FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33134

FusionGeneSummary for SEMA3C_AUTS2

check button Fusion gene summary
Fusion gene informationFusion gene name: SEMA3C_AUTS2
Fusion gene ID: 33134
HgeneTgene
Gene symbol

SEMA3C

AUTS2

Gene ID

10512

26053

Gene namesemaphorin 3CAUTS2, activator of transcription and developmental regulator
SynonymsSEMAE|SemEFBRSL2|MRD26
Cytomap

7q21.11

7q11.22

Type of geneprotein-codingprotein-coding
Descriptionsemaphorin-3Csema Esema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3Csemaphorin Eautism susceptibility gene 2 proteinautism susceptibility candidate 2autism-related protein 1
Modification date2018052320180519
UniProtAcc

Q99985

Q8WXX7

Ensembl transtripts involved in fusion geneENST00000265361, ENST00000544525, 
ENST00000419255, ENST00000536800, 
ENST00000487621, 
ENST00000406775, 
ENST00000342771, ENST00000403018, 
ENST00000489774, 
Fusion gene scores* DoF score6 X 4 X 5=12018 X 16 X 6=1728
# samples 720
** MAII scorelog2(7/120*10)=-0.777607578663552
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1728*10)=-3.11103131238874
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SEMA3C [Title/Abstract] AND AUTS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneAUTS2

GO:0045944

positive regulation of transcription by RNA polymerase II

25519132

TgeneAUTS2

GO:0051571

positive regulation of histone H3-K4 methylation

25519132

TgeneAUTS2

GO:2000620

positive regulation of histone H4-K16 acetylation

25519132


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-B6-A0IC-01ASEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000265361ENST00000406775SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
In-frameENST00000265361ENST00000342771SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000265361ENST00000403018SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000265361ENST00000489774SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
Frame-shitENST00000544525ENST00000406775SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
Frame-shitENST00000544525ENST00000342771SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000544525ENST00000403018SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000544525ENST00000489774SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
Frame-shitENST00000419255ENST00000406775SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
Frame-shitENST00000419255ENST00000342771SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000419255ENST00000403018SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
5CDS-intronENST00000419255ENST00000489774SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-3CDSENST00000536800ENST00000406775SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-3CDSENST00000536800ENST00000342771SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-intronENST00000536800ENST00000403018SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-intronENST00000536800ENST00000489774SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-3CDSENST00000487621ENST00000406775SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-3CDSENST00000487621ENST00000342771SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-intronENST00000487621ENST00000403018SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+
intron-intronENST00000487621ENST00000489774SEMA3Cchr7

80418622

-AUTS2chr7

69900738

+

Top

FusionProtFeatures for SEMA3C_AUTS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SEMA3C

Q99985

AUTS2

Q8WXX7

Binds to plexin family members and plays an importantrole in the regulation of developmental processes. Required fornormal cardiovascular development during embryogenesis. Functionsas attractant for growing axons, and thereby plays an importantrole in axon growth and axon guidance (By similarity).{ECO:0000250}. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain thetranscriptionally repressive state of many genes, including Hoxgenes, throughout development. PcG PRC1 complex acts via chromatinremodeling and modification of histones; it mediatesmonoubiquitination of histone H2A 'Lys-119', rendering chromatinheritably changed in its expressibility (PubMed:25519132). ThePRC1-like complex that contains PCGF5, RNF2, CSNK2B, RYBP andAUTS2 has decreased histone H2A ubiquitination activity, due tothe phosphorylation of RNF2 by CSNK2B (PubMed:25519132). As aconsequence, the complex mediates transcriptional activation(PubMed:25519132). In the cytoplasm, plays a role in axon anddendrite elongation and in neuronal migration during embryonicbrain development. Promotes reorganization of the actincytoskeleton, lamellipodia formation and neurite elongation viaits interaction with RAC guanine nucleotide exchange factors,which then leads to the activation of RAC1 (By similarity).{ECO:0000250|UniProtKB:A0A087WPF7, ECO:0000269|PubMed:25519132}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAUTS2chr7:80418622chr7:69900738ENST00000342771+3191122_11812201260Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000342771+319288_4712201260Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000342771+319525_5482201260Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000342771+319545_6462201260Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000403018+051122_1181-15267Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000403018+05288_471-15267Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000403018+05525_548-15267Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000403018+05545_646-15267Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000406775+3181122_11812201236Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000406775+318288_4712201236Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000406775+318525_5482201236Compositional biasHis-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000406775+318545_6462201236Compositional biasPro-rich
TgeneAUTS2chr7:80418622chr7:69900738ENST00000342771+319289_4722201260RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:80418622chr7:69900738ENST00000403018+05289_472-15267RegionImportant for regulation of lamellipodia formation
TgeneAUTS2chr7:80418622chr7:69900738ENST00000406775+318289_4722201236RegionImportant for regulation of lamellipodia formation

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000265361-1218724_745451752Compositional biasNote=Arg/Lys-rich (basic)
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000419255-1218724_745451752Compositional biasNote=Arg/Lys-rich (basic)
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000265361-121828_511451752DomainSema
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000265361-1218571_655451752DomainNote=Ig-like C2-type
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000419255-121828_511451752DomainSema
HgeneSEMA3Cchr7:80418622chr7:69900738ENST00000419255-1218571_655451752DomainNote=Ig-like C2-type


