FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 33043

FusionGeneSummary for SEC23B_ZCCHC7

check button Fusion gene summary
Fusion gene informationFusion gene name: SEC23B_ZCCHC7
Fusion gene ID: 33043
HgeneTgene
Gene symbol

SEC23B

ZCCHC7

Gene ID

10483

84186

Gene nameSec23 homolog B, coat complex II componentzinc finger CCHC-type containing 7
SynonymsCDA-II|CDAII|CDAN2|CWS7|HEMPAS|hSec23BAIR1|HSPC086
Cytomap

20p11.23

9p13.2

Type of geneprotein-codingprotein-coding
Descriptionprotein transport protein Sec23BSEC23-like protein BSEC23-related protein BSec23 homolog B, COPII coat complex componenttransport protein SEC23Bzinc finger CCHC domain-containing protein 7TRAMP-like complex RNA-binding factor ZCCHC7zinc finger, CCHC domain containing 7
Modification date2018052320180519
UniProtAcc

Q15437

Q8N3Z6

Ensembl transtripts involved in fusion geneENST00000262544, ENST00000336714, 
ENST00000377475, ENST00000377465, 
ENST00000494645, 
ENST00000336755, 
ENST00000534928, ENST00000461038, 
ENST00000322831, 
Fusion gene scores* DoF score8 X 7 X 8=4485 X 4 X 5=100
# samples 105
** MAII scorelog2(10/448*10)=-2.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SEC23B [Title/Abstract] AND ZCCHC7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CV-A45T-01ASEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262544ENST00000336755SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000262544ENST00000534928SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-3UTRENST00000262544ENST00000461038SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-intronENST00000262544ENST00000322831SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000336714ENST00000336755SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000336714ENST00000534928SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-3UTRENST00000336714ENST00000461038SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-intronENST00000336714ENST00000322831SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000377475ENST00000336755SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000377475ENST00000534928SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-3UTRENST00000377475ENST00000461038SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-intronENST00000377475ENST00000322831SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000377465ENST00000336755SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
In-frameENST00000377465ENST00000534928SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-3UTRENST00000377465ENST00000461038SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
5CDS-intronENST00000377465ENST00000322831SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
intron-3CDSENST00000494645ENST00000336755SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
intron-3CDSENST00000494645ENST00000534928SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
intron-3UTRENST00000494645ENST00000461038SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+
intron-intronENST00000494645ENST00000322831SEC23Bchr20

18506576

+ZCCHC7chr9

37349354

+

Top

FusionProtFeatures for SEC23B_ZCCHC7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SEC23B

Q15437

ZCCHC7

Q8N3Z6

Component of the coat protein complex II (COPII) whichpromotes the formation of transport vesicles from the endoplasmicreticulum (ER). The coat has two main functions, the physicaldeformation of the endoplasmic reticulum membrane into vesiclesand the selection of cargo molecules for their transport to theGolgi complex. {ECO:0000250|UniProtKB:Q15436}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneZCCHC7chr20:18506576chr9:37349354ENST00000336755+59348_365329544Zinc fingerCCHC-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSEC23Bchr20:18506576chr9:37349354ENST00000262544+720634_720278768RepeatGelsolin-like
HgeneSEC23Bchr20:18506576chr9:37349354ENST00000336714+720634_720278768RepeatGelsolin-like
HgeneSEC23Bchr20:18506576chr9:37349354ENST00000377465+720634_720278768RepeatGelsolin-like
HgeneSEC23Bchr20:18506576chr9:37349354ENST00000377475+720634_720278768RepeatGelsolin-like
TgeneZCCHC7chr20:18506576chr9:37349354ENST00000336755+59241_258329544Zinc fingerCCHC-type 1
TgeneZCCHC7chr20:18506576chr9:37349354ENST00000336755+59263_280329544Zinc fingerCCHC-type 2
TgeneZCCHC7chr20:18506576chr9:37349354ENST00000336755+59304_321329544Zinc fingerCCHC-type 3


