
GTCGCTTCTTTATGTTGTAAGGTGAATTGTAACTATGCATTCTGCAAAGGGGGTGGGGAGGAGAGGGCAGAAAGGGGAAGGGAGTAGCGT
TGCATCCTTGTTCTTCAGTTTCTGTGTCCATGGTGTCCCCGTGTCCTGGAGGGGAAGGGGAGTGAGAGACGAATGTGGTAAGGTCAGCAC
AGTGAGATAGAGACCTCTGAGTCCTCTTGCCACTGTTGCTGGCAGGTCTGATGGCCAGGTAAATTCCAGGGGGCCTGCAGTTCCTGTCAA
CCAATGTGGTTCAGGATTCTTGATCCTAGCCGTGCAGTGTTAATCCAGTGCAGCAATGGAACTCCACAGGCTCCAGTGTTCTCTGGAAAA
AGTACTCATCCTTTCCTGAATTCAGAGCCCTTCAAGCTCAGGAAACCACGCTTCACTCGTGCTGACCTGAAAGTTAATCTTTAGGTCGAT
TTTGAAAAACTCCGCCTCCTCTCTCCTTTTTAATATTTCTTTCTTCCTTTTTAATCATGTTTAAGTGAACTTACTCTTAGTTATAAGGAA
CTGTCCTGCTTTGTGGGGAAGAGGGCTGTTGCTTGTCAGGCAAAAAAGTTTTCTCTTCCTACCCACCATCCCTCTCTCTGCTTCCCTTGC
ATTTGGCAGGCTGTATGAAGCCAATGAGCTGCGAGGTGTTTTGACAGGGGAGGTCTGCATGCAGCCTCTTCTTTGTCCTAACAATTCCTT
TGTTGATCTTGCCTGTGATGAATCATAGCGCCTGCATTGCTCTGGTCTAGGCATTATTTGCAACACACAGTATCGTAAGCGAGAGATTGT
TCTGCCTATATTCAGTGTTTTCCATGCAGCAATTCTTCTTGTTGACGTTCACAGTACTGTAACGAGTAACAGACTTGATCACAGTCTCCT
CGTGCCTGTGCAGGGCTGCACAGGCATGATCTTATCAGGGTTCCAATCTGTTAGATTGCCTTTAAACAAAAAAAACAACAAAAAAATAAA
ATCCTGACGTTTCAACTGTCTCACACAAAATAATACCTCGAGGTACATTTCCCCCTGCAATGTAAACCCTTAACTCCTCTCTCCTTTCTG
ACATCAGTGGATTATCCTTTTTAAAATATGAACATGTAAATAGCAGGATAACTTTAAAAAACATTTTCTTTGCTGTGAAAGTAACCCTAA
AATATGTTTTCTTCTTTTGTATTTTTTTGGTTTTTGTTTTTAAGCCATCAGAAGTTTCAGATCTTTACTCTTTCATGTTTAAGAAGAAAG
AGCAGAGGAGGTCGGGGGAGCCGGTTTGCATTTGTGTTGGAGGGGTGTTATCTCCATTGCCTCCCACACAGTGACAGCAGACCAGTATGT
AAACCCTGTCTTGGCTGGGCGCGGTGGCTCACACCAGTAATCCCAGCACTTTGGGAGGCTGAGGCAGGCAGATCATCTGAGGTCAGGAGT
TTAAGACCAGCCTGGCCAACATGGTGAAACCCCGTCTCTACTAAAAAATTAGCCGGACGCAGTGGCGCGCGCCTGTGGTCCCAGCTGCTC
GGGAGGCTAAGGCAGGAGAATTGCTTGAACCCGGGAGACGGAGGTTGCGGTGAGCCGAGATTGCACCACTGCACTCCAGTGTGGGCAACA
GAGCAAGACTTCGACTCAAAAACATAAAATAAACAAAAGACACACACACACACAAAAACCCTGTCTTAAATAGCTGCCATCTCTTCCAGC
AATCTAGTGCCAGGGTAAGAAGTGTCTGAATTTCTCTCTTCCAGCAGATCCATCCCCTGCAGGGACTCCAGAATGTTCTCCACACAATAC
CTGGAGCTCTCAACCTTTCTTGGTTCAGACACACACATACACACCCCTTGAGTAACTCAGTATCATTTTGTAGTTCACAGAAGGATGTAG
TCCCTGGCATTTTGGTTTGCACTGTAGAATCCATAGCCTTGTCACTTTGTTATGCTCTGGAAATGTACTGATTTCTTACTTGGGAGGAAA
CTTGTGTAAGGAGATGTGCAAACCACCCTGAAAGCCATGTGCATCCTCACCTCTTCCATTACCCCCTCCATGAGCTCGAAGCGACATTAA
GTAGAGGGAAATGCTTTTAACAAATGCTGCTCATGTGGATCTGTCAGCTATTGCTTGCCTAGATTTGGGCACCCATGAAGCAGGGTTGGA
ATGGATCATTTTGAATTGCTTCTTTGCAGACACCCCCTTCGCCCCCATCTTTAAGATAAACCCTTTACTAGTCAAGAAGCCCTTTTCAGT
TGGATCTCACTGATCTTGTATAGTGACGACTTCCTTTGAAGGAAGAAGCTTGATTATAAGTGCATGCATATTATCCACCCACCTTCTGAT
TTGGGCACTGTTCACCTTGGAATTTTATTTATTTTGTTTATCTGGAGGCCCTTTTTCTATCAGTCTCTGATCCCTCATGGGTTCTGCCTG
CCCTTGTATCTCTTGTACAATGCTCCCAAAGGGCTTTGCTGATCTCTGCACTTCTTTCCTGGGACACTCCCCCCACCACCACCCTTTGCA
CACACCAGTGACCAAAGTGTATGCAGTGATCTCACAGAAGACATCAAAAATGGTGCATGCACCGTGAATGTGCTCACAGAGACACGTGCA
CAAGATTCTGCACCCTTGGCCTTAATCTCAGTATGACTTAAGGTGCAGGAACATTTTTAACAGGTTTTAAAAAAACAAAAAACCCTTCTG
GGAGGAAAAAAATAAAAAGCAGATACAACAGCTCAACTGTTCCCACTCCTAACTCTCCACTATGTGCTTATAACTTCACATTCTATGCCC
TCCCCGCCACCCACCTCATCCCTGTTCTGCGTAACCAAAAAACAGACAACAAAAGCAACCTGAGGAGAGGTTTCTGGACTATTTTATCTG
TCTCCATTTAGATGGAGATATAAATGCTGCTTTGGGTTCCATAATCCTAGGGGGCTATGTTTACATAGTAAAATACATCCTACCAAATCA
GGAAACAGTGAATAATGGGAGTCACTTCACAGAGACGCAGGAGGACCTGGGGGGCGTAGCAGAGGAGGATAGGTAGAGAAGTACCATTTT
AATTATTTGTGACTTGTGGCTTCCTTCCTCCTCTCCTCCTCCCTCCACGTCTCTCTTTGCCCCCTTTAGACAGAAGGTGCAGAAAAGGGC
ATCAAAAAGAGGCTGGATTTTTTAAAAGGCAGCTTTCCAACTTTGCACACAAACAGGTAACAGGAAGGTACAGCAAAAATCCTCTCATCT
GAAACACTGTCAGCAGAAACAAAACCTGTAAAAATGACTAATCAGCTGCACATATTGATGCTCTCTGCAAGTTACCTTTAAGTGTTTTTT
TTTTCTTATACTTGAAGTTGCTTTTACGATATTATTTTGGTGGCTTTCTTTTCTCTCTTTGATGGGCAATAGAGGAAGTAGATAATGGGA
TTTAAGGACGCCTGGGGGAGAAAAGGGAGGATGTGGCATTGTCTTTTTTTTTTTTTTTTTTTTTTTTTTTAGCATAGAGGTTTAATCAAA
CTCCCATATGTTGAAATTGCTCCTCATATTACTGGTTTTACATGGACACAGAAACTAGGCACTTTAGAGGTGCACTTGCATGGCAGGCTG
GGCCCCCTTTTCTATATTTTATTTTCCTTTTTAGTATAGTGGTACTTAAAATCACTGGTTCACTTAAAAAAACAAACAATAAAATGTTAA
ACTCTACTAATGTACAAATAAGCTGAAAAGTTGCATTTTATGTGTATTTTTTGCCATAGCAGGTACTGTATTTCTCATGCTGGATTTCAA
AAAAAAAAAAAAAAGTATCAAAAACAAAAAAAACTAAAGGGTGGTGTTTTATTGGATTGTGACAGGTTGAGTAATAAGGAATTAAGTCGT
CGTCATTTCATTAAAACTGAGAGATGATGTAATGCATATATAAGAGTTTTCTGAAGGGTTTTTTTTGGGCTTTTAAACAGCTTATTTTTG
TTTTTGTTTAGTTTTTTTATTTTATTTTATTTTGGAAAGATATGATTGTATTATGTGCAACTCAGTTGCTTACATTATAACTACAAAATA