Top

FusionGeneSequence for SEMA3C_AUTS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000406775_chr7_69900738_+_1467aa
MAFRTICVLVGVFICSICVKGSSQPQARVTLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRITVGSKDHILSLNINNISQEALSVF
WPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLTVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMTIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDT
GGLRSLVNKWTTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVTGIFTTSSSVFKGSAVCVTHLSDIQTVFNGPFAHKEGPN
HQLISTQGRIPTPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLIVRIGTDYKTTKIAVDRVNAADGRYHVLFLG
TV_Q_Q_PGREGIRCQL_KTLQHCTCKQRSGVRCWHATRT_QPGCRADCPQDIGSREKPGEEPGLLQRANL_ACGA_RPLPSGRTANTPA
ADGAPTPSSFSGP_LGAAHRGPTSTPTSEYTATTGPS_GPAPACPAASGAEATQATVPHPAAPSEPPTCAGPPLCSEPLPAIVSLQQQ_L
KPQQFKQQQKQHSSEDSARPTSHLPPPLCLPVPPLPAQPQPPAQLHTHPPAPRTLTSPQTVCPSHCSASSTTTDIRKSAGGRTPGREHLL
RARHLATGTEHSFFGLSEC_PRGFPGPSALPADRVPSAPAPAPAHPPAHAPAHLHAVPPRHPTHRHHADASTSHV_QIPYKS_PILPAQS
LPFLSSCSVGHPPTDPTHWPFWFTTRSISAEVDRSFQTTVKETREVVCTACSHRLADLPPPTESQETDAVRPT_AGLWTET_VPEPPSRP
QSFWSHPPPP_PGTAFNFVLCRWCCTPNWDPFWATSSSQQLPQPCCPPRAF_SAVYIHRPSSSWWQCLRGTWKSFRYTQLNVRPQGWPQC
AEL_QPSRTLEPAAPNASVVPDPSALAEARGAGAQRVRCSS_QR_RCR_TRLIC__R_QRKGKRREETLQPPFTSTCPPGECPGTYPQLH
_TDPGSSEH_GSGEGQTQREGERPLGIPQGPGRRRAQGERGPPAREGRARPRGARRGRRGQAAGPGAVSLRADPGGGECQAQQHLEPGGR
AAQG_AGLREPQEELRGQGEGGAEGRP_PASRGPADPPGLGAAASQLLVQRAPGAPGLDAHDGGGDGHSPHEQHQQPGQDSHDDPLHGHQ
PPPGRRALPVPFFPLGPHPGPLEGSLPRT_HSPERPAGQGLPAKERPAPPALDSPAVRSRPLLQGPGASRLQPPPPPPPPPAVCGPSAGA
RAGRPPGRAGALAHAQRRLRAHAAPLRAPRLPRRTPPPPQPHHPGTPQHALSPHQPHRGQPERTPQQDPSDSSAERTSPAHLHAGGPPGL

>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000342771_chr7_69900738_+_1491aa
MAFRTICVLVGVFICSICVKGSSQPQARVTLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRITVGSKDHILSLNINNISQEALSVF
WPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLTVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMTIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDT
GGLRSLVNKWTTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVTGIFTTSSSVFKGSAVCVTHLSDIQTVFNGPFAHKEGPN
HQLISTQGRIPTPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLIVRIGTDYKTTKIAVDRVNAADGRYHVLFLG
TV_Q_Q_PGREGIRCQL_KTLQHCTCKQRSGVRCWHATRT_QPGCRADCPQDIGSREKPGEEPGLLQRANL_ACGA_RPLPSGRTANTPA
ADGAPTPSSFSGP_LGAAHRGPTSTPTSEYTATTGPS_GPAPACPAASGAEATQATVPHPAAPSEPPTCAGPPLCSEPLPAIVSLQQQ_L
KPQQFKQQQKQHSSEDSARPTSHLPPPLCLPVPPLPAQPQPPAQLHTHPPAPRTLTSPQTVCPSHCSASSTTTDIRKSAGGRTPGREHLL
RARHLATGTEHSFFGLSEC_PRGFPGPSALPADRVPSAPAPAPAHPPAHAPAHLHAVPPRHPTHRHHADASTSHV_QIPYKS_PILPAQS
LPFLSSCSVGHPPTDPTHWPFWFTTRSISAEDIQPTRCRCSAWDSPTHFTPKGPEVDRSFQTTVKETREVVCTACSHRLADLPPPTESQE
TDAVRPT_AGLWTET_VPEPPSRPQSFWSHPPPP_PGTAFNFVLCRWCCTPNWDPFWATSSSQQLPQPCCPPRAF_SAVYIHRPSSSWWQ
CLRGTWKSFRYTQLNVRPQGWPQCAEL_QPSRTLEPAAPNASVVPDPSALAEARGAGAQRVRCSS_QR_RCR_TRLIC__R_QRKGKRRE
ETLQPPFTSTCPPGECPGTYPQLH_TDPGSSEH_GSGEGQTQREGERPLGIPQGPGRRRAQGERGPPAREGRARPRGARRGRRGQAAGPG
AVSLRADPGGGECQAQQHLEPGGRAAQG_AGLREPQEELRGQGEGGAEGRP_PASRGPADPPGLGAAASQLLVQRAPGAPGLDAHDGGGD
GHSPHEQHQQPGQDSHDDPLHGHQPPPGRRALPVPFFPLGPHPGPLEGSLPRT_HSPERPAGQGLPAKERPAPPALDSPAVRSRPLLQGP
GASRLQPPPPPPPPPAVCGPSAGARAGRPPGRAGALAHAQRRLRAHAAPLRAPRLPRRTPPPPQPHHPGTPQHALSPHQPHRGQPERTPQ