Top

FusionGeneSequence for SEC23B_ZCCHC7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_493aa
MATYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPLACLLTPLKERPDLPPVQTEPVLCSRPTCKAVLNPLCQVDTRAKLWACNFCFQ
RNQFPPATGGISEVNQPAELMPQFSTIEYVIQRGAQSPLIFLTVVDTCLEEDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSC
EGISKSTVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGVAL
SIAVGLLETKPGPPKKPKTPSRPSALATCTHCAQKGHTGHECPEREVTDPSPVSPFICYTDDKTEIQEREKRLKQKIKVLKKNGVIPEPS
KLPTIKAANENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTYSSPGSFKTQKPSKPFHRSSHY


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_1479nt
ATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAG
GCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTT
TGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAA
AGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTG
ATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCC
CTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGT
GAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCC
ATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATG
AACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTG
TCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTAT
CACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTAT
GATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCC
AAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAA
GAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAG
GATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTAC
CACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_2850nt
ATCGTTCTCGCTTTCCGGTAGCTAAGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAG
GAGCGCTGGCTGCGCTTAGGCAACGGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGA
ACTCTCGTTTTGAAGTGCGACATACACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCG
TCGGAGAAGCGCTCTTTGATTGGCCAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACT
TGGCGGTGGGAGCCGGAGCCTGCTTGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGGTGAGCGGCTCCGGCCAGGTGAGCGGGGCGCA
TAGGTGACGGAGGGCCGAGGGCACGGTTCCCTTTTAGACTATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGT
GCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGA
ACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGA
TTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACC
TGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACAC
ATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGAT
CACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGC
AAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGC
TTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAAC
TCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCC
GAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGT
GTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAAT
AAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAG
GAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGA
GAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAAC
CCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCA
GAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCAGAGAAAAAAAAAGTCTTAAGCCGTCAGGCA
GCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTGTGTTTATTATCTATGATTAAATAAAGTGAG
TTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGATCTCAATTCTCTGTGTCCAACAGGATATTAG
GTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAGAATCCTAGGGATAGGTAGAAGAATTCATCT
TTTCAAGAAAGTGTTTTAAAAATACTTTGGGAAAAAAACTGCATCAAAGGTAATTTATCCTCAAATTAAATCCTTGCAGGAAGAGAAATT
AACACTAAGAAAAAGTCATCAATATTTTTCAACTTTTTTTTTTTTTTTTTTTACTTTGGAAAGGACAATAACTATAAACCTATATCCAGA
TTTTCTTTCTGCTGAAGCTGTTGTCAGAATCTTCCTTTGGACAAAACATCACTAGCTGACTATAAAAACAAAAGTGTCATCATTGAAGCC
CTGAAGAGGCAGGGAATTGAGCTTCAGCAAAATACAGGAAAAGAACTATCCAGTATAAATGTCAGAAGACAGATTTCCTAAACAAGTAAA
AGAGACATCAAAAATTTTAACATAATCACAATGAAATCATTTTTTACCACTTTTACAGCGGTGTTTCAAGCGGACTGTCACTCAGATCTG
CAGAGATGAATATTACTCAAAAAATTTTTTTGTTCTCTTGCATTTTTTTCAACTACCGCAAAGCTATACAGATTTTTTTGTACTTGTGGA

