FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33295

FusionGeneSummary for SERPINA3_LAP3

check button Fusion gene summary
Fusion gene informationFusion gene name: SERPINA3_LAP3
Fusion gene ID: 33295
HgeneTgene
Gene symbol

SERPINA3

LAP3

Gene ID

12

51056

Gene nameserpin family A member 3leucine aminopeptidase 3
SynonymsAACT|ACT|GIG24|GIG25HEL-S-106|LAP|LAPEP|PEPS
Cytomap

14q32.13

4p15.32

Type of geneprotein-codingprotein-coding
Descriptionalpha-1-antichymotrypsincell growth-inhibiting gene 24/25 proteingrowth-inhibiting protein 24growth-inhibiting protein 25serine (or cysteine) proteinase inhibitor, clade A, member 3serpin A3serpin peptidase inhibitor, clade A (alpha-1 antiproteinasecytosol aminopeptidaseLAP-3epididymis secretory protein Li 106leucyl aminopeptidasepeptidase Sproline aminopeptidaseprolyl aminopeptidase
Modification date2018052320180519
UniProtAcc

P01011

P28838

Ensembl transtripts involved in fusion geneENST00000393078, ENST00000485588, 
ENST00000393080, ENST00000467132, 
ENST00000482740, 
ENST00000226299, 
ENST00000606142, ENST00000503467, 
Fusion gene scores* DoF score6 X 8 X 4=1925 X 4 X 5=100
# samples 105
** MAII scorelog2(10/192*10)=-0.941106310946431
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SERPINA3 [Title/Abstract] AND LAP3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-HP-A5MZ-01ASERPINA3chr14

95090392

+LAP3chr4

17585225

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393078ENST00000226299SERPINA3chr14

95090392

+LAP3chr4

17585225

+
In-frameENST00000393078ENST00000606142SERPINA3chr14

95090392

+LAP3chr4

17585225

+
5CDS-intronENST00000393078ENST00000503467SERPINA3chr14

95090392

+LAP3chr4

17585225

+
intron-3CDSENST00000485588ENST00000226299SERPINA3chr14

95090392

+LAP3chr4

17585225

+
intron-3CDSENST00000485588ENST00000606142SERPINA3chr14

95090392

+LAP3chr4

17585225

+
intron-intronENST00000485588ENST00000503467SERPINA3chr14

95090392

+LAP3chr4

17585225

+
In-frameENST00000393080ENST00000226299SERPINA3chr14

95090392

+LAP3chr4

17585225

+
In-frameENST00000393080ENST00000606142SERPINA3chr14

95090392

+LAP3chr4

17585225

+
5CDS-intronENST00000393080ENST00000503467SERPINA3chr14

95090392

+LAP3chr4

17585225

+
Frame-shiftENST00000467132ENST00000226299SERPINA3chr14

95090392

+LAP3chr4

17585225

+
Frame-shiftENST00000467132ENST00000606142SERPINA3chr14

95090392

+LAP3chr4

17585225

+
5CDS-intronENST00000467132ENST00000503467SERPINA3chr14

95090392

+LAP3chr4

17585225

+
In-frameENST00000482740ENST00000226299SERPINA3chr14

95090392

+LAP3chr4

17585225

+
In-frameENST00000482740ENST00000606142SERPINA3chr14

95090392

+LAP3chr4

17585225

+
5CDS-intronENST00000482740ENST00000503467SERPINA3chr14

95090392

+LAP3chr4

17585225

+

Top

FusionProtFeatures for SERPINA3_LAP3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SERPINA3

P01011

LAP3

P28838

Presumably involved in the processing and regularturnover of intracellular proteins. Catalyzes the removal ofunsubstituted N-terminal amino acids from various peptides.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393078+55235_237503424DNA binding.
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393080+55235_237504424DNA binding.
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000467132+55235_237504424DNA binding.
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393078+55369_394503424RegionNote=RCL
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393078+55381_389503424RegionNote=O-glycosylated at one site
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393080+55369_394504424RegionNote=RCL
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000393080+55381_389504424RegionNote=O-glycosylated at one site
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000467132+55369_394504424RegionNote=RCL
HgeneSERPINA3chr14:95090392chr4:17585225ENST00000467132+55381_389504424RegionNote=O-glycosylated at one site