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000406775_chr7_69900738_+_4402nt
ATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTCCCAGCCCCAAGCAAGAGTTTAT
TTAACATTTGATGAACTTCGAGAAACCAAGACCTCTGAATACTTCAGCCTTTCCCACCATCCTTTAGACTACAGGATTTTATTAATGGAT
GAAGATCAGGACCGGATATATGTGGGAAGCAAAGATCACATTCTTTCCCTGAATATTAACAATATAAGTCAAGAAGCTTTGAGTGTTTTC
TGGCCAGCATCTACAATCAAAGTTGAAGAATGCAAAATGGCTGGCAAAGATCCCACACACGGCTGTGGGAACTTTGTCCGTGTAATTCAG
ACTTTCAATCGCACACATTTGTATGTCTGTGGGAGTGGCGCTTTCAGTCCTGTCTGTACTTACTTGAACAGAGGGAGGAGATCAGAGGAC
CAAGTTTTCATGATTGACTCCAAGTGTGAATCTGGAAAAGGACGCTGCTCTTTCAACCCCAACGTGAACACGGTGTCTGTTATGATCAAT
GAGGAGCTTTTCTCTGGAATGTATATAGATTTCATGGGGACAGATGCTGCTATTTTTCGAAGTTTAACCAAGAGGAATGCGGTCAGAACT
GATCAACATAATTCCAAATGGCTAAGTGAACCTATGTTTGTAGATGCACATGTCATCCCAGATGGTACTGATCCAAATGATGCTAAGGTG
TACTTCTTCTTCAAAGAAAAACTGACTGACAATAACAGGAGCACGAAACAGATTCATTCCATGATTGCTCGAATATGTCCTAATGACACT
GGTGGACTGCGTAGCCTTGTCAACAAGTGGACCACTTTCTTAAAGGCGAGGCTGGTGTGCTCGGTAACAGATGAAGACGGCCCAGAAACA
CACTTTGATGAATTAGAGGATGTGTTTCTGCTGGAAACTGATAACCCGAGGACAACACTAGTGTATGGCATTTTTACAACATCAAGCTCA
GTTTTCAAAGGATCAGCCGTGTGTGTGTATCATTTATCTGATATACAGACTGTGTTTAATGGGCCTTTTGCCCACAAAGAAGGGCCCAAT
CATCAGCTGATTTCCTATCAGGGCAGAATTCCATATCCTCGCCCTGGAACTTGTCCAGGAGGAGCATTTACACCCAATATGCGAACCACC
AAGGAGTTCCCAGATGATGTTGTCACTTTTATTCGGAACCATCCTCTCATGTACAATTCCATCTACCCAATCCACAAAAGGCCTTTGATT
GTTCGTATTGGCACTGACTACAAGTATACAAAGATAGCTGTGGATCGAGTGAACGCTGCTGATGGGAGATACCATGTCCTGTTTCTCGGA
ACAGTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCC
GGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGA
GAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCC
GCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTAC
ACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCA
GCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTT
AAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTC
CCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATAT
GTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTC
AGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTA
CCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGC
CATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCT
CTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCC
GAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCA
CCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCC
CAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGAC
CCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCT
AGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGT
GCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGG
GGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGA
AAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCAC
TGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGA
CCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGC
CAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGA
GCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCC
TCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCC
CATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAG
CCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGA
CATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGA
CCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCA
CGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGC
CTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAA
CCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTC

