FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32887

FusionGeneSummary for SCP2_TMPRSS2

check button Fusion gene summary
Fusion gene informationFusion gene name: SCP2_TMPRSS2
Fusion gene ID: 32887
HgeneTgene
Gene symbol

SCP2

TMPRSS2

Gene ID

10388

7113

Gene namesynaptonemal complex protein 2transmembrane serine protease 2
SynonymsSCP-2|SCP2PP9284|PRSS10
Cytomap

20q13.33

21q22.3

Type of geneprotein-codingprotein-coding
Descriptionsynaptonemal complex protein 2synaptonemal complex lateral element proteintransmembrane protease serine 2epitheliasinserine protease 10transmembrane protease, serine 2
Modification date2018051920180523
UniProtAcc

P22307

O15393

Ensembl transtripts involved in fusion geneENST00000371514, ENST00000528311, 
ENST00000371509, ENST00000407246, 
ENST00000371513, ENST00000473584, 
ENST00000430330, ENST00000408941, 
ENST00000435345, ENST00000488965, 
ENST00000332149, ENST00000398585, 
ENST00000458356, ENST00000497881, 
Fusion gene scores* DoF score6 X 5 X 4=12016 X 12 X 3=576
# samples 620
** MAII scorelog2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/576*10)=-1.52606881166759
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: SCP2 [Title/Abstract] AND TMPRSS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTissue-specifically expressed gene involved fusion gene, inframe and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTMPRSS2

GO:0006508

proteolysis

21068237|24227843

TgeneTMPRSS2

GO:0046598

positive regulation of viral entry into host cell

21068237|24227843


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-YL-A8SC-01ASCP2chr1

53504718

+TMPRSS2chr21

42861520

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000371514ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000371514ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000371514ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000371514ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000528311ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000528311ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000528311ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000528311ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000371509ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000371509ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000371509ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000371509ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000407246ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000407246ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000407246ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000407246ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000371513ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000371513ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000371513ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-intronENST00000371513ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000473584ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000473584ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000473584ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-intronENST00000473584ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000430330ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000430330ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000430330ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000430330ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000408941ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000408941ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000408941ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-intronENST00000408941ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000435345ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000435345ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
In-frameENST00000435345ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
5CDS-intronENST00000435345ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000488965ENST00000332149SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000488965ENST00000398585SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-3CDSENST00000488965ENST00000458356SCP2chr1

53504718

+TMPRSS2chr21

42861520

-
intron-intronENST00000488965ENST00000497881SCP2chr1

53504718

+TMPRSS2chr21

42861520

-

Top

FusionProtFeatures for SCP2_TMPRSS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SCP2

P22307

TMPRSS2

O15393

Serine protease that proteolytically cleaves andactivates the viral spike glycoproteins which facilitate virus-cell membrane fusions; spike proteins are synthesized andmaintained in precursor intermediate folding states andproteolysis permits the refolding and energy release required tocreate stable virus-cell linkages and membrane coalescence.Facilitates human SARS coronavirus (SARS-CoV) infection via twoindependent mechanisms, proteolytic cleavage of ACE2, which mightpromote viral uptake, and cleavage of coronavirus spikeglycoprotein which activates the glycoprotein for cathepsin L-independent host cell entry. Proteolytically cleaves and activatesthe spike glycoproteins of human coronavirus 229E (HCoV-229E) andhuman coronavirus EMC (HCoV-EMC) and the fusion glycoproteins F0of Sendai virus (SeV), human metapneumovirus (HMPV), humanparainfluenza 1, 2, 3, 4a and 4b viruses (HPIV). Essential forspread and pathogenesis of influenza A virus (strains H1N1, H3N2and H7N9); involved in proteolytic cleavage and activation ofhemagglutinin (HA) protein which is essential for viralinfectivity. {ECO:0000269|PubMed:21068237,ECO:0000269|PubMed:21325420, ECO:0000269|PubMed:23536651,ECO:0000269|PubMed:23966399, ECO:0000269|PubMed:24027332,ECO:0000269|PubMed:24227843}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-214112_14979493DomainLDL-receptor class A
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-214150_24279493DomainSRCR
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-214256_48979493DomainPeptidase S1
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-214150_242116530DomainSRCR
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-214256_489116530DomainPeptidase S1
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-214112_14979493DomainLDL-receptor class A
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-214150_24279493DomainSRCR
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-214256_48979493DomainPeptidase S1
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-214106_49279493Topological domainExtracellular
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-214106_49279493Topological domainExtracellular
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-21485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-21485_10579493TransmembraneHelical%3B Signal-anchor for type II membrane protein