>In-frame_SEC23B_ENST00000262544_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_2267nt
ATCGTTCTCGCTTTCCGGTAGCTAAGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAG
GAGCGCTGGCTGCGCTTAGGCAACGGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGA
ACTCTCGTTTTGAAGTGCGACATACACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCG
TCGGAGAAGCGCTCTTTGATTGGCCAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACT
TGGCGGTGGGAGCCGGAGCCTGCTTGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGGTGAGCGGCTCCGGCCAGGTGAGCGGGGCGCA
TAGGTGACGGAGGGCCGAGGGCACGGTTCCCTTTTAGACTATGGCGACATACCTGGAGTTCATCCAGCAGAATGAAGAACGGGATGGTGT
GCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACCCCTGGCTTGTCTCCTTACTCCTTTGAAAGA
ACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAAAGCTGTTCTCAACCCACTTTGTCAGGTTGA
TTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGCTTATGGAGGCATATCTGAGGTGAATCAACC
TGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTCCCCTCTGATCTTTCTCTATGTGGTTGACAC
ATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCTTCTTCCTCCAGATGCTCTGGTGGGTCTGAT
CACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTATGTCTTCCGAGGGACCAAGGATTTAACTGC
AAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACGACCTGCACAACCACAGGAGCACCCTTTTGC
TTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGGGGAGCTACAGAGGGACCCATGGCCAGTAAC
TCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCTGGAGACCAAACCTGGACCACCCAAAAAGCC
GAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCATTATGGACACGAATGTCCAGAAAGAGAAGT
GTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCAGGAGAGAGAAAAGAGACTAAAACAAAAAAT
AAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGCAGCAAATGAGAACCCCCACCATGATATAAG
GAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAAAGAAATGAAGAACAAGAATAGAAACTGGGA
GAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAAAACCTACTCTTCTCCTGGCAGTTTTAAAAC
CCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCA
GAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCAGAGAAAAAAAAAGTCTTAAGCCGTCAGGCA
GCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTGTGTTTATTATCTATGATTAAATAAAGTGAG
TTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGATCTCAATTCTCTGTGTCCAACAGGATATTAG
GTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAGAATCCTAGGGATAGGTAGAAGAATTCATCT

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_2792nt
ATCGTTCTCGCTTTCCGGTAGCTAAGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAG
GAGCGCTGGCTGCGCTTAGGCAACGGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGA
ACTCTCGTTTTGAAGTGCGACATACACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCG
TCGGAGAAGCGCTCTTTGATTGGCCAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACT
TGGCGGTGGGAGCCGGAGCCTGCTTGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGTTCCCTTTTAGACTATGGCGACATACCTGGAG
TTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTA
CCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGT
AAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCA
GCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAG
TCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGT
CTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGT
TATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCA
CGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTT
GGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTG
CTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGC
CATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATT
CAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAA
GCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAA
AAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCC
AAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGAC
AAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAG
CAGAGAAAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCAC
TGTGTTTATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAG
ATCTCAATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTC
AGAATCCTAGGGATAGGTAGAAGAATTCATCTTTTCAAGAAAGTGTTTTAAAAATACTTTGGGAAAAAAACTGCATCAAAGGTAATTTAT
CCTCAAATTAAATCCTTGCAGGAAGAGAAATTAACACTAAGAAAAAGTCATCAATATTTTTCAACTTTTTTTTTTTTTTTTTTTACTTTG
GAAAGGACAATAACTATAAACCTATATCCAGATTTTCTTTCTGCTGAAGCTGTTGTCAGAATCTTCCTTTGGACAAAACATCACTAGCTG
ACTATAAAAACAAAAGTGTCATCATTGAAGCCCTGAAGAGGCAGGGAATTGAGCTTCAGCAAAATACAGGAAAAGAACTATCCAGTATAA
ATGTCAGAAGACAGATTTCCTAAACAAGTAAAAGAGACATCAAAAATTTTAACATAATCACAATGAAATCATTTTTTACCACTTTTACAG
CGGTGTTTCAAGCGGACTGTCACTCAGATCTGCAGAGATGAATATTACTCAAAAAATTTTTTTGTTCTCTTGCATTTTTTTCAACTACCG
CAAAGCTATACAGATTTTTTTGTACTTGTGGATCTTTTGTACTTCTCATAACCTAATGTCAGACTAAGAAAAATAAAATATCTGAGAGTA

>In-frame_SEC23B_ENST00000336714_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_2209nt
ATCGTTCTCGCTTTCCGGTAGCTAAGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAG
GAGCGCTGGCTGCGCTTAGGCAACGGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGA
ACTCTCGTTTTGAAGTGCGACATACACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCG
TCGGAGAAGCGCTCTTTGATTGGCCAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACT
TGGCGGTGGGAGCCGGAGCCTGCTTGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGTTCCCTTTTAGACTATGGCGACATACCTGGAG
TTCATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTA
CCCCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGT
AAAGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCA
GCTTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAG
TCCCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGT
CTTCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGT
TATGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCA
CGACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTT
GGGGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTG
CTGGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGC
CATTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATT
CAGGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAA
GCAGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAA
AAAGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCC
AAAACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGAC
AAGTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAG
CAGAGAAAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCAC
TGTGTTTATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAG
ATCTCAATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTC

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_2786nt
AGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAGGAGCGCTGGCTGCGCTTAGGCAAC
GGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGAACTCTCGTTTTGAAGTGCGACATA
CACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCGTCGGAGAAGCGCTCTTTGATTGGC
CAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACTTGGCGGTGGGAGCCGGAGCCTGCT
TGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGGTGAGCGGCTCCGGCCAGTTCCCTTTTAGACTATGGCGACATACCTGGAGTTCATC
CAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACCCCTG
GCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAAAGCT
GTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGCTTAT
GGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTCCCCT
CTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCTTCTT
CCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTATGTC
TTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACGACCT
GCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGGGGAG
CTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCTGGAG
ACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCATTAT
GGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCAGGAG
AGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGCAGCA
AATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAAAGAA
ATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAAAACC
TACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAAGTCT
CCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCAGAGA
AAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTGTGTT
TATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGATCTCA
ATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAGAATC
CTAGGGATAGGTAGAAGAATTCATCTTTTCAAGAAAGTGTTTTAAAAATACTTTGGGAAAAAAACTGCATCAAAGGTAATTTATCCTCAA
ATTAAATCCTTGCAGGAAGAGAAATTAACACTAAGAAAAAGTCATCAATATTTTTCAACTTTTTTTTTTTTTTTTTTTACTTTGGAAAGG
ACAATAACTATAAACCTATATCCAGATTTTCTTTCTGCTGAAGCTGTTGTCAGAATCTTCCTTTGGACAAAACATCACTAGCTGACTATA
AAAACAAAAGTGTCATCATTGAAGCCCTGAAGAGGCAGGGAATTGAGCTTCAGCAAAATACAGGAAAAGAACTATCCAGTATAAATGTCA
GAAGACAGATTTCCTAAACAAGTAAAAGAGACATCAAAAATTTTAACATAATCACAATGAAATCATTTTTTACCACTTTTACAGCGGTGT
TTCAAGCGGACTGTCACTCAGATCTGCAGAGATGAATATTACTCAAAAAATTTTTTTGTTCTCTTGCATTTTTTTCAACTACCGCAAAGC

>In-frame_SEC23B_ENST00000377475_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_2203nt
AGGCGATCAGCGGGACTTCCCACTGAGACGAGCGGATGTCATATTGTATCAGGGCGAACCTCTGAGGAGCGCTGGCTGCGCTTAGGCAAC
GGTGCGGCAGGCGCCGGGGTTTTCTGAAACAGAAACGTTTAGGGGTGGGGAAACGTGTTCCGAGGAACTCTCGTTTTGAAGTGCGACATA
CACCTGTCTTGCCCTGTTCCAAGATGGTGGCAGAGCTTCTCTGAGTCTCTCGCTTCCTCCAGTCCGTCGGAGAAGCGCTCTTTGATTGGC
CAGTGGACAGCGCCGTGGCATGACGCGCTGGGGCGCTGGCCAATCGGTTGAGAGCTGAGCTGGACTTGGCGGTGGGAGCCGGAGCCTGCT
TGTTGCAGCTGTGGGTGAGGACGGCTCTAGCTAGGTGAGCGGCTCCGGCCAGTTCCCTTTTAGACTATGGCGACATACCTGGAGTTCATC
CAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACCCCTG
GCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAAAGCT
GTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGCTTAT
GGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTCCCCT
CTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCTTCTT
CCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTATGTC
TTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACGACCT
GCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGGGGAG
CTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCTGGAG
ACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCATTAT
GGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCAGGAG
AGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGCAGCA
AATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAAAGAA
ATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAAAACC
TACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAAGTCT
CCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCAGAGA
AAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTGTGTT
TATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGATCTCA
ATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAGAATC

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000336755_chr9_37349354_+_2610nt
GCTTCTGGGAGGAGGCCTTTTCTTGACAGTTTAGGGTAGCGGGGGAATGGATGATCCGGGAGTCCCCTGCGGATGTCGTCCCGCACCAGG
CCGGGACCGATTTCTGGCTCCAGTTTCCCCAGAATTGCGGAGTGCGCACACCTGGAAGGACCCAAGTCCCGTTTTATAGTTGAGAAACTC
AAGACTCAGACAAGTGAAACGACTTTTGCTTCATGACAGCTGGAACTGGAACCCAGTTCCCTTTTAGACTATGGCGACATACCTGGAGTT
CATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACC
CCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAA
AGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGC
TTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTC
CCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCT
TCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTA
TGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACG
ACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGG
GGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCT
GGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCA
TTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCA
GGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGC
AGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAA
AGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAA
AACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAA
GTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCA
GAGAAAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTG
TGTTTATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGAT
CTCAATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAG
AATCCTAGGGATAGGTAGAAGAATTCATCTTTTCAAGAAAGTGTTTTAAAAATACTTTGGGAAAAAAACTGCATCAAAGGTAATTTATCC
TCAAATTAAATCCTTGCAGGAAGAGAAATTAACACTAAGAAAAAGTCATCAATATTTTTCAACTTTTTTTTTTTTTTTTTTTACTTTGGA
AAGGACAATAACTATAAACCTATATCCAGATTTTCTTTCTGCTGAAGCTGTTGTCAGAATCTTCCTTTGGACAAAACATCACTAGCTGAC
TATAAAAACAAAAGTGTCATCATTGAAGCCCTGAAGAGGCAGGGAATTGAGCTTCAGCAAAATACAGGAAAAGAACTATCCAGTATAAAT
GTCAGAAGACAGATTTCCTAAACAAGTAAAAGAGACATCAAAAATTTTAACATAATCACAATGAAATCATTTTTTACCACTTTTACAGCG
GTGTTTCAAGCGGACTGTCACTCAGATCTGCAGAGATGAATATTACTCAAAAAATTTTTTTGTTCTCTTGCATTTTTTTCAACTACCGCA
AAGCTATACAGATTTTTTTGTACTTGTGGATCTTTTGTACTTCTCATAACCTAATGTCAGACTAAGAAAAATAAAATATCTGAGAGTAAA