>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000342771_chr7_69900738_+_4474nt
ATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTCCCAGCCCCAAGCAAGAGTTTAT
TTAACATTTGATGAACTTCGAGAAACCAAGACCTCTGAATACTTCAGCCTTTCCCACCATCCTTTAGACTACAGGATTTTATTAATGGAT
GAAGATCAGGACCGGATATATGTGGGAAGCAAAGATCACATTCTTTCCCTGAATATTAACAATATAAGTCAAGAAGCTTTGAGTGTTTTC
TGGCCAGCATCTACAATCAAAGTTGAAGAATGCAAAATGGCTGGCAAAGATCCCACACACGGCTGTGGGAACTTTGTCCGTGTAATTCAG
ACTTTCAATCGCACACATTTGTATGTCTGTGGGAGTGGCGCTTTCAGTCCTGTCTGTACTTACTTGAACAGAGGGAGGAGATCAGAGGAC
CAAGTTTTCATGATTGACTCCAAGTGTGAATCTGGAAAAGGACGCTGCTCTTTCAACCCCAACGTGAACACGGTGTCTGTTATGATCAAT
GAGGAGCTTTTCTCTGGAATGTATATAGATTTCATGGGGACAGATGCTGCTATTTTTCGAAGTTTAACCAAGAGGAATGCGGTCAGAACT
GATCAACATAATTCCAAATGGCTAAGTGAACCTATGTTTGTAGATGCACATGTCATCCCAGATGGTACTGATCCAAATGATGCTAAGGTG
TACTTCTTCTTCAAAGAAAAACTGACTGACAATAACAGGAGCACGAAACAGATTCATTCCATGATTGCTCGAATATGTCCTAATGACACT
GGTGGACTGCGTAGCCTTGTCAACAAGTGGACCACTTTCTTAAAGGCGAGGCTGGTGTGCTCGGTAACAGATGAAGACGGCCCAGAAACA
CACTTTGATGAATTAGAGGATGTGTTTCTGCTGGAAACTGATAACCCGAGGACAACACTAGTGTATGGCATTTTTACAACATCAAGCTCA
GTTTTCAAAGGATCAGCCGTGTGTGTGTATCATTTATCTGATATACAGACTGTGTTTAATGGGCCTTTTGCCCACAAAGAAGGGCCCAAT
CATCAGCTGATTTCCTATCAGGGCAGAATTCCATATCCTCGCCCTGGAACTTGTCCAGGAGGAGCATTTACACCCAATATGCGAACCACC
AAGGAGTTCCCAGATGATGTTGTCACTTTTATTCGGAACCATCCTCTCATGTACAATTCCATCTACCCAATCCACAAAAGGCCTTTGATT
GTTCGTATTGGCACTGACTACAAGTATACAAAGATAGCTGTGGATCGAGTGAACGCTGCTGATGGGAGATACCATGTCCTGTTTCTCGGA
ACAGTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACACTGTTATTGTAAACAAAGATCC
GGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATATCGGGTCTAGAGAGAAGCCAGGA
GAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGGTCGCACAGCCAATACCCCAGCC
GCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCACCTCAACCCCCACCTCTGAGTAC
ACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCACCCAGGCCACAGTCCCCCACCCA
GCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGTCAGCCTACAACAGCAGTAGCTT
AAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACATCTCCCACCACCCCTCTGCCTC
CCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCGCACACTCACATCACCCCAATAT
GTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGACACCCGGCCGGGAGCACTTACTC
AGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGGCTTCCCTGGGCCCTCCGCCCTA
CCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACACCTTCACGCCGTTCCCCCACGC
CATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTGACCCATTCTACCGGCACAGTCT
CTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTTCACTACAAGGAGCATTTCAGCC
GAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGGACCCGAGGTTGACAGATCCTTT
CAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAA
ACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCAT
CCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCC
TCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAA
TGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCC
TCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGC
GTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAA
GAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCA
TCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCA
CAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGT
GCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCC
GGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGAC
CCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGAC
GGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGA
GCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCC
GCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCG
GGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCT
GGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCT
CCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAA
CAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000406775_chr7_69900738_+_6471nt
GGACTGCGAAAGGAGCAGGGTTGCGGAGCTAGGGCTCCAGCCTGCGGCCGCGCATTCTTGCGTCTGGCCAGCCGCGAGCTCTAAGGGTCG
GCCCCGCCCGGTCCGCCCCCGCGGCTCCCTGCCAGGCTCTCGCGGGCGCGCTCGGGGTGGGGCCTCGCGGCTGGCGGAGATGCGGCCGGG
GCTGCGCGGTGGTGATGCGAGCCTGCAGGGCGGCGCGCCGGGGCAGCCGGAGCCGCGCGCCGCGGCGCTGTAATCGGACACCAAGAGCGC
TCGCCCCCGGCCTCCGGCCACTTTCCATTCACTCCGAGGTGCTTGATTGAGCGACGCGGAGAAGAGCTCCGGGTGCCGCGGCACTGCAGC
GCTGAGATTCCTTTACAAAGAAACTCAGAGGACCGGGAAGAAAGAATTTCACCTTTGCGACGTGCTAGAAAATAAGGTCGTCTGGGAAAA
GGACTGGAGACACAAGCGCATCCAACCCCGGTAGCAAACTGATGACTTTTCCGTGCTGATTTCTTTCAACCTCGGTATTTTCCCTTGGAT
ATTAACTTGCATATCTGAAGAAATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTC
CCAGCCCCAAGCAAGAGTTTATTTAACATTTGATGAACTTCGAGAAACCAAGACCTCTGAATACTTCAGCCTTTCCCACCATCCTTTAGA
CTACAGGATTTTATTAATGGATGAAGATCAGGACCGGATATATGTGGGAAGCAAAGATCACATTCTTTCCCTGAATATTAACAATATAAG
TCAAGAAGCTTTGAGTGTTTTCTGGCCAGCATCTACAATCAAAGTTGAAGAATGCAAAATGGCTGGCAAAGATCCCACACACGGCTGTGG
