FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33293

FusionGeneSummary for SERPINA3_CPB1

check button Fusion gene summary
Fusion gene informationFusion gene name: SERPINA3_CPB1
Fusion gene ID: 33293
HgeneTgene
Gene symbol

SERPINA3

CPB1

Gene ID

12

1360

Gene nameserpin family A member 3carboxypeptidase B1
SynonymsAACT|ACT|GIG24|GIG25CPB|PASP|PCPB
Cytomap

14q32.13

3q24

Type of geneprotein-codingprotein-coding
Descriptionalpha-1-antichymotrypsincell growth-inhibiting gene 24/25 proteingrowth-inhibiting protein 24growth-inhibiting protein 25serine (or cysteine) proteinase inhibitor, clade A, member 3serpin A3serpin peptidase inhibitor, clade A (alpha-1 antiproteinasecarboxypeptidase Bcarboxypeptidase B1 (tissue)pancreas-specific proteinpancreatic carboxypeptidase Bprocarboxypeptidase Bprotaminasetissue carboxypeptidase B
Modification date2018052320180523
UniProtAcc

P01011

P15086

Ensembl transtripts involved in fusion geneENST00000393078, ENST00000485588, 
ENST00000393080, ENST00000467132, 
ENST00000482740, 
ENST00000491148, 
ENST00000282957, ENST00000498639, 
Fusion gene scores* DoF score6 X 8 X 4=19221 X 24 X 3=1512
# samples 1019
** MAII scorelog2(10/192*10)=-0.941106310946431
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(19/1512*10)=-2.99238681589013
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SERPINA3 [Title/Abstract] AND CPB1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-B6-A0RP-01ASERPINA3chr14

95081421

+CPB1chr3

148563211

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000393078ENST00000491148SERPINA3chr14

95081421

+CPB1chr3

148563211

+
In-frameENST00000393078ENST00000282957SERPINA3chr14

95081421

+CPB1chr3

148563211

+
5CDS-intronENST00000393078ENST00000498639SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-3CDSENST00000485588ENST00000491148SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-3CDSENST00000485588ENST00000282957SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-intronENST00000485588ENST00000498639SERPINA3chr14

95081421

+CPB1chr3

148563211

+
In-frameENST00000393080ENST00000491148SERPINA3chr14

95081421

+CPB1chr3

148563211

+
In-frameENST00000393080ENST00000282957SERPINA3chr14

95081421

+CPB1chr3

148563211

+
5CDS-intronENST00000393080ENST00000498639SERPINA3chr14

95081421

+CPB1chr3

148563211

+
In-frameENST00000467132ENST00000491148SERPINA3chr14

95081421

+CPB1chr3

148563211

+
In-frameENST00000467132ENST00000282957SERPINA3chr14

95081421

+CPB1chr3

148563211

+
5CDS-intronENST00000467132ENST00000498639SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-3CDSENST00000482740ENST00000491148SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-3CDSENST00000482740ENST00000282957SERPINA3chr14

95081421

+CPB1chr3

148563211

+
intron-intronENST00000482740ENST00000498639SERPINA3chr14

95081421

+CPB1chr3

148563211

+

Top

FusionProtFeatures for SERPINA3_CPB1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SERPINA3

P01011

CPB1

P15086


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCPB1chr14:95081421chr3:148563211ENST00000282957+711305_306259418RegionSubstrate binding
TgeneCPB1chr14:95081421chr3:148563211ENST00000491148+812305_306259418RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393078+25235_237214424DNA binding.
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393080+25235_237214424DNA binding.
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000467132+25235_237214424DNA binding.
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393078+25369_394214424RegionNote=RCL
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393078+25381_389214424RegionNote=O-glycosylated at one site
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393080+25369_394214424RegionNote=RCL
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000393080+25381_389214424RegionNote=O-glycosylated at one site
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000467132+25369_394214424RegionNote=RCL
HgeneSERPINA3chr14:95081421chr3:148563211ENST00000467132+25381_389214424RegionNote=O-glycosylated at one site
TgeneCPB1chr14:95081421chr3:148563211ENST00000282957+711176_179259418RegionSubstrate binding
TgeneCPB1chr14:95081421chr3:148563211ENST00000282957+711251_252259418RegionSubstrate binding
TgeneCPB1chr14:95081421chr3:148563211ENST00000491148+812176_179259418RegionSubstrate binding
TgeneCPB1chr14:95081421chr3:148563211ENST00000491148+812251_252259418RegionSubstrate binding