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSCP2chr1:53504718chr21:42861520ENST00000371509+1315433_543445504DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000371513+111433_543-27323DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000371514+1416433_543489548DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000407246+1315433_543465524DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000408941+14433_543-28361DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000430330+35433_54382141DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000435345+35433_54385144DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000488965+13433_543-1660DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000528311+1315433_543408467DomainNote=SCP2
HgeneSCP2chr1:53504718chr21:42861520ENST00000371509+1315545_547445504MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000371513+111545_547-27323MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000371514+1416545_547489548MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000407246+1315545_547465524MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000408941+14545_547-28361MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000430330+35545_54782141MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000435345+35545_54785144MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000488965+13545_547-1660MotifMicrobody targeting signal
HgeneSCP2chr1:53504718chr21:42861520ENST00000528311+1315545_547408467MotifMicrobody targeting signal
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-214112_149116530DomainLDL-receptor class A
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000332149-2141_8479493Topological domainCytoplasmic
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-214106_492116530Topological domainExtracellular
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-2141_84116530Topological domainCytoplasmic
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000458356-2141_8479493Topological domainCytoplasmic
TgeneTMPRSS2chr1:53504718chr21:42861520ENST00000398585-21485_105116530TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for SCP2_TMPRSS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_903aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGDSTCGQRAITHSLGMTGIPIINV
NNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEH
FAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEK
SIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQ
FVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPS
NWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVD
ITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTA
FAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAA
KVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWITRQMRA

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_903aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGDSTCGQRAITHSLGMTGIPIINV
NNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEH
FAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEK
SIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQ
FVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPS
NWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVD
ITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTA
FAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAA
KVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWITRQMRA

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_903aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGDSTCGQRAITHSLGMTGIPIINV
NNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEH
FAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEK
SIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGAT
GLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQ
FVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPS
NWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVD
ITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTA
FAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAA
KVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWITRQMRA

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_822aa
MTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHM
EKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMT
DLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLI
SKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIE
KKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECD
SSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMK
LNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKP
LNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKG
KTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFT

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_822aa
MTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHM
EKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMT
DLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLI
SKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIE
KKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECD
SSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMK
LNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKP
LNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKG
KTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFT

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_822aa
MTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHM
EKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMT
DLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLI
SKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIE
KKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECD
SSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMK
LNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKP
LNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKG
KTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFT

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_859aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGVAECVLALGFEKMSKGSLGIKFS
DRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQC
CPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELL
TTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYK
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_859aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGVAECVLALGFEKMSKGSLGIKFS
DRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQC
CPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELL
TTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYK
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_859aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPTSAVDQACVGTVFGVAECVLALGFEKMSKGSLGIKFS
DRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEYSLDEVMASKEVFDFLTILQC
CPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGLTPNDIDVIELHDCFSTNELL
TTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYK
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_879aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGDSTCGQRAITHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAE
CVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEY
SLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGL
TPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGA
KVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATW
VVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGP
NFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIAC
GVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISH
PNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAM

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_879aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGDSTCGQRAITHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAE
CVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEY
SLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGL
TPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGA
KVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATW
VVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGP
NFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIAC
GVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISH
PNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAM

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_879aa
MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGDSTCGQRAITHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAE
CVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKTGLSAHPVAPQMFGTAGKEHMEKTGTKIEHFAKIGWKNHKHSVNNPTSQFQDEY
SLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFVQKTGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCTEKSGL
TPNDIDVIELHDCFSTNELLTTEALGLCPEGQGATLVDRGDNTTGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGA
KVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATW
VVDVKNGKGSVLPNSETKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGP
NFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIAC
GVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISH
PNTDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAM

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_496aa
MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCI
TLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWN
ENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAW
PWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTF
NDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVT

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_496aa
MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCI
TLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWN
ENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAW
PWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTF
NDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVT

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_496aa
MGFPEAARTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKALCI
TLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWN
ENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAW
PWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKPLTF
NDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGPLVT

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_499aa
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_499aa
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_499aa
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSETKKA
LCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQD
DWNENYGRAACRDMGTKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDITKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALP
GAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFTGAGYQVEKVISHPNTDSKTKNNDIALMKLQKP
LTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRTVTDNLITPAMICAGFLQGNVDSCQGDSGGP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_2709nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTC
AACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGG
TTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAG
TATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACAC
TTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATG
GCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCA
TTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAA
AGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGAC
GTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTG
GTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACA
GGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCAT
AATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAA
GCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAG
TTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAAT
GGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTG
GCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCT
AACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTG
TACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTAT
AAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGAT
ATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCA
AGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTG
TGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCA
TTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAG
ACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGC
ATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCC
AAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTG
CAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGC
TGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCA

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_2709nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTC
AACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGG
TTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAG
TATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACAC
TTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATG
GCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCA
TTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAA
AGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGAC
GTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTG
GTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACA
GGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCAT
AATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAA
GCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAG
TTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAAT
GGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTG
GCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCT
AACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTG
TACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTAT
AAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGAT
ATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCA
AGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTG
TGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCA
TTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAG
ACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGC
ATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCC
AAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTG
CAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGC
TGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCA

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2709nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTC
AACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGG
TTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAG
TATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACAC
TTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATG
GCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCA
TTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAA
AGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGAC
GTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTG
GTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACA
GGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCAT
AATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAA
GCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAG
TTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAAT
GGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTG
GCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCT
AACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTG
TACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTAT
AAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGAT
ATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCA
AGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTG
TGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCA
TTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAG
ACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGC
ATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCC
AAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTG
CAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGC
TGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCA

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_2466nt
ATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGT
GTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGAT
AAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATG
GAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAA
GATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCT
GCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACT
GATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAA
TCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTC
TGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATT
TCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTT
CCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCC
AGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAG
AAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAG
GCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTG
GGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGAC
TCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTC
TACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGG
CGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAA
CTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGT
ATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTC
AGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCT
CTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTG
ATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTG
AAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGG
AAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACA
CCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAAT
ATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACG

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_2466nt
ATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGT
GTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGAT
AAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATG
GAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAA
GATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCT
GCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACT
GATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAA
TCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTC
TGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATT
TCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTT
CCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCC
AGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAG
AAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAG
GCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTG
GGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGAC
TCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTC
TACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGG
CGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAA
CTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGT
ATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTC
AGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCT
CTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTG
ATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTG
AAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGG
AAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACA
CCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAAT
ATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACG

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2466nt
ATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGT
GTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGAT
AAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATG
GAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAA
GATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCT
GCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACT
GATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAA
TCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTC
TGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATT
TCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTT
CCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCC
AGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAG
AAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAG
GCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTG
GGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGAC
TCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTC
TACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGG
CGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAA
CTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGT
ATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTC
AGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCT
CTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTG
ATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTG
AAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGG
AAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACA
CCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAAT
ATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACG

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_2577nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCA
GATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGG
TATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAAT
AACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGT
TGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATT
TTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCT
GCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTT
ACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATA
AATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGG
GAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAG
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_2577nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCA
GATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGG
TATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAAT
AACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGT
TGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATT
TTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCT
GCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTT
ACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATA
AATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGG
GAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAG
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2577nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCA
TGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCA
GATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGG
TATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAAT
AACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGT
TGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATT
TTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCT
GCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTT
ACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATA
AATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGG
GAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAG
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_2637nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGA
ATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAA
TGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTT
GACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATAT
GGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATAC
AGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCA
ATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCA
AGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTG
ACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAA
GGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGA
CACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCA
AAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTT
AGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTT
GAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGG
GTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTC
CTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGT
ACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCA
AACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCC
TGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACA
AGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGC
GGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCAC
GTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAAT
CCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCAT
CCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTG
TGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCA
GAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATG
ATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGG
CTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATT

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_2637nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGA
ATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAA
TGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTT
GACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATAT
GGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATAC
AGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCA
ATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCA
AGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTG
ACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAA
GGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGA
CACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCA
AAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTT
AGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTT
GAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGG
GTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTC
CTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGT
ACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCA
AACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCC
TGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACA
AGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGC
GGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCAC
GTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAAT
CCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCAT
CCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTG
TGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCA
GAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATG
ATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGG
CTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATT

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2637nt
ATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAG
AATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGA
ATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAA
TGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTT
GACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATAT
GGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATAC
AGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCA
ATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCA
AGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTG
ACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAA
GGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGA
CACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCA
AAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTT
AGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTT
GAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGG
GTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTC
CTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGT
ACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCA
AACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCC
TGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACA
AGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGC
GGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCAC
GTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAAT
CCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCAT
CCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTG
TGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCA
GAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATG
ATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGG
CTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATT

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_1488nt
ATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_1488nt
ATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_1488nt
ATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_1497nt
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_1497nt
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_1497nt
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAAT
CTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAA
GATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCA
CTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCC
AACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGAC
GAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGAC
GACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGC
GGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAA
GCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCG
GGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCC
GCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCC
GGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCT
CTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGG
GGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATAT
GTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCT
CTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_4468nt
GCGCCCCACCCCGCCCCCTCCTCCTGCCCCTACGCACGCGCACTCTCACGCGCCTGTGTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAG
GGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCCCGGTCCCGCACTGGTGCAGCCATGTCCTCTTCC
CCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAGAATTCAAGAGAC
TACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTAT
GTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGT
GCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATG
AGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCT
GCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATT
GGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAA
GTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAG
TATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAA
ATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTT
CACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGA
GATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAG
TGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATT
GGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACC
AGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAA
ATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCA
GTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTA
CTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGAT
GGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAG
AGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTT
TACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAA
CTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGC
AGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCC
ATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATT
TTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAAT
GACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAG
CCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTC
ATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTC
GATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGC
TGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCC
ACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCA
GAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAG
CCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCT
GCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGA
GATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTA
CCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGG
TGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAG
CAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCC
TCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGG
CCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTT
TCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCA
TCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAA
GCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACC
AGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTG
CAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATG
CCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGT
AATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAG

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_4466nt
GCGCCCCACCCCGCCCCCTCCTCCTGCCCCTACGCACGCGCACTCTCACGCGCCTGTGTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAG
GGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCCCGGTCCCGCACTGGTGCAGCCATGTCCTCTTCC
CCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAGAATTCAAGAGAC
TACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTAT
GTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGT
GCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATG
AGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCT
GCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATT
GGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAA
GTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAG
TATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAA
ATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTT
CACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGA
GATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAG
TGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATT
GGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACC
AGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAA
ATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCA
GTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTA
CTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGAT
GGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAG
AGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTT
TACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAA
CTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGC
AGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCC
ATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATT
TTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAAT
GACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAG
CCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTC
ATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTC
GATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGC
TGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCC
ACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCA
GAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAG
CCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCT
GCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGA
GATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTA
CCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGG
TGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAG
CAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCC
TCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGG
CCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTT
TCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCA
TCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAA
GCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACC
AGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTG
CAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATG
CCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGT
AATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAG

>In-frame_SCP2_ENST00000371514_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_3010nt
GCGCCCCACCCCGCCCCCTCCTCCTGCCCCTACGCACGCGCACTCTCACGCGCCTGTGTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAG
GGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCCCGGTCCCGCACTGGTGCAGCCATGTCCTCTTCC
CCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAGTTTGTGAAGCCTGGAGCTGAGAATTCAAGAGAC
TACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTAT
GTTTTTGGTGACTCTACCTGTGGGCAGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGT
GCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATG
AGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCT
GCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATT
GGATGGAAAAATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAA
GTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAG
TATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAA
ATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTT
CACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGA
GATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAG
TGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATT
GGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACC
AGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAA
ATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCA
GTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTA
CTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGAT
GGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAG
AGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTT
TACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAA
CTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGC
AGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCC
ATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATT
TTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAAT
GACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAG
CCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTC
ATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTC
GATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGC
TGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCC
ACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCA

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_4353nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
GCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGC
AGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTA
TGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAAT
TTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGT
TTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAG
TTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTAC
AATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGG
AAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAG
AAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAAC
TCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGG
TCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGA
GAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCT
ACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGG
CAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGG
TGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGA
AAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGT
GCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGG
AGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCC
AAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATG
ACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTT
CAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGC
TCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGA
CAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATG
GAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGA
AGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCG
GGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCA
GATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAG
GGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAG
TGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGT
TTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACA
GTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCG
CAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAG
TCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAG
GGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGA
TGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAG
GGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAG
CACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCC
TAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGG
AAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTC
CTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCC
TATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAA
GAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGC
CAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACA
GCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAG
GGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTT
ATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATG

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_4351nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
GCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGC
AGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTA
TGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAAT
TTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGT
TTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAG
TTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTAC
AATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGG
AAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAG
AAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAAC
TCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGG
TCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGA
GAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCT
ACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGG
CAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGG
TGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGA
AAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGT
GCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGG
AGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCC
AAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATG
ACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTT
CAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGC
TCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGA
CAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATG
GAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGA
AGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCG
GGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCA
GATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAG
GGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAG
TGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGT
TTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACA
GTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCG
CAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAG
TCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAG
GGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGA
TGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAG
GGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAG
CACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCC
TAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGG
AAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTC
CTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCC
TATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAA
GAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGC
CAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACA
GCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAG
GGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTT
ATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATG

>In-frame_SCP2_ENST00000528311_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2895nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
GCAAGAAGGCTTTAGCTGATGCACAGATCCCTTATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGACTCTACCTGTGGGC
AGAGGGCTATCTATCACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTA
TGGCCCGCCAGCTGATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAAT
TTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGT
TTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAG
TTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTAC
AATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGG
AAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAG
AAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAAC
TCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGG
TCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGA
GAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCT
ACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGG
CAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGG
TGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGA
AAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGT
GCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGG
AGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCC
AAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATG
ACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTT
CAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGC
TCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGA
CAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATG
GAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGA
AGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCG
GGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCA
GATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAG
GGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAG
TGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGT
TTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACA

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_4279nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCT
TATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGA
AGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCA
GTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAA
AATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGAT
TTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTG
CAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGC
TTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGC
TTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACA
TATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAA
CTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCT
GTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCA
AGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGT
ATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCT
AACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAG
TTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCA
CACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCC
TGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGC
CAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCAC
AGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTG
GGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACC
CCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAA
TCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCG
CTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAG
CTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACA
CAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGC
CAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAA
GCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCT
TCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACT
TCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTC
CCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTG
AGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAA
GGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCAC
AAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGT
GGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAA
AGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCC
TCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAG
GCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACAT
TGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCA
AGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGC
CCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGG
GTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGA
AATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAG
AGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAA
AACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGT

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_4277nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCT
TATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGA
AGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCA
GTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAA
AATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGAT
TTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTG
CAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGC
TTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGC
TTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACA
TATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAA
CTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCT
GTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCA
AGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGT
ATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCT
AACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAG
TTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCA
CACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCC
TGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGC
CAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCAC
AGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTG
GGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACC
CCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAA
TCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCG
CTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAG
CTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACA
CAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGC
CAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAA
GCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCT
TCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACT
TCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTC
CCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTG
AGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAA
GGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCAC
AAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGT
GGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAA
AGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCC
TCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAG
GCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACAT
TGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCA
AGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGC
CCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGG
GTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGA
AATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAG
AGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAA
AACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGT

>In-frame_SCP2_ENST00000371509_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2821nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGCAAGAAGGCTTTAGCTGATGCACAGATCCCT
TATTCAGCAGTGGACCAGGCATGTGTTGGCTATGTTTTTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGA
AGCCTTGGAATAAAATTTTCAGATAGAACCATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCA
GTTGCTCCTCAGATGTTTGGGTATGCTGGAAAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAA
AATCATAAACATTCAGTTAATAACCCGTATTCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGAT
TTTTTGACTATCTTACAATGTTGTCCCACTTCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTG
CAATCCAAAGCTGTGGAAATTTTGGCACAAGAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGC
TTTGATATGAGTAAAGAAGCTGCAAGAAAATGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGC
TTTTCTACCAACGAACTCCTTACTTATGAAGCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACA
TATGGAGGAAAGTGGGTCATAAATCCTAGTGGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAA
CTCTGCTGGCAGCTGAGAGGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCT
GTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCA
AGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGT
ATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCT
AACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAG
TTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCA
CACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCC
TGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGC
CAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCAC
AGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTG
GGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACC
CCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAA
TCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCG
CTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAG
CTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACA
CAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGC
CAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAA
GCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCT
TCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACT

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_4339nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTAT
CACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTG
ATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACC
ATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGA
AAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTAT
TCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACT
TCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAA
GAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAA
TGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAA
GCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGT
GGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGA
AAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTT
CCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG
ATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACA
ATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGG
CTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGC
CGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGC
CAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGT
GGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGC
CTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACAT
TTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAG
GTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGA
GTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCAT
GGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCT
TTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTT
TGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGT
GTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACC
ATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACC
TTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACA
GTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTA
TTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTATGC

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_4337nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTAT
CACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTG
ATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACC
ATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGA
AAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTAT
TCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACT
TCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAA
GAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAA
TGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAA
GCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGT
GGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGA
AAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTT
CCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG
ATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACA
ATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGG
CTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGC
CGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGC
CAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGT
GGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGC
CTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACAT
TTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAG
GTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGA
GTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCAT
GGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCT
TTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTT
TGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGT
GTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACC
ATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACC
TTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACA
GTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTA
TTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTATGC

>In-frame_SCP2_ENST00000407246_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_2881nt
GTTGCCGCCCGCGGCCCTGGCTTCGGGCTTCAGGGAGCTCTGGTGCAGTCTCCGCCTGTCAGTGCCGGCAGTCGTCCGCGGCGCCCGCCC
CGGTCCCGCACTGGTGCAGCCATGTCCTCTTCCCCGTGGGAGCCTGCGACCCTGCGCCGGGTGTTCGTGGTGGGGGTTGGCATGACCAAG
TTTGTGAAGCCTGGAGCTGAGAATTCAAGAGACTACCCTGACTTGGCAGAAGAAGCAGGTGACTCTACCTGTGGGCAGAGGGCTATCTAT
CACAGTTTGGGAATGACTGGAATTCCTATAATCAATGTCAACAATAACTGTGCTACTGGTTCTACTGCTTTGTTTATGGCCCGCCAGCTG
ATTCAGGGTGGTGTGGCAGAATGTGTCTTGGCTCTTGGGTTTGAGAAGATGAGTAAGGGAAGCCTTGGAATAAAATTTTCAGATAGAACC
ATTCCCACTGATAAGCATGTTGACCTCCTGATCAATAAGTATGGATTGTCTGCTCACCCAGTTGCTCCTCAGATGTTTGGGTATGCTGGA
AAAGAACATATGGAAAAATATGGAACAAAAATTGAACACTTTGCAAAAATTGGATGGAAAAATCATAAACATTCAGTTAATAACCCGTAT
TCCCAGTTCCAAGATGAATACAGTTTAGATGAAGTGATGGCATCTAAAGAAGTTTTTGATTTTTTGACTATCTTACAATGTTGTCCCACT
TCAGATGGTGCTGCAGCAGCAATTTTGGCCAGTGAAGCATTTGTACAGAAGTATGGCCTGCAATCCAAAGCTGTGGAAATTTTGGCACAA
GAAATGATGACTGATTTGCCAAGCTCGTTTGAAGAAAAAAGCATTATTAAAATGGTTGGCTTTGATATGAGTAAAGAAGCTGCAAGAAAA
TGCTATGAGAAATCTGGCCTGACACCAAATGATATTGACGTAATAGAACTTCACGATTGCTTTTCTACCAACGAACTCCTTACTTATGAA
GCACTGGGACTCTGTCCAGAAGGACAAGGTGCAACGCTGGTTGATAGAGGAGATAATACATATGGAGGAAAGTGGGTCATAAATCCTAGT
GGTGGACTGATTTCAAAGGGACACCCACTAGGCGCTACAGGTCTTGCTCAGTGTGCAGAACTCTGCTGGCAGCTGAGAGGGGAAGCCGGA
AAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTT
CCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTT
AAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCT
GGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATC
ACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGG
ATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGG
TGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAAC
GAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACC
AGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTT
TCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGG
CCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGC
GTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAA
GTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTC
AACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACC
GAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGAC
AACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACT
TCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTG
ATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACA
ATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGG

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_3172nt
GGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTAC
AAGATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTT
TTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGC
CCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGC
ATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCT
GGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAAT
CGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGG
AACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCC
ACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTG
GTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCC
TGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCAC
TGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATAC
CAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACT
TTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCC
ACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTAT
GACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTC
ACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAAT
GTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAA
ACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTC
TGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGAT
GGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGG
GGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCA
GGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAG
AGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAA
CATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTG
CAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGG
AGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTC
CATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTA
GCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTG
CTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGA
TGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATA
ACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTA
ACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAA
ACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTC
TTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTA

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_3170nt
GGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTAC
AAGATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTT
TTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGC
CCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGC
ATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCT
GGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAAT
CGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGG
AACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCC
ACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTG
GTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCC
TGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCAC
TGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATAC
CAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACT
TTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCC
ACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTAT
GACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTC
ACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAAT
GTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAA
ACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTC
TGGCTTTGGCACTCTCTGCCATTCTGTGCAGGCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGAT
GGCCGGCTGGTTGTGGGCACTGGCGGTCAAGTGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGG
GGCCAATTTTGGATGAGCATGGAGCTGTCACCTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCA
GGTGGCACCTGCAGCGGCTGCCCTCTGGGGCCACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAG
AGCCTTAGCAGCCCTGGATGGTGGCCAGAAATAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAA
CATTTTTGTTCTTATGGGGTGAGAATATAGACAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTG
CAGGTCTCCACCTGCACATTGGGTGGGGCTCCTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGG
AGAGTGCACATGCCCCTTGGTCCTGGCAGGGCGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTC
CATGGGGGAAATCAAGGATGCTCAGTTTAAGGTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTA
GCTTTTGATGTCTCCAAGTAGTCCACCTTCATTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTG
CTTTGACAAAATGACTGGCTCCTGACTTAACGTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGA
TGTGTTTTGTTTTGGACTCTCTGTGGTCCCTTCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATA
ACCATGAGCACTACTCTACCATGGTTCTGCCTCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTA
ACCTTGAAATGGAAAGTCATGCAATCCCATTTGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAA
ACAGTTGGCACTGTAAGGTGCTTGCTCCCCAAGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTC
TTATTTATGTGAACAACTGTTTGTCTTTTTTTGTATCTTTTTTAAACTGTAAAGTTCAATTGTGAAAATGAATATCATGCAAATAAATTA

>In-frame_SCP2_ENST00000430330_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_1714nt
GGGGAAGCCGGAAAGAGGCAAGTTCCTGGTGCAAAGGTGGCTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTAC
AAGATGGGTTTTCCGGAAGCCGCCAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTT
TTTAAGGAGATTGAGAAGAAACTTGAAGAGGAAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGC
CCTGGGGGTAAAGAGGCCACCTGGGTGGTGGATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGC
ATCACCTTGACCCTGGGGACCTTCCTCGTGGGAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCT
GGGATAGAGTGCGACTCCTCAGGTACCTGCATCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAAT
CGGTGTGTTCGCCTCTACGGACCAAACTTCATCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGG
AACGAGAACTACGGGCGGGCGGCCTGCAGGGACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCC
ACCAGCTTTATGAAACTGAACACAAGTGCCGGCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTG
GTTTCTTTACGCTGTATAGCCTGCGGGGTCAACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCC
TGGCCCTGGCAGGTCAGCCTGCACGTCCAGAACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCAC
TGCGTGGAAAAACCTCTTAACAATCCATGGCATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATAC
CAAGTAGAAAAAGTGATTTCTCATCCAAATTATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACT
TTCAACGACCTAGTGAAACCAGTGTGTCTGCCCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCC
ACCGAGGAGAAAGGGAAGACCTCAGAAGTGCTGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTAT
GACAACCTGATCACACCAGCCATGATCTGTGCCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTC
ACTTCGAAGAACAATATCTGGTGGCTGATAGGGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAAT
GTGATGGTATTCACGGACTGGATTTATCGACAAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAA
ACAATGGGGCTGGTTTTGCTTCCCCGTGCATGATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTC

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000332149_chr21_42861520_-_3141nt
CTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTC
ATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGG
AAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGG
ATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGG
GAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCA
TCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCA
TCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGG
ACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCG
GCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCA
ACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGA
ACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGC
ATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATT
ATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGC
CCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGC
TGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTG
CCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAG
GGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGAC
AAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCAT
GATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAG
GCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAG
TGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCAC
CTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGC
CACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAA
TAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGA
CAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTC
CTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGG
CGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAG
GTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCA
TTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAAC
GTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCT
TCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCC
TCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATT
TGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCA
AGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTT

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000398585_chr21_42861520_-_3139nt
CTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTC
ATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGG
AAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGG
ATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGG
GAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCA
TCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCA
TCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGG
ACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCG
GCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCA
ACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGA
ACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGC
ATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATT
ATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGC
CCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGC
TGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTG
CCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAG
GGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGAC
AAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCAT
GATTTACTCTTAGAGATGATTCAGAGGTCACTTCATTTTTATTAAACAGTGAACTTGTCTGGCTTTGGCACTCTCTGCCATTCTGTGCAG
GCTGCAGTGGCTCCCCTGCCCAGCCTGCTCTCCCTAACCCCTTGTCCGCAAGGGGTGATGGCCGGCTGGTTGTGGGCACTGGCGGTCAAG
TGTGGAGGAGAGGGGTGGAGGCTGCCCCATTGAGATCTTCCTGCTGAGTCCTTTCCAGGGGCCAATTTTGGATGAGCATGGAGCTGTCAC
CTCTCAGCTGCTGGATGACTTGAGATGAAAAAGGAGAGACATGGAAAGGGAGACAGCCAGGTGGCACCTGCAGCGGCTGCCCTCTGGGGC
CACTTGGTAGTGTCCCCAGCCTACCTCTCCACAAGGGGATTTTGCTGATGGGTTCTTAGAGCCTTAGCAGCCCTGGATGGTGGCCAGAAA
TAAAGGGACCAGCCCTTCATGGGTGGTGACGTGGTAGTCACTTGTAAGGGGAACAGAAACATTTTTGTTCTTATGGGGTGAGAATATAGA
CAGTGCCCTTGGTGCGAGGGAAGCAATTGAAAAGGAACTTGCCCTGAGCACTCCTGGTGCAGGTCTCCACCTGCACATTGGGTGGGGCTC
CTGGGAGGGAGACTCAGCCTTCCTCCTCATCCTCCCTGACCCTGCTCCTAGCACCCTGGAGAGTGCACATGCCCCTTGGTCCTGGCAGGG
CGCCAAGTCTGGCACCATGTTGGCCTCTTCAGGCCTGCTAGTCACTGGAAATTGAGGTCCATGGGGGAAATCAAGGATGCTCAGTTTAAG
GTACACTGTTTCCATGTTATGTTTCTACACATTGCTACCTCAGTGCTCCTGGAAACTTAGCTTTTGATGTCTCCAAGTAGTCCACCTTCA
TTTAACTCTTTGAAACTGTATCATCTTTGCCAAGTAAGAGTGGTGGCCTATTTCAGCTGCTTTGACAAAATGACTGGCTCCTGACTTAAC
GTTCTATAAATGAATGTGCTGAAGCAAAGTGCCCATGGTGGCGGCGAAGAAGAGAAAGATGTGTTTTGTTTTGGACTCTCTGTGGTCCCT
TCCAATGCTGTGGGTTTCCAACCAGGGGAAGGGTCCCTTTTGCATTGCCAAGTGCCATAACCATGAGCACTACTCTACCATGGTTCTGCC
TCCTGGCCAAGCAGGCTGGTTTGCAAGAATGAAATGAATGATTCTACAGCTAGGACTTAACCTTGAAATGGAAAGTCATGCAATCCCATT
TGCAGGATCTGTCTGTGCACATGCCTCTGTAGAGAGCAGCATTCCCAGGGACCTTGGAAACAGTTGGCACTGTAAGGTGCTTGCTCCCCA
AGACACATCCTAAAAGGTGTTGTAATGGTGAAAACGTCTTCCTTCTTTATTGCCCCTTCTTATTTATGTGAACAACTGTTTGTCTTTTTT