GAACTTTGTCCGTGTAATTCAGACTTTCAATCGCACACATTTGTATGTCTGTGGGAGTGGCGCTTTCAGTCCTGTCTGTACTTACTTGAA
CAGAGGGAGGAGATCAGAGGACCAAGTTTTCATGATTGACTCCAAGTGTGAATCTGGAAAAGGACGCTGCTCTTTCAACCCCAACGTGAA
CACGGTGTCTGTTATGATCAATGAGGAGCTTTTCTCTGGAATGTATATAGATTTCATGGGGACAGATGCTGCTATTTTTCGAAGTTTAAC
CAAGAGGAATGCGGTCAGAACTGATCAACATAATTCCAAATGGCTAAGTGAACCTATGTTTGTAGATGCACATGTCATCCCAGATGGTAC
TGATCCAAATGATGCTAAGGTGTACTTCTTCTTCAAAGAAAAACTGACTGACAATAACAGGAGCACGAAACAGATTCATTCCATGATTGC
TCGAATATGTCCTAATGACACTGGTGGACTGCGTAGCCTTGTCAACAAGTGGACCACTTTCTTAAAGGCGAGGCTGGTGTGCTCGGTAAC
AGATGAAGACGGCCCAGAAACACACTTTGATGAATTAGAGGATGTGTTTCTGCTGGAAACTGATAACCCGAGGACAACACTAGTGTATGG
CATTTTTACAACATCAAGCTCAGTTTTCAAAGGATCAGCCGTGTGTGTGTATCATTTATCTGATATACAGACTGTGTTTAATGGGCCTTT
TGCCCACAAAGAAGGGCCCAATCATCAGCTGATTTCCTATCAGGGCAGAATTCCATATCCTCGCCCTGGAACTTGTCCAGGAGGAGCATT
TACACCCAATATGCGAACCACCAAGGAGTTCCCAGATGATGTTGTCACTTTTATTCGGAACCATCCTCTCATGTACAATTCCATCTACCC
AATCCACAAAAGGCCTTTGATTGTTCGTATTGGCACTGACTACAAGTATACAAAGATAGCTGTGGATCGAGTGAACGCTGCTGATGGGAG
ATACCATGTCCTGTTTCTCGGAACAGTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACA
CTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATAT
CGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGG
TCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCAC
CTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCAC
CCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGT
CAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACA
TCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCG
CACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGAC
ACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGG
CTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACA
CCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTG
ACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTT
CACTACAAGGAGCATTTCAGCCGAAGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACA
TCGCCTGGCAGATTTACCACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGT
TCCTGAGCCGCCCTCCAGGCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTG
GTGCTGCACACCCAACTGGGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATC
GGCCGTCTACATTCACAGGCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCG
GCCACAAGGATGGCCCCAGTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCC
CTCCGCCCTGGCTGAAGCCAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCAT
CTGTTAGTAAAGATGACAAAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCC
TGGGACATACCCGCAGCTCCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAG
ACCACTCGGAATCCCGCAAGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGG
GGCGCGCCGCGGGCGAAGAGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACA
GCACCTCGAGCCGGGAGGCCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGC
GGAAGGAAGACCATGACCTGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACC
CGGGGCCCCTGGCCTCGATGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGA
TGACCCCCTTCATGGGCATCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGA
GGGATCCTTACCGAGAACTTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGA
CTCCCCGGCTGTACGAAGCCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGT
CTGTGGACCCTCGGCGGGAGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGC
GGCTCCACTCCGTGCACCCCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCC
GCATCAGCCCCACCGCGGGCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCA
CGCTGGGGGGCCGCCCGGTCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATA
TCGAGGCCCGATAAGCCGAGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCT
GCATGGCTCACACAGACTGGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTA
TATTATATGTTGAGATTTTTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATT
TGAACCAAAACAGTGAAGATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCA
TGCAAAATTCTTTCAGATGAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAA
AGGGTAAGATGAAAGCTTTACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAAC
TTACTTAATATCAGTGAACACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTT
CGGGCTTTTCACAAAAGCCCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCG
CTTACGTGATATGACTCTGTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTA
GCATCTGAAGTTGCCGCTTGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTG
GGATTTGCCAGATGCCAAAATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGA
GAACCATGCCTTTTTTAGTGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTG
AAAGAAAGCTTCAAGTTTTCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGAC
GCACTGTATTCCAGCTGGTGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGC
AGAAAAAAAAGTCTTGTGTGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTC
TTGTCTACATATTTGGAGAGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATA

>In-frame_SEMA3C_ENST00000265361_chr7_80418622_-_AUTS2_ENST00000342771_chr7_69900738_+_7108nt
GGACTGCGAAAGGAGCAGGGTTGCGGAGCTAGGGCTCCAGCCTGCGGCCGCGCATTCTTGCGTCTGGCCAGCCGCGAGCTCTAAGGGTCG
GCCCCGCCCGGTCCGCCCCCGCGGCTCCCTGCCAGGCTCTCGCGGGCGCGCTCGGGGTGGGGCCTCGCGGCTGGCGGAGATGCGGCCGGG
GCTGCGCGGTGGTGATGCGAGCCTGCAGGGCGGCGCGCCGGGGCAGCCGGAGCCGCGCGCCGCGGCGCTGTAATCGGACACCAAGAGCGC
TCGCCCCCGGCCTCCGGCCACTTTCCATTCACTCCGAGGTGCTTGATTGAGCGACGCGGAGAAGAGCTCCGGGTGCCGCGGCACTGCAGC
GCTGAGATTCCTTTACAAAGAAACTCAGAGGACCGGGAAGAAAGAATTTCACCTTTGCGACGTGCTAGAAAATAAGGTCGTCTGGGAAAA
GGACTGGAGACACAAGCGCATCCAACCCCGGTAGCAAACTGATGACTTTTCCGTGCTGATTTCTTTCAACCTCGGTATTTTCCCTTGGAT
ATTAACTTGCATATCTGAAGAAATGGCATTCCGGACAATTTGCGTGTTGGTTGGAGTATTTATTTGTTCTATCTGTGTGAAAGGATCTTC
CCAGCCCCAAGCAAGAGTTTATTTAACATTTGATGAACTTCGAGAAACCAAGACCTCTGAATACTTCAGCCTTTCCCACCATCCTTTAGA
CTACAGGATTTTATTAATGGATGAAGATCAGGACCGGATATATGTGGGAAGCAAAGATCACATTCTTTCCCTGAATATTAACAATATAAG
TCAAGAAGCTTTGAGTGTTTTCTGGCCAGCATCTACAATCAAAGTTGAAGAATGCAAAATGGCTGGCAAAGATCCCACACACGGCTGTGG
GAACTTTGTCCGTGTAATTCAGACTTTCAATCGCACACATTTGTATGTCTGTGGGAGTGGCGCTTTCAGTCCTGTCTGTACTTACTTGAA
CAGAGGGAGGAGATCAGAGGACCAAGTTTTCATGATTGACTCCAAGTGTGAATCTGGAAAAGGACGCTGCTCTTTCAACCCCAACGTGAA
CACGGTGTCTGTTATGATCAATGAGGAGCTTTTCTCTGGAATGTATATAGATTTCATGGGGACAGATGCTGCTATTTTTCGAAGTTTAAC
CAAGAGGAATGCGGTCAGAACTGATCAACATAATTCCAAATGGCTAAGTGAACCTATGTTTGTAGATGCACATGTCATCCCAGATGGTAC
TGATCCAAATGATGCTAAGGTGTACTTCTTCTTCAAAGAAAAACTGACTGACAATAACAGGAGCACGAAACAGATTCATTCCATGATTGC
TCGAATATGTCCTAATGACACTGGTGGACTGCGTAGCCTTGTCAACAAGTGGACCACTTTCTTAAAGGCGAGGCTGGTGTGCTCGGTAAC
AGATGAAGACGGCCCAGAAACACACTTTGATGAATTAGAGGATGTGTTTCTGCTGGAAACTGATAACCCGAGGACAACACTAGTGTATGG
CATTTTTACAACATCAAGCTCAGTTTTCAAAGGATCAGCCGTGTGTGTGTATCATTTATCTGATATACAGACTGTGTTTAATGGGCCTTT
TGCCCACAAAGAAGGGCCCAATCATCAGCTGATTTCCTATCAGGGCAGAATTCCATATCCTCGCCCTGGAACTTGTCCAGGAGGAGCATT
TACACCCAATATGCGAACCACCAAGGAGTTCCCAGATGATGTTGTCACTTTTATTCGGAACCATCCTCTCATGTACAATTCCATCTACCC
AATCCACAAAAGGCCTTTGATTGTTCGTATTGGCACTGACTACAAGTATACAAAGATAGCTGTGGATCGAGTGAACGCTGCTGATGGGAG
ATACCATGTCCTGTTTCTCGGAACAGTGTGACAGTGACAGTGACCAGGAAGAGAAGGCATCAGATGCCAGCTCTGAAAAACTCTTCAACA
CTGTTATTGTAAACAAAGATCCGGAGTTAGGTGTTGGCACGCTACCAGAACATGACAGCCAGGATGCAGGGCCGATTGTCCCCAAGATAT
CGGGTCTAGAGAGAAGCCAGGAGAAGAGCCAGGACTGTTGCAAAGAGCCAATCTTTGAGCCTGTGGTGCTTAAAGACCCCTGCCCTCAGG
TCGCACAGCCAATACCCCAGCCGCAGACGGAGCCCCAACTCCGAGCTCCTTCTCCGGACCCTGACTTGGTGCAGCGCACAGAGGCCCCAC
CTCAACCCCCACCTCTGAGTACACAGCCACCACAGGGCCCTCCTGAGGCCCAGCTCCAGCCTGCCCCGCAGCCTCAGGTGCAGAGGCCAC
CCAGGCCACAGTCCCCCACCCAGCTGCTCCATCAGAACCTCCCACCTGTGCAGGCCCACCCCTCTGCTCAGAGCCTCTCCCAGCCATTGT