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for SERPINA3_LAP3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_897aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTG
NASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQP
GPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQSGGSWASXQQXIISLAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYD
DLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAK
GSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKA
NKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMP

>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_897aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTG
NASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQP
GPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQSGGSWASXQQXIISLAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYD
DLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAK
GSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKA
NKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMP

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_898aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTG
NASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQP
GPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQSGGSWASXQQXIISLDTGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEY
DDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVA
KGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGK
ANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRM

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_898aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTG
NASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQP
GPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQSGGSWASXQQXIISLDTGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEY
DDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVA
KGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGK
ANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRM

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_679aa
MPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREI
GELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRP
FLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQPGPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQ
SGGSWASXQQXIISLAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQ
LMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGI
SIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTF
NPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEF

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_679aa
MPFDPQDTHQSRFYLSKKKWVMVPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWRDSLEFREI
GELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHKAVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRP
FLMIIVPTDTQNIFFMSKVTNPKQAXSLPSSSGALSKELGMQAGCLGLWAQPGPCAPSGHGMCGPVCLSLEGDSDSLCSSHMHRGPWTLQ
SGGSWASXQQXIISLAGCRQIQDLELSSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKMAVSAKLYGSGDQEAWQKGVLFASGQNLARQ
LMETPANEMTPTRFAEIIEKNLKSASSKTEVHIRPKSWIEEQAMGSFLSVAKGSDEPPVFLEIHYKGSPNANEPPLVFVGKGITFDSGGI
SIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTF
NPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_2691nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATG
GTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGC
AATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGA
GACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAG
CTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAG
GCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGG
ACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCC
AAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCT
GGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATG
CACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGCGGGGTGCAGGCAGATTCAA
GACCTGGAGCTCTCGTCTGTGGAGGTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATACGAT
GACCTAAAGCAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCT
TCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTC
AAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAA
GGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGA
ATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGC
TCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCC
AACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGAT
GCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGT
GCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCT
CTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACA
GCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCC

>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_2691nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATG
GTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGC
AATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGA
GACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAG
CTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAG
GCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGG
ACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCC
AAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCT
GGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATG
CACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGCGGGGTGCAGGCAGATTCAA
GACCTGGAGCTCTCGTCTGTGGAGGTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATACGAT
GACCTAAAGCAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCT
TCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTC
AAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAA
GGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGA
ATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGC
TCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCC
AACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGAT
GCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGT
GCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCT
CTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACA
GCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCC

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_2694nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATG
GTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGC
AATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGA
GACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAG
CTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAG
GCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGG
ACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCC
AAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCT
GGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATG
CACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGACACGGGGTGCAGGCAGATT
CAAGACCTGGAGCTCTCGTCTGTGGAGGTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATAC
GATGACCTAAAGCAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTT
GCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAAT
CTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCC
AAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAA
GGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATA
TGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAG
GCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCT
GATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCA
GGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATG
CCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGT
ACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTT

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_2694nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATG
GTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGC
AATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGA
GACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAG
CTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAG
GCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGG
ACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCC
AAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCT
GGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATG
CACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGACACGGGGTGCAGGCAGATT
CAAGACCTGGAGCTCTCGTCTGTGGAGGTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATAC
GATGACCTAAAGCAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTT
GCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAAT
CTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCC
AAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAA
GGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATA
TGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAG
GCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCT
GATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCA
GGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATG
CCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGT
ACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTT

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_2037nt
ATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGATGAGTTTGCATCAC
CTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGCACTCTTCATCCTC
CCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGAGTTCAGAGAGATA
GGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGAGGAAGCCTTCACC
AGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGATGTATTTGAGGAG
GGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCGTTTCAACAGGCCC
TTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTAGAGCTTGCCATCA
AGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGCACCGAGTGGCCAT
GGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCCATGGACTCTTCAG
TCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGCGGGGTGCAGGCAGATTCAAGACCTGGAGCTCTCGTCTGTGGAG
GTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATACGATGACCTAAAGCAAAAAAAGAAGATG
GCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAA
TTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAG
GTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTC
TTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATC
TCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAG
CTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGA
GCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTT
AACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCA
TCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAG
GTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTC
GTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGG

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_2037nt
ATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGATGAGTTTGCATCAC
CTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGCACTCTTCATCCTC
CCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGAGTTCAGAGAGATA
GGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGAGGAAGCCTTCACC
AGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGATGTATTTGAGGAG
GGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCGTTTCAACAGGCCC
TTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTAGAGCTTGCCATCA
AGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGCACCGAGTGGCCAT
GGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCCATGGACTCTTCAG
TCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGCGGGGTGCAGGCAGATTCAAGACCTGGAGCTCTCGTCTGTGGAG
GTGGATCCCTGTGGAGACGCTCAGGCTGCTGCGGAGGGAGCGGTGCTTGGTCTCTATGAATACGATGACCTAAAGCAAAAAAAGAAGATG
GCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAA
TTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAG
GTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTC
TTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATC
TCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAG
CTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGA
GCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTT
AACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCA
TCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAG
GTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTC
GTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_3029nt
ATTCATGAAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGCAGAGTTGAGAATGGAGAGAAT
GTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCT
GACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTT
AGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATAC
CACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCG
CACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCAC
GGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGT
GAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAA
AGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGAT
GAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGC
ACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGA
GTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGA
GGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGA
TGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCG
TTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTA
GAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGC
ACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCC
ATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGAAAAAAAGAAGATGGCTGTGTCGGCAAAGCT
CTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGC
CAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAA
GTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAA
AGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGC
AAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAA
TATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGAC
CATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCT
CAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAA
ACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCT
TGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTG
GGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCT
CATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAAC
TTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGC
CTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGAT
TAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAAC

>In-frame_SERPINA3_ENST00000393078_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_2995nt
ATTCATGAAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGCAGAGTTGAGAATGGAGAGAAT
GTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCT
GACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTT
AGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATAC
CACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCG
CACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCAC
GGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGT
GAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAA
AGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGAT
GAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGC
ACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGA
GTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGA
GGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGA
TGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCG
TTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTA
GAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGC
ACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCC
ATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGAAAAAAAGAAGATGGCTGTGTCGGCAAAGCT
CTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGC
CAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAA
GTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAA
AGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGC
AAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAA
TATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGAC
CATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCT
CAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAA
ACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCT
TGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTG
GGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCT
CATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAAC
TTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGC
CTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGAT
TAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAAC

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_3021nt
AAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGCCAAATGGG
AGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGATGAGTTTGCATC
ACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGCACTCTTCATCC
TCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGAGTTCAGAGAGA
TAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGAGGAAGCCTTCA
CCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGATGTATTTGAGG
AGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCGTTTCAACAGGC
CCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTAGAGCTTGCCAT
CAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGCACCGAGTGGCC
ATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCCATGGACTCTTC
AGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGACAAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAA
GTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGA
TGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGA
TTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCC
CCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGG
ACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAG
GTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGG
TTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCG
CCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCG
AGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATG
TTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATT
TAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGT
TCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGG
TTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTT
TTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTT
TTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAACATGAGCAA

>In-frame_SERPINA3_ENST00000393080_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_2987nt
AAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGCCAAATGGG
AGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAAGTGGGTAATGGTGCCCATGATGAGTTTGCATC
ACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAAGTACACAGGCAATGCCAGCGCACTCTTCATCC
TCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAAGCGGTGGAGAGACTCTCTGGAGTTCAGAGAGA
TAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACATACTTCTCCAGCTGGGCATTGAGGAAGCCTTCA
CCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGTGGTCCATAAGGCTGTGCTTGATGTATTTGAGG
AGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGTGGAGACAAGGACCATTGTGCGTTTCAACAGGC
CCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGTCACCAATCCCAAGCAAGCCTAGAGCTTGCCAT
CAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTGGGCACAGCCTGGCCCCTGTGCACCGAGTGGCC
ATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAGCTCTCACATGCACAGGGGCCCATGGACTCTTC
AGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGACAAAAAAAAGAAGATGGCTGTGTCGGCAAAGCTCTATGGAA
GTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACGCCAATTGATGGAGACGCCAGCCAATGAGA
TGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAACCGAGGTCCATATCAGACCCAAGTCTTGGA
TTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGTCTTCTTGGAAATTCACTACAAAGGCAGCC
CCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGGTATCTCCATCAAGGCTTCTGCAAATATGG
ACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGCAAAGCTTAATTTGCCCATTAATATTATAG
GTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGTTAGAGCCAAAAACGGGAAGACCATCCAGG
TTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACACGTTTAACCCGAAGGTCATCCTCAATGCCG
CCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAATTCATCCTGGCTCTGGAACAAACTCTTCG
AGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAGACAGGTTGTAGATTGCCAGCTTGCTGATG
TTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGAATTCGTAACTCATCCTAAGTGGGCACATT
TAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGACTGGGAGGCCCACAAGGACTCTCATTGAGT
TCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTGTCTTAAATTGGACAGTTGAACTTAAAAGG
TTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAGAACACAATGAAATTTGTATGCCTTGATTT
TTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTTTTAAGATACTCTATAAATGATTAAAATTT
TTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACTCAGATTTGTGATGCTAGGAACATGAGCAA

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000226299_chr4_17585225_+_3860nt
AAGTTGACCTGGGCCCATTTGAAAATTCCTTTTGCTCCCTCATTTTAACCCCTAAAGTAAAGCCGTTTGTGACTTTATGAGCTTTTACCA
AGCATCTCCTAAAACCAAGAATGGAGGTGAAAGATTGTGGAGCCCACAACCTAGAGAAAGGATTGACAATTTTTTTTCCATAAAGGGCCT
AGTAGTATGTATTTTAGGCTGTGTGGTCCACATGAGGGCAGATTCTTCTTTTTGACTTCCTCCTCTGCATCTTCTTCATCTTCTCTTTCC
TCTTCATTTTTTTTACAACCTTTGAAAAATATAAGCACCATTCTTAGCTTTAGGTACACACAAAAATAAGCTATGGCTGTATTGGCTTAC
AGGCTATAGTTTCCTGACCCCTGTTCTAGGGGAGGAAAATAATTGTACCCAACTAAATGCGTGCGAATCATGGGCCTATGTCATGATTCC
CAAAGAATGAGTTTCATGGAATTTTCAACATTTTAAATATTTTACTCCATTCTTCCCTTGCTTGCATAGTTTCTGATGAGAAGTCTGCTG
TCATTTTCATCCTTATTCCTTTTTAGATAAGGTGGAGTTTTCCTCCCTCTGCCTCTACCTCTACCTCTTTCAAGATTTTCTCTTTCTCTT
TACTATGGTAAATAGGCCTTTAGTGAGAGGAGTTATGTCAGCCTGGCTAGGAGTCAGGCTGCATTTCAGGTTTGTGATAGCTAGAGGTAC
CAGAGGCAGTTTCATGGAATTTTACCTTTGCAACACTGAGAGCCTAGGCAGCCTCAGAGTCAGAACACCCACAGTTGAATCCTCAGCCTG
ACAGACACTGAATCCAGGGCAAATCTTAGCTGAATATTCATGGTCTGTAGAGGTGGACATGAGCTAGATATGAGCTAAGGACCATAGCCA
GCTCATGGCTTTTGTGATGTCCAACACCGCTATCCTCTAAGATGTCACAAGTGTCCCTAGGCTTTTATTCCCATGGTCTCTCCTGGCTCT
GAGTTCTATCTTCCATTAAGGTTCTTCCTGTTCCTCCCCTCATTCACACTGATTGGCATCTCTTCTGTCTGCCCTCACCAACTCACATAC
AGAACCCAGTCTCTTTCCTCTTATTTCCACCCAAAGCCCTCCCACAAGCCACTGTTATATGTTCACATCCCTGTAATACCAGTGAGTAAT
AATTGCTAATGAGACATTTTTCCTTTTATGGAACAAAGGCTGTCCCATTTCTCCTCAGGCACCAGCCTCCCACATGTTGTCATGCCTCTT
TCCCCCACTTTCCCTAAACCTTCTTTCTCTCTTGCACTCCTTATTCCCTGGTTCCTATTGATTTCTCATTTAGCACAAGGAACTAGGTCT
TTCTTTTGTGGCCCTTTTCCCAATCCAAGCCTGCTGGGCTCTCCCTCACCCCCAATAACTTTTACTCTTGCCAAGCTACTTCTCTAAACC
AAAGCAGGGTCCCTCCTATGAGGGACTCTGGGCACTTCCACTGCTGCGGAAGCAGGGTCGAGCAGGGCGACCCTTGCACTCACACCTTCT
CCAACTGCTTGCTCCACCTTCAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAA
GTGGGTAATGGTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAA
GTACACAGGCAATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAA
GCGGTGGAGAGACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACAT
ACTTCTCCAGCTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGT
GGTCCATAAGGCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGT
GGAGACAAGGACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGT
CACCAATCCCAAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTG
GGCACAGCCTGGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAG
CTCTCACATGCACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGAAAAAAAGAA
GATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACG
CCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAAC
CGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGT
CTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGG
TATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGC
AAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGT
TAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACAC
GTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAA
TTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAG
ACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGA
ATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGAC
TGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTG
TCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAG
AACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTT
TTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACT

>In-frame_SERPINA3_ENST00000482740_chr14_95090392_+_LAP3_ENST00000606142_chr4_17585225_+_3826nt
AAGTTGACCTGGGCCCATTTGAAAATTCCTTTTGCTCCCTCATTTTAACCCCTAAAGTAAAGCCGTTTGTGACTTTATGAGCTTTTACCA
AGCATCTCCTAAAACCAAGAATGGAGGTGAAAGATTGTGGAGCCCACAACCTAGAGAAAGGATTGACAATTTTTTTTCCATAAAGGGCCT
AGTAGTATGTATTTTAGGCTGTGTGGTCCACATGAGGGCAGATTCTTCTTTTTGACTTCCTCCTCTGCATCTTCTTCATCTTCTCTTTCC
TCTTCATTTTTTTTACAACCTTTGAAAAATATAAGCACCATTCTTAGCTTTAGGTACACACAAAAATAAGCTATGGCTGTATTGGCTTAC
AGGCTATAGTTTCCTGACCCCTGTTCTAGGGGAGGAAAATAATTGTACCCAACTAAATGCGTGCGAATCATGGGCCTATGTCATGATTCC
CAAAGAATGAGTTTCATGGAATTTTCAACATTTTAAATATTTTACTCCATTCTTCCCTTGCTTGCATAGTTTCTGATGAGAAGTCTGCTG
TCATTTTCATCCTTATTCCTTTTTAGATAAGGTGGAGTTTTCCTCCCTCTGCCTCTACCTCTACCTCTTTCAAGATTTTCTCTTTCTCTT
TACTATGGTAAATAGGCCTTTAGTGAGAGGAGTTATGTCAGCCTGGCTAGGAGTCAGGCTGCATTTCAGGTTTGTGATAGCTAGAGGTAC
CAGAGGCAGTTTCATGGAATTTTACCTTTGCAACACTGAGAGCCTAGGCAGCCTCAGAGTCAGAACACCCACAGTTGAATCCTCAGCCTG
ACAGACACTGAATCCAGGGCAAATCTTAGCTGAATATTCATGGTCTGTAGAGGTGGACATGAGCTAGATATGAGCTAAGGACCATAGCCA
GCTCATGGCTTTTGTGATGTCCAACACCGCTATCCTCTAAGATGTCACAAGTGTCCCTAGGCTTTTATTCCCATGGTCTCTCCTGGCTCT
GAGTTCTATCTTCCATTAAGGTTCTTCCTGTTCCTCCCCTCATTCACACTGATTGGCATCTCTTCTGTCTGCCCTCACCAACTCACATAC
AGAACCCAGTCTCTTTCCTCTTATTTCCACCCAAAGCCCTCCCACAAGCCACTGTTATATGTTCACATCCCTGTAATACCAGTGAGTAAT
AATTGCTAATGAGACATTTTTCCTTTTATGGAACAAAGGCTGTCCCATTTCTCCTCAGGCACCAGCCTCCCACATGTTGTCATGCCTCTT
TCCCCCACTTTCCCTAAACCTTCTTTCTCTCTTGCACTCCTTATTCCCTGGTTCCTATTGATTTCTCATTTAGCACAAGGAACTAGGTCT
TTCTTTTGTGGCCCTTTTCCCAATCCAAGCCTGCTGGGCTCTCCCTCACCCCCAATAACTTTTACTCTTGCCAAGCTACTTCTCTAAACC
AAAGCAGGGTCCCTCCTATGAGGGACTCTGGGCACTTCCACTGCTGCGGAAGCAGGGTCGAGCAGGGCGACCCTTGCACTCACACCTTCT
CCAACTGCTTGCTCCACCTTCAGCCAAATGGGAGATGCCCTTTGACCCCCAAGATACTCATCAGTCAAGGTTCTACTTGAGCAAGAAAAA
GTGGGTAATGGTGCCCATGATGAGTTTGCATCACCTGACTATACCTTACTTCCGGGACGAGGAGCTGTCCTGCACCGTGGTGGAGCTGAA
GTACACAGGCAATGCCAGCGCACTCTTCATCCTCCCTGATCAAGACAAGATGGAGGAAGTGGAAGCCATGCTGCTCCCAGAGACCCTGAA