Top

FusionGeneSequence for SERPINA3_CPB1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI

>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_373aa
MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSLYKQLVLKAPDKNVIFSPLSISTALAFLSLG
AHNTTLTEILKGLKFNLTETSEAEIHQSFQHLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKEIGASRNPCDETYCGPAAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYS
YAYKLGENNAELNALAKATVKELASLHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC

>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_1119nt
ATGGAGAGAATGTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGAC
GAGGAGAATCTGACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTG
TACAAGCAGTTAGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGG
GCCCATAATACCACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAG
CACCTCCTGCGCACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTG
GACAGGTTCACGGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATC
AACGACTACGTGAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTAC
ATCTTCTTTAAAGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCC
CTGGCTGATTTCATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCA
TATGCTTACAAACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAG
TACACATATGGCCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTC
ACCTTTGAACTTCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_1383nt
ATTCATGAAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGCAGAGTTGAGAATGGAGAGAAT
GTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCT
GACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTT
AGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATAC
CACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCG
CACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCAC
GGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGT
GAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAA
AGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTT
CATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAA
ACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGG
CCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACT
TCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGC
CAGCTACGTCCTGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATT
CTTATTTTGGTTTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGA

>In-frame_SERPINA3_ENST00000393078_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_1379nt
ATTCATGAAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGCAGAGTTGAGAATGGAGAGAAT
GTTACCTCTCCTGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCT
GACCCAGGAGAACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTT
AGTCCTGAAGGCCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATAC
CACCCTGACAGAGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCG
CACCCTCAATCAGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCAC
GGAGGATGCCAAGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGT
GAAGAATGGAACTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAA
AGAAATTGGAGCCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTT
CATCCGCAACAAACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAA
ACTCGGTGAGAACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGG
CCCGGGAGCTACAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACT
TCGAGATACAGGCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGC
CAGCTACGTCCTGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATT
CTTATTTTGGTTTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGA

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_1372nt
AAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGAAATTGGAG
CCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTTCATCCGCAACA
AACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAAACTCGGTGAGA
ACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGGCCCGGGAGCTA
CAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACTTCGAGATACAG
GCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGCCAGCTACGTCC
TGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATTCTTATTTTGGT
TTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGATCATAATAAAA

>In-frame_SERPINA3_ENST00000393080_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_1368nt
AAAATCCACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGAAATTGGAG
CCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTTCATCCGCAACA
AACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAAACTCGGTGAGA
ACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGGCCCGGGAGCTA
CAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACTTCGAGATACAG
GCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGCCAGCTACGTCC
TGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATTCTTATTTTGGT
TTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGATCATAATAAAA

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000491148_chr3_148563211_+_2452nt
ACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGACTGAGTGGGCGGAGGCTGAAGGTGAATAATCTTGT
TTGCTGCGGTCACCGGCTTGGAACTCAGCCCTTCCAGGGTCTCTTGTGCAGTAGCTCATGGCTCTTCTCTGGCTTGTAGTTTCAGGAAAG
GGGTAGTATGGGAGGTGGTGACTGCTCGGTACGTCTAATATGAACCAGGTGCCTTCATCATTTATCTCACCTGAGCCACTTAACAGGTTG
TGCAGAGACGGAAACAGGTTGAGAGATGTACAGTCACCTGCTTGCCAGTACACAGCAATCAAAAGTGGCCAAAATAAAATCCCAGTCCAA
GTCTGGGAGACTCCAAAGCCCTCTCTGCCTTCTCCCCACTAAGAGGCCCTTCCAGGCTTATGGTGGACACAGACACCACGTGGCAACCTG
GCAGGGGCAGAGAAGAACATTTGCCTTTCTTTGGTCTTGCTGCCAACCATTATCAGGGCCATCGAGGCTCCAGACACTGTACCAGGGACT
TTCATTTCCCTCTCTCAGTCGACCCTCACTGCCACCCAGCATCACATCGTGGAGGCCTGTGGAGGCCACACCACGTGACATCTAGAGGCT
GGGAGAGTCACTGTGGCCTCTATCTCTGCCCAGGGCTCCTTCATCCCTGGGTTCTACTTTGGTGGCAGTTGGGAGAATGAAGGAAGGGAG
CCCCTGCTTTCTAATCCCCTAGGATGAGATCTGCTCACCAAGCAGGAGAGGAGCAGGCATTCTGATTGGACTGAACCTCGGACCCCCCAT
CAGCTTACAGACCGAGGAGCCAGGCAAACCTGGCTGCCCACTGGGCTCCTTTACCTGTTTGCTGTATGATCTTGGGCAAGCCCCCTCACC
GCTCTGTGCCCGGCTTTTCCACTGCAAGAAAATGGCAACAATTATGGTACCTACCTCAAAGGGTGAAATGAAGCAGAGTGATGTGTGTCG
GGTGCCCCAGAGAGCACCTACCTGAGGGAGGCTCCAAAGCTAGCAAGAGGCAGCAGGACAGGGACCAGGACGCAGGCTGGGTGGAGGGCA
GTGGGAGGTGGTCGGGGCTCCATCTGGCCCTCTGAGACTTAAAGGAGCTTTGCTTTTCAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGAAATTGGAG
CCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTTCATCCGCAACA
AACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAAACTCGGTGAGA
ACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGGCCCGGGAGCTA
CAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACTTCGAGATACAG
GCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGCCAGCTACGTCC
TGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATTCTTATTTTGGT
TTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGATCATAATAAAA

>In-frame_SERPINA3_ENST00000467132_chr14_95081421_+_CPB1_ENST00000282957_chr3_148563211_+_2448nt
ACTACTCCAGACAGACGGCTTTGGAATCCACCAGCTACATCCAGCTCCCTGAGGACTGAGTGGGCGGAGGCTGAAGGTGAATAATCTTGT
TTGCTGCGGTCACCGGCTTGGAACTCAGCCCTTCCAGGGTCTCTTGTGCAGTAGCTCATGGCTCTTCTCTGGCTTGTAGTTTCAGGAAAG
GGGTAGTATGGGAGGTGGTGACTGCTCGGTACGTCTAATATGAACCAGGTGCCTTCATCATTTATCTCACCTGAGCCACTTAACAGGTTG
TGCAGAGACGGAAACAGGTTGAGAGATGTACAGTCACCTGCTTGCCAGTACACAGCAATCAAAAGTGGCCAAAATAAAATCCCAGTCCAA
GTCTGGGAGACTCCAAAGCCCTCTCTGCCTTCTCCCCACTAAGAGGCCCTTCCAGGCTTATGGTGGACACAGACACCACGTGGCAACCTG
GCAGGGGCAGAGAAGAACATTTGCCTTTCTTTGGTCTTGCTGCCAACCATTATCAGGGCCATCGAGGCTCCAGACACTGTACCAGGGACT
TTCATTTCCCTCTCTCAGTCGACCCTCACTGCCACCCAGCATCACATCGTGGAGGCCTGTGGAGGCCACACCACGTGACATCTAGAGGCT
GGGAGAGTCACTGTGGCCTCTATCTCTGCCCAGGGCTCCTTCATCCCTGGGTTCTACTTTGGTGGCAGTTGGGAGAATGAAGGAAGGGAG
CCCCTGCTTTCTAATCCCCTAGGATGAGATCTGCTCACCAAGCAGGAGAGGAGCAGGCATTCTGATTGGACTGAACCTCGGACCCCCCAT
CAGCTTACAGACCGAGGAGCCAGGCAAACCTGGCTGCCCACTGGGCTCCTTTACCTGTTTGCTGTATGATCTTGGGCAAGCCCCCTCACC
GCTCTGTGCCCGGCTTTTCCACTGCAAGAAAATGGCAACAATTATGGTACCTACCTCAAAGGGTGAAATGAAGCAGAGTGATGTGTGTCG
GGTGCCCCAGAGAGCACCTACCTGAGGGAGGCTCCAAAGCTAGCAAGAGGCAGCAGGACAGGGACCAGGACGCAGGCTGGGTGGAGGGCA
GTGGGAGGTGGTCGGGGCTCCATCTGGCCCTCTGAGACTTAAAGGAGCTTTGCTTTTCAGAGTTGAGAATGGAGAGAATGTTACCTCTCC
TGGCTCTGGGGCTCTTGGCGGCTGGGTTCTGCCCTGCTGTCCTCTGCCACCCTAACAGCCCACTTGACGAGGAGAATCTGACCCAGGAGA
ACCAAGACCGAGGGACACACGTGGACCTCGGATTAGCCTCCGCCAACGTGGACTTCGCTTTCAGCCTGTACAAGCAGTTAGTCCTGAAGG
CCCCTGATAAGAATGTCATCTTCTCCCCACTGAGCATCTCCACCGCCTTGGCCTTCCTGTCTCTGGGGGCCCATAATACCACCCTGACAG
AGATTCTCAAAGGCCTCAAGTTCAACCTCACGGAGACTTCTGAGGCAGAAATTCACCAGAGCTTCCAGCACCTCCTGCGCACCCTCAATC
AGTCCAGCGATGAGCTGCAGCTGAGTATGGGAAATGCCATGTTTGTCAAAGAGCAACTCAGTCTGCTGGACAGGTTCACGGAGGATGCCA
AGAGGCTGTATGGCTCCGAGGCCTTTGCCACTGACTTTCAGGACTCAGCTGCAGCTAAGAAGCTCATCAACGACTACGTGAAGAATGGAA
CTAGGGGGAAAATCACAGATCTGATCAAGGACCTTGACTCGCAGACAATGATGGTCCTGGTGAATTACATCTTCTTTAAAGAAATTGGAG
CCTCTCGAAACCCCTGTGATGAAACTTACTGTGGACCTGCCGCAGAGTCTGAAAAGGAGACCAAGGCCCTGGCTGATTTCATCCGCAACA
AACTCTCTTCCATCAAGGCATATCTGACAATCCACTCGTACTCCCAAATGATGATCTACCCTTACTCATATGCTTACAAACTCGGTGAGA
ACAATGCTGAGTTGAATGCCCTGGCTAAAGCTACTGTGAAAGAACTTGCCTCACTGCACGGCACCAAGTACACATATGGCCCGGGAGCTA
CAACAATCTATCCTGCTGCTGGGGGCTCTGACGACTGGGCTTATGACCAAGGAATCAGATATTCCTTCACCTTTGAACTTCGAGATACAG
GCAGATATGGCTTTCTCCTTCCAGAATCCCAGATCCGGGCTACCTGCGAGGAGACCTTCCTGGCAATCAAGTATGTTGCCAGCTACGTCC
TGGAACACCTGTACTAGTTGAGAAAGCTGATGGCCTTGTTTCAAAATTCTCATTTTTCATTTCTTTTCTTTCTTGAATTCTTATTTTGGT
TTGCCTGGATGTTTTGCAGATCCCAATCTTTCTTTTAAGCTTCTGGGTCTATTAAACTAGGTAGATCTTTTCGTATTGATCATAATAAAA


Top

FusionGenePPI for SERPINA3_CPB1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SERPINA3DNAJC1, ELANE, KLK2, PSMA3, ATP6V1B1, LAMC3, ZNRD1, ADH1B, LMNB1, NFKB1, ABCC5, GDPD1, DDX19B, C16orf70, KLK13, TBC1D22B, DDX31, ZIC1, SNX27, FAM60A, MPI, CDK15CPB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SERPINA3_CPB1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneSERPINA3P01011DB01593ZincAlpha-1-antichymotrypsinsmall moleculeapproved|investigational
TgeneCPB1P15086DB04272Citric AcidCarboxypeptidase Bsmall moleculeapproved|nutraceutical|vet_approved

Top

RelatedDiseases for SERPINA3_CPB1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSERPINA3C0023794Lipoidosis3CTD_human
HgeneSERPINA3C0033578Prostatic Neoplasms1CTD_human
HgeneSERPINA3C0033975Psychotic Disorders1PSYGENET
HgeneSERPINA3C0349204Nonorganic psychosis1PSYGENET