CAGCCTACAACAGCAGTAGCTTAAGCCTCAACAGTTTAAGCAGCAGCAGAAGCAGCACTCCAGCGAAGACTCAGCCCGCCCCACCTCACA
TCTCCCACCACCCCTCTGCCTCCCCGTTCCCCCTCTCCCTGCCCAACCACAGCCCCCTGCACAGCTTCACACCCACCCTCCAGCCCCCCG
CACACTCACATCACCCCAATATGTTTGCCCCTCCCACTGCTCTGCCTCCTCCACCACCACTGACATCAGGAAGTCTGCAGGTGGCCGGAC
ACCCGGCCGGGAGCACTTACTCAGAGCAAGACATCTTGCGACAGGAACTGAACACTCGTTTTTTGGCCTCTCAGAGTGCTGACCGCGGGG
CTTCCCTGGGCCCTCCGCCCTACCTGCGGACCGAGTTCCATCAGCACCAGCACCAGCACCAGCACACCCACCAGCACACGCACCAGCACA
CCTTCACGCCGTTCCCCCACGCCATCCCACCCACCGCCATCATGCCGACGCCAGCACCTCCCATGTTTGACAAATACCCTACAAAAGTTG
ACCCATTCTACCGGCACAGTCTCTTCCATTCCTATCCTCCTGCAGTGTCGGGCATCCCCCCTATGATCCCACCCACTGGCCCTTTTGGTT
CACTACAAGGAGCATTTCAGCCGAAGACATCCAACCCTATCGATGTCGCTGCTCGGCCTGGGACAGTCCCACACACTTTACTCCAAAAGG
ACCCGAGGTTGACAGATCCTTTCAGACCTATGTTAAGGAAACCAGGGAAGTGGTGTGCTATGCATGTTCACATCGCCTGGCAGATTTACC
ACCACCAACAGAAAGTCAAGAAACAGATGCAGTCAGACCCACATAAGCTGGACTTTGGACTGAAACCTGAGTTCCTGAGCCGCCCTCCAG
GCCCCAGTCTTTTTGGAGCCATCCACCACCCCCATGACCTGGCACGGCCTTCAACTTTGTTCTCTGCCGCTGGTGCTGCACACCCAACTG
GGACCCCTTTTGGGCCACCTCCTCATCACAGCAACTTCCTCAACCCTGCTGCCCACCTAGAGCCTTTTAATCGGCCGTCTACATTCACAG
GCCTAGCAGCAGTTGGTGGCAATGCCTTCGGGGGACTTGGAAATCCTTCCGTTACACCCAACTCAATGTTCGGCCACAAGGATGGCCCCA
GTGTGCAGAACTTTAGCAACCCTCACGAACCCTGGAACCGGCTGCACCGAACGCCTCCGTCGTTCCCGACCCCTCCGCCCTGGCTGAAGC
CAGGGGAGCTGGAGCGCAGCGCGTCCGCTGCAGCTCATGACAGAGATAGAGATGTAGATAAACGAGACTCATCTGTTAGTAAAGATGACA
AAGAAAGGGAAAGCGTCGAGAAGAGACACTCCAGCCACCCTTCACCAGCACCTGTCCTCCCGGTGAATGCCCTGGGACATACCCGCAGCT
CCACTGAACAGATCCGGGCTCATCTGAACACTGAGGCTCGGGAGAAGGACAAACCCAAAGAGAGGGAGAGAGACCACTCGGAATCCCGCA
AGGACCTGGCCGCCGACGAGCACAAGGCGAAAGAGGGCCACCTGCCCGAGAAGGACGGGCACGGCCACGAGGGGCGCGCCGCGGGCGAAG
AGGCCAAGCAGCTGGCCCGGGTGCCGTCTCCCTACGTGCGGACCCCGGTGGTGGAGAGTGCCAGGCCCAACAGCACCTCGAGCCGGGAGG
CCGAGCCGCGCAAGGGTGAGCCGGCCTACGAGAACCCCAAGAAGAGCTCCGAGGTCAAGGTGAAGGAGGAGCGGAAGGAAGACCATGACC
TGCCTCCAGAGGCCCCGCAGACCCACCGGGCCTCGGAGCCGCCGCCTCCCAACTCCTCGTCCAGCGTGCACCCGGGGCCCCTGGCCTCGA
TGCCCATGACGGTGGGGGTGACGGGCATTCACCCCATGAACAGCATCAGCAGCCTGGACAGGACTCGCATGATGACCCCCTTCATGGGCA
TCAGCCCCCTCCCGGGCGGAGAGCGCTTCCCGTACCCTTCTTTCCACTGGGACCCCATCCGGGACCCCTTGAGGGATCCTTACCGAGAAC
TTGACATTCACCGGAGAGACCCGCTGGGCAGGGACTTCCTGCTAAGGAACGACCCGCTCCACCGGCTCTCGACTCCCCGGCTGTACGAAG
CCGACCGCTCCTTCAGGGACCGGGAGCCTCACGACTACAGCCACCACCACCACCACCACCACCACCCGCTGTCTGTGGACCCTCGGCGGG
AGCACGAGCGGGGAGGCCACCTGGACGAGCGGGAGCGCTTGCACATGCTCAGAGAAGACTACGAGCACACGCGGCTCCACTCCGTGCACC
CCGCCTCCCTCGACGGACACCTCCCCCACCCCAGCCTCATCACCCCGGGACTCCCCAGCATGCACTATCCCCGCATCAGCCCCACCGCGG
GCAACCAGAACGGACTCCTCAACAAGACCCCTCCGACAGCAGCGCTGAGCGCACCTCCCCCGCTCATCTCCACGCTGGGGGGCCGCCCGG
TCTCTCCCAGAAGGACGACTCCTCTGTCCGCAGAGATAAGGGAGAGGCCCCCTTCCCACACGCTGAAGGATATCGAGGCCCGATAAGCCG