Top

FusionGenePPI for SGSM3_TNRC6B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SGSM3NF2, RPL35, PDCD6IP, NTRK1, RAB5A, RAB5B, RAB5C, RAB39B, NXF1, HLA-B, SNCA, KLF8, LEMD2, TRIM25TNRC6BAGO1, AGO2, GIGYF2, UBC, AGO3, AGO4, PABPC1, CUL3, CUL2, CUL1, COPS5, DCUN1D1, CAND1, NEDD8, UBQLN4, LATS2, SAV1, CARM1, APBA3, CSK, FBRS, GMPS, NUP155, FLAD1, CHEK1, GARS, TRIM65, PFAS, NXF1, BMI1, CNOT1, CNOT2, CNOT6, CNOT6L, CNOT7, CNOT8, CNOT3, PAN3, BTRC, MED4, MED23, SSX2IP, OFD1, B9D2, MKS1, CEP97, CEP104, CEP120, CEP152, CNTROB, CEP128, CEP135, CEP44, CEP63, CNTRL, FBF1, NINL, NIN, NPHP1, ODF2, RPGRIP1L, SCLT1, SASS6, RPGRIP1, STIL, CENPJ, CLTC, KAT6A, GTSE1, RNASEH2B, G3BP1, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000301923+12241_9944321030argonaute proteins
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000335727+9211_99411261724argonaute proteins
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000402203+12241_9944321030argonaute proteins
TgeneTNRC6Bchr22:40804846chr22:40696459ENST00000454349+11231_99412361834argonaute proteins


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SGSM3_TNRC6B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SGSM3_TNRC6B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTNRC6BC0032460Polycystic Ovary Syndrome1CTD_human