>In-frame_SEC23B_ENST00000377465_chr20_18506576_+_ZCCHC7_ENST00000534928_chr9_37349354_+_2027nt
GCTTCTGGGAGGAGGCCTTTTCTTGACAGTTTAGGGTAGCGGGGGAATGGATGATCCGGGAGTCCCCTGCGGATGTCGTCCCGCACCAGG
CCGGGACCGATTTCTGGCTCCAGTTTCCCCAGAATTGCGGAGTGCGCACACCTGGAAGGACCCAAGTCCCGTTTTATAGTTGAGAAACTC
AAGACTCAGACAAGTGAAACGACTTTTGCTTCATGACAGCTGGAACTGGAACCCAGTTCCCTTTTAGACTATGGCGACATACCTGGAGTT
CATCCAGCAGAATGAAGAACGGGATGGTGTGCGTTTTAGTTGGAACGTGTGGCCTTCCAGCCGGCTGGAGGCTACAAGAATGGTTGTACC
CCTGGCTTGTCTCCTTACTCCTTTGAAAGAACGTCCAGACCTACCTCCTGTACAATATGAACCTGTGCTTTGCAGCAGGCCAACTTGTAA
AGCTGTTCTCAACCCACTTTGTCAGGTTGATTATCGAGCAAAACTTTGGGCCTGTAATTTCTGTTTTCAAAGAAATCAGTTTCCTCCAGC
TTATGGAGGCATATCTGAGGTGAATCAACCTGCCGAATTGATGCCCCAGTTTTCTACAATTGAGTACGTGATACAGCGAGGTGCTCAGTC
CCCTCTGATCTTTCTCTATGTGGTTGACACATGCCTGGAGGAAGATGACCTTCAAGCACTCAAAGAGTCCCTGCAGATGTCCCTGAGTCT
TCTTCCTCCAGATGCTCTGGTGGGTCTGATCACATTTGGAAGGATGGTGCAGGTTCATGAGCTAAGCTGTGAAGGAATCTCCAAAAGTTA
TGTCTTCCGAGGGACCAAGGATTTAACTGCAAAGCAAATACAGGATATGTTGGGCCTGACCAAGCCAGCCATGCCCATGCAGCAAGCACG
ACCTGCACAACCACAGGAGCACCCTTTTGCTTCAAGCAGATTTCTGCAGCCTGTTCACAAGATTGATATGAACCTCACTGATCTTCTTGG
GGAGCTACAGAGGGACCCATGGCCAGTAACTCAGGGGAAGAGACCTTTGCGATCCACTGGTGTGGCTTTGTCCATTGCTGTTGGCTTGCT
GGAGACCAAACCTGGACCACCCAAAAAGCCGAAGACCCCTTCAAGACCATCAGCCTTAGCATATTGCTATCACTGCGCGCAAAAAGGCCA
TTATGGACACGAATGTCCAGAAAGAGAAGTGTATGACCCGTCTCCAGTATCTCCATTCATCTGCTACTATGATGACAAATATGAAATTCA
GGAGAGAGAAAAGAGACTAAAACAAAAAATAAAAGTACTCAAGAAAAATGGGGTTATCCCAGAGCCATCCAAGCTACCTTATATAAAAGC
AGCAAATGAGAACCCCCACCATGATATAAGGAAGGGCCGTGCCTCATGGAAAAGCAACAGGTGGCCTCAAGAAAATAAAGAAACACAAAA
AGAAATGAAGAACAAGAATAGAAACTGGGAGAAGCACAGGAAGGCTGACAGACATCGTGAAGTGGATGAGGATTTTCCCAGGGGCCCCAA
AACCTACTCTTCTCCTGGCAGTTTTAAAACCCAGAAGCCTTCTAAGCCCTTTCACCGTTCATCACATTACCACACGTCAAGAGAAGACAA
GTCTCCCAAGGAAGGCAAGAGGGGCAAGCAGAAGAAAAAGGAGAGGTGCTGGGAAGATGATGACAATGATAACTTATTTCTTATTAAGCA
GAGAAAAAAAAAGTCTTAAGCCGTCAGGCAGCCTCTGATGTGGCTTTTCATTGTTCATTTGGCCTTTGTGTCTATAACCTTCTGGCACTG
TGTTTATTATCTATGATTAAATAAAGTGAGTTTTTGGTTTTGTTTTTTTAATTTCAGCCATTCCTAGAGTTACTGAATATCCATGGAGAT
CTCAATTCTCTGTGTCCAACAGGATATTAGGTAAGAAAGTACAAAGATAAACCTGGACTTCTCCTATTCCAATATGTCATCTTTACTCAG


Top

FusionGenePPI for SEC23B_ZCCHC7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SEC23BSEC24C, SEC24D, FYCO1, SIRT7, SYK, CUL3, CAND1, SEC24B, SRSF3, FN1, DAB2, TMED9, TMED10, TMED1, TMED2, KDELR1, UGT1A1, GALNT1, MAN2A1, SRPK2, SRPK1, PXN, ZYX, CSNK1A1, HOXA3, SEC23B, CPSF7, FATE1, DTX2, PRRC1, SYNE4, SLC25A35, KCNJ10, CPNE2, SEC13, DCUN1D1, SEC23A, SEC31A, SUMO2, SUMO3, SEC24A, NTRK1, STIL, TMEM17, TMEM216, CENPJ, XPO1, SEC16A, MCM2, NF2, SNW1, ATOH1, KIAA0226L, TRIM25, BRCA1ZCCHC7PAPD5, PAPD7, ELAVL1, LYN, SUMO1, SUMO2, PHC1, UBE2I, CARD9, RPL10A, RPL14, PDLIM7, HDLBP, SENP5, EIF2S2, HDGFRP2, ZNHIT6, FAM208A, PPAN, HIST1H1T, KIAA0020, NOL12, DGCR8, RPL28, ZKSCAN1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SEC23B_ZCCHC7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SEC23B_ZCCHC7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSEC23BC1306589Congenital dyserythropoietic anemia, type II2ORPHANET;UNIPROT
HgeneSEC23BC0002876Congenital dyserythropoietic anemia1CTD_human
HgeneSEC23BC4225179COWDEN SYNDROME 71UNIPROT