AGAACAGGAGCAAGAACGAGGAAGAAGAAACCCTAGGCAGACACCAGGCCAGGCTTGAGAGACAGAACTCCTGCATGGCTCACACAGACT
GGGGGGGAAAGCCCCACCCCTTCCCCTTGTAAAAAATGTATAGACTCAGTGCACATTTTGAAATGTTTTGTATATTATATGTTGAGATTT
TTCAGATCTTTTAGCCCAGTCATATGTTCTCACGTCTCCTACTTTTTGTTTCTCGTATAAAACTTTTTGATTTGAACCAAAACAGTGAAG
ATGACAACACACACCAATTGGATGATAATTGTAGCGGGGGCGGTGGGGGGGAGAAGTCCACGCCATCCATCATGCAAAATTCTTTCAGAT
GAGGTGGGAAGGCCGTGTACATAGTTATGTAAAAAGAGATTGCTTCATGAGCTAATGGTTCATATATGCAAAAGGGTAAGATGAAAGCTT
TACTTTGTACAAATGTAAATAGATAAAGTAACATAATACATTAATACTTCTTAAAATGTGCTATTTGCAAACTTACTTAATATCAGTGAA
CACAGTCGGCTAAAGCTGTGTTCCCATATATTGTTATAGACAGCTAAACCCTTCAACTATGCAATGAATGTTCGGGCTTTTCACAAAAGC
CCGCCTAACTCAAAGGAGCCTTTTCAAATCCATTTACAGCATACTTAAGGTCATATTTTCCCTGAACAAGCGCTTACGTGATATGACTCT
GTTTTCCTTGCTTGTTTTTTTTCAAACGGAGAAACATCCTGTTTTGCAAATTGGACCCCAGGCTGGAACTTAGCATCTGAAGTTGCCGCT
TGTGGGCTCTGGGGGAAAGTGTAGCCCCGGAGAGGTAACTGAGGACATGAGCAACCAGTGCCAGGGAGGGTGGGATTTGCCAGATGCCAA
AATCAGGGGACGGGTGGTGGTGTCTGTCAGACACACACAGGTCGCCAGTGACTTCACACACACCTCATGTGAGAACCATGCCTTTTTTAG
TGTGTCCTATTTCATACCTGTACACACTTCCTCGTTTTGTAATGAGATTTACTTACACCCAAACAGATCCTGAAAGAAAGCTTCAAGTTT
TCTCAGATGATGGATATGTTTTCACTGTATTCAATAACTGACGGATGTAAGGTGCACGTTTCCTGATGTGACGCACTGTATTCCAGCTGG
TGATCAAGTCTGGGAACAGCCGTAACAGGTCAACCTTGTGGAGCCATCGCGAGTTAGAGGGTGAAAGATGGCAGAAAAAAAAGTCTTGTG
TGTGAGTGTGTTTTTTGAGTTTGCATCAATCTTAATGTCTCTTCATAATACTTTTATAATACATTAAGCCTCTTGTCTACATATTTGGAG
AGAATATGACTTTACTAGCAGAGAAATACAATATATCTTGTCTACTGGACTGTAAAATATATGTATGAAATAAAATTAGTTCCATTTGGT
CTTCTAGTATATTAAAGTGCTATCTGACGTTGTTATCCTGTTTTTGCAAAAAAAAAAAAAAAAAAAAGTTAACTACAGACCATTGTTTCT
AATAAGCAGAGAGATCTATTTTAGTAGTAAACTGAAGGTTTAGTTGTGAGCTTCAGATTTTGTGAACTCCAGATGTTGTGCGGTGTTTTT
TTTTTTTTTTAAGACAACAACTAAAAAAAATGCAAGGAATATGTACACTGGAACTGTAGTGGTAGCTTTCAGTATTGTAAAGAGATTGTT
CTATACGGACCTTTTTGCTGTTTATCCTGTATGTAATAAAGTCCTTTCTAGATCCTATGTGAAAAGAAAAGTGAAGCAACTGAATCTTCA
GCATGTTCTCATCGGCGGAGCCTTCTTGTGTAATGTAAACTGTGCCATGTTATTAAAAAATGTGAACTAAGCTTCCAGCTGCTTGTTTGT
GTGAGGTGACCATCATTACCTTAGGGAAGAAGCCATACCTGTACAAGACCGGGCTCTTGAAAAGAAACACCTCGAACCCAGCCCGTGTAA


Top

FusionGenePPI for SEMA3C_AUTS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SEMA3CSCGB2A2, SDC2AUTS2PCGF3, PCGF5, RNF2, CSNK2A2, RYBP, RING1, YAF2, CSNK2A1, CSNK2B, DCAF7, FBRS, EP300, RERE, RBM14, ZNF608, ZNF609, TLE3, WDR5, PCGF6, ATN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SEMA3C_AUTS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SEMA3C_AUTS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSEMA3CC0041207Truncus Arteriosus, Persistent1CTD_human
TgeneAUTS2C0036341Schizophrenia2PSYGENET
TgeneAUTS2C0014544Epilepsy1CTD_human