GCGGTGGAGAGACTCTCTGGAGTTCAGAGAGATAGGTGAGCTCTACCTGCCAAAGTTTTCCATCTCGAGGGACTATAACCTGAACGACAT
ACTTCTCCAGCTGGGCATTGAGGAAGCCTTCACCAGCAAGGCTGACCTGTCAGGGATCACAGGGGCCAGGAACCTAGCAGTCTCCCAGGT
GGTCCATAAGGCTGTGCTTGATGTATTTGAGGAGGGCACAGAAGCATCTGCTGCCACAGCAGTCAAAATCACCCTCCTTTCTGCATTAGT
GGAGACAAGGACCATTGTGCGTTTCAACAGGCCCTTCCTGATGATCATTGTCCCTACAGACACCCAGAACATCTTCTTCATGAGCAAAGT
CACCAATCCCAAGCAAGCCTAGAGCTTGCCATCAAGCAGTGGGGCTCTCAGTAAGGAACTTGGAATGCAAGCTGGATGCCTGGGTCTCTG
GGCACAGCCTGGCCCCTGTGCACCGAGTGGCCATGGCATGTGTGGCCCTGTCTGCTTATCCTTGGAAGGTGACAGCGATTCCCTGTGTAG
CTCTCACATGCACAGGGGCCCATGGACTCTTCAGTCTGGAGGGTCCTGGGCCTCCTGACAGCAATAAATAATTTCGTTGGAAAAAAAGAA
GATGGCTGTGTCGGCAAAGCTCTATGGAAGTGGGGATCAGGAGGCCTGGCAGAAAGGAGTCCTGTTTGCTTCTGGGCAGAACTTGGCACG
CCAATTGATGGAGACGCCAGCCAATGAGATGACGCCAACCAGATTTGCTGAAATTATTGAGAAGAATCTCAAAAGTGCTAGTAGTAAAAC
CGAGGTCCATATCAGACCCAAGTCTTGGATTGAGGAACAGGCAATGGGATCATTCCTCAGTGTGGCCAAAGGATCTGACGAGCCCCCAGT
CTTCTTGGAAATTCACTACAAAGGCAGCCCCAATGCAAACGAACCACCCCTGGTGTTTGTTGGGAAAGGAATTACCTTTGACAGTGGTGG
TATCTCCATCAAGGCTTCTGCAAATATGGACCTCATGAGGGCTGACATGGGAGGAGCTGCAACTATATGCTCAGCCATCGTGTCTGCTGC
AAAGCTTAATTTGCCCATTAATATTATAGGTCTGGCCCCTCTTTGTGAAAATATGCCCAGCGGCAAGGCCAACAAGCCGGGGGATGTTGT
TAGAGCCAAAAACGGGAAGACCATCCAGGTTGATAACACTGATGCTGAGGGGAGGCTCATACTGGCTGATGCGCTCTGTTACGCACACAC
GTTTAACCCGAAGGTCATCCTCAATGCCGCCACCTTAACAGGTGCCATGGATGTAGCTTTGGGATCAGGTGCCACTGGGGTCTTTACCAA
TTCATCCTGGCTCTGGAACAAACTCTTCGAGGCCAGCATTGAAACAGGGGACCGTGTCTGGAGGATGCCTCTCTTCGAACATTATACAAG
ACAGGTTGTAGATTGCCAGCTTGCTGATGTTAACAACATTGGAAAATACAGATCTGCAGGAGCATGTACAGCTGCAGCATTCCTGAAAGA
ATTCGTAACTCATCCTAAGTGGGCACATTTAGACATAGCAGGCGTGATGACCAACAAAGATGAAGTTCCCTATCTACGGAAAGGCATGAC
TGGGAGGCCCACAAGGACTCTCATTGAGTTCTTACTTCGTTTCAGTCAAGACAATGCTTAGTTCAGATACTCAAAAATGTCTTCACTCTG
TCTTAAATTGGACAGTTGAACTTAAAAGGTTTTTGAATAAATGGATGAAAATCTTTTAACGGAGACAAAGGATGGTATTTAAAAATGTAG
AACACAATGAAATTTGTATGCCTTGATTTTTTTTTCATTTCACACAAAGATTTATAAAGGTAAAGTTAATATCTTACTTGATAAGGATTT
TTAAGATACTCTATAAATGATTAAAATTTTTAGAACTTCCTAATCACTTTTCAGAGTATATGTTTTTCATTGAGAAGCAAAATTGTAACT