>In-frame_SCP2_ENST00000435345_chr1_53504718_+_TMPRSS2_ENST00000458356_chr21_42861520_-_1683nt
CTCTGCAGCATAATTTAGGCATTGGAGGAGCTGTGGTTGTAACACTCTACAAGATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTC
ATCAAATTGAAGCTGTTCCAACCAGCTCTGCAAGTGATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGG
AAGGGGAACAGTTTGTGAAGAAAATCGGTGGTATTTTTGCCTTCAAGGTGAAAGATGGCCCTGGGGGTAAAGAGGCCACCTGGGTGGTGG
ATGTGAAGAATGGCAAAGGATCAGTGCTTCCTAACTCAGAGACTAAGAAAGCACTGTGCATCACCTTGACCCTGGGGACCTTCCTCGTGG
GAGCTGCGCTGGCCGCTGGCCTACTCTGGAAGTTCATGGGCAGCAAGTGCTCCAACTCTGGGATAGAGTGCGACTCCTCAGGTACCTGCA
TCAACCCCTCTAACTGGTGTGATGGCGTGTCACACTGCCCCGGCGGGGAGGACGAGAATCGGTGTGTTCGCCTCTACGGACCAAACTTCA
TCCTTCAGGTGTACTCATCTCAGAGGAAGTCCTGGCACCCTGTGTGCCAAGACGACTGGAACGAGAACTACGGGCGGGCGGCCTGCAGGG
ACATGGGCTATAAGAATAATTTTTACTCTAGCCAAGGAATAGTGGATGACAGCGGATCCACCAGCTTTATGAAACTGAACACAAGTGCCG
GCAATGTCGATATCTATAAAAAACTGTACCACAGTGATGCCTGTTCTTCAAAAGCAGTGGTTTCTTTACGCTGTATAGCCTGCGGGGTCA
ACTTGAACTCAAGCCGCCAGAGCAGGATTGTGGGCGGCGAGAGCGCGCTCCCGGGGGCCTGGCCCTGGCAGGTCAGCCTGCACGTCCAGA
ACGTCCACGTGTGCGGAGGCTCCATCATCACCCCCGAGTGGATCGTGACAGCCGCCCACTGCGTGGAAAAACCTCTTAACAATCCATGGC
ATTGGACGGCATTTGCGGGGATTTTGAGACAATCTTTCATGTTCTATGGAGCCGGATACCAAGTAGAAAAAGTGATTTCTCATCCAAATT
ATGACTCCAAGACCAAGAACAATGACATTGCGCTGATGAAGCTGCAGAAGCCTCTGACTTTCAACGACCTAGTGAAACCAGTGTGTCTGC
CCAACCCAGGCATGATGCTGCAGCCAGAACAGCTCTGCTGGATTTCCGGGTGGGGGGCCACCGAGGAGAAAGGGAAGACCTCAGAAGTGC
TGAACGCTGCCAAGGTGCTTCTCATTGAGACACAGAGATGCAACAGCAGATATGTCTATGACAACCTGATCACACCAGCCATGATCTGTG
CCGGCTTCCTGCAGGGGAACGTCGATTCTTGCCAGGGTGACAGTGGAGGGCCTCTGGTCACTTCGAAGAACAATATCTGGTGGCTGATAG
GGGATACAAGCTGGGGTTCTGGCTGTGCCAAAGCTTACAGACCAGGAGTGTACGGGAATGTGATGGTATTCACGGACTGGATTTATCGAC
AAATGAGGGCAGACGGCTAATCCACATGGTCTTCGTCCTTGACGTCGTTTTACAAGAAAACAATGGGGCTGGTTTTGCTTCCCCGTGCAT


Top

FusionGenePPI for SCP2_TMPRSS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SCP2CAV1, PITPNA, CACNA1A, ELAVL1, HSD17B4, MRPS28, TIMM44, RAB8A, ACAA1, UBL4A, RRBP1, STX7, VDAC2, RBMS1, VDAC3, TBL2, SCO2, SUGP1, ECI2, RAB31, NDUFA7, IDH3G, SRRM2, AGPS, SEPT9, MRRF, MPLKIP, PEX5, TRIP13, MYO5A, MYO5C, POLR1A, URI1, PDRG1, UXT, HMGCS1, MED20, CREB3, PDHA1TMPRSS2CLK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SCP2_TMPRSS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SCP2_TMPRSS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneSCP2C0013421Dystonia1CTD_human
HgeneSCP2C0152025Polyneuropathy1CTD_human
HgeneSCP2C0270612Leukoencephalopathies1CTD_human;HPO
TgeneTMPRSS2C0033578Prostatic Neoplasms2CTD_human