Top

FusionGenePPI for SERPINA3_LAP3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SERPINA3DNAJC1, ELANE, KLK2, PSMA3, ATP6V1B1, LAMC3, ZNRD1, ADH1B, LMNB1, NFKB1, ABCC5, GDPD1, DDX19B, C16orf70, KLK13, TBC1D22B, DDX31, ZIC1, SNX27, FAM60A, MPI, CDK15LAP3DDA1, UBA5, TAB1, ISG15, APP, LIG4, AARSD1, AGFG1, ALAD, ARPC2, NIF3L1, OGT, SH3GL1, SH3GLB1, TPRKB, RAPGEF2, RNF2, FUBP1, MIF, PRDX1, PRDX2, TKT, VARS, NTRK1, TP53, NDUFS5, RAB7A, RBM39, ZCCHC17, U2AF2, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SERPINA3_LAP3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneSERPINA3P01011DB01593ZincAlpha-1-antichymotrypsinsmall moleculeapproved|investigational

Top

RelatedDiseases for SERPINA3_LAP3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSERPINA3C0023794Lipoidosis3CTD_human
HgeneSERPINA3C0033578Prostatic Neoplasms1CTD_human
HgeneSERPINA3C0033975Psychotic Disorders1PSYGENET
HgeneSERPINA3C0349204Nonorganic psychosis1PSYGENET