FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3287

FusionGeneSummary for ATP13A3_IQCG

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP13A3_IQCG
Fusion gene ID: 3287
HgeneTgene
Gene symbol

ATP13A3

IQCG

Gene ID

79572

84223

Gene nameATPase 13A3IQ motif containing G
SynonymsAFURS1CFAP122|DRC9
Cytomap

3q29

3q29

Type of geneprotein-codingprotein-coding
Descriptionprobable cation-transporting ATPase 13A3ATPase family homolog up-regulated in senescence cells 1ATPase type 13A3dynein regulatory complex protein 9IQ domain-containing protein Gdynein regulatory complex subunit 9
Modification date2018052320180519
UniProtAcc

Q9H7F0

Q9H095

Ensembl transtripts involved in fusion geneENST00000439040, ENST00000256031, 
ENST00000265239, ENST00000455191, 
ENST00000453254, ENST00000480302, 
Fusion gene scores* DoF score5 X 7 X 4=1408 X 8 X 3=192
# samples 89
** MAII scorelog2(8/140*10)=-0.807354922057604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/192*10)=-1.09310940439148
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ATP13A3 [Title/Abstract] AND IQCG [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-24-2023-01AATP13A3chr3

194170874

-IQCGchr3

197619630

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000439040ENST00000265239ATP13A3chr3

194170874

-IQCGchr3

197619630

-
Frame-shitENST00000439040ENST00000455191ATP13A3chr3

194170874

-IQCGchr3

197619630

-
5CDS-intronENST00000439040ENST00000453254ATP13A3chr3

194170874

-IQCGchr3

197619630

-
5CDS-intronENST00000439040ENST00000480302ATP13A3chr3

194170874

-IQCGchr3

197619630

-
In-frameENST00000256031ENST00000265239ATP13A3chr3

194170874

-IQCGchr3

197619630

-
In-frameENST00000256031ENST00000455191ATP13A3chr3

194170874

-IQCGchr3

197619630

-
5CDS-intronENST00000256031ENST00000453254ATP13A3chr3

194170874

-IQCGchr3

197619630

-
5CDS-intronENST00000256031ENST00000480302ATP13A3chr3

194170874

-IQCGchr3

197619630

-

Top

FusionProtFeatures for ATP13A3_IQCG


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP13A3

Q9H7F0

IQCG

Q9H095

Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility whichmaintains the alignment and integrity of the distal axoneme andregulates microtubule sliding in motile axonemes. Binds calmodulinwhen cellular Ca(2+) levels are low and thereby contributes to theregulation of calcium and calmodulin-dependent protein kinase IV(CAMK4) activity; contributes to the regulation of CAMK4 signalingcascades. Required for normal axoneme assembly in sperm flagella,normal sperm tail formation and for male fertility.{ECO:0000250|UniProtKB:A3KQH2, ECO:0000250|UniProtKB:A8HQ54,ECO:0000250|UniProtKB:Q80W32}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ATP13A3_IQCG


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000265239_chr3_197619630_-_446aa
MDREERKTINQGQEDEMEITGYNLSRWKLAIVSLGVICSGGFLLLLLTWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLS
LETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKTSQTESQQIRTFTHHSVKTFWNDTIHNFDFLKGLDEGVSCTSITEKHSAGLT
KGMHAYRKLLTGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYTYTALAIVVMSIVSIVSSLTSIRKQTVMLHDMVATHSTV
RVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTET_GEAGVLDGEIR_GHRNETE_TKCSQSHKGQ_LST

>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000455191_chr3_197619630_-_446aa
MDREERKTINQGQEDEMEITGYNLSRWKLAIVSLGVICSGGFLLLLLTWMPEWRVKATCVRAAIKDCEVVLLRTTDEFKMWFCAKIRVLS
LETYPVSSPKSMSNKLSNGHAVCLIENPTEENRHRISKTSQTESQQIRTFTHHSVKTFWNDTIHNFDFLKGLDEGVSCTSITEKHSAGLT
KGMHAYRKLLTGVNEIAVKVPSVFKLLIKEVLNPFYIFQLFSVILWSTDEYTYTALAIVVMSIVSIVSSLTSIRKQTVMLHDMVATHSTV
RVSVCRVNEEIEEIFSTDLVPGDVMVIPLNGTIMPCDAVLINGTCIVNESMLTET_GEAGVLDGEIR_GHRNETE_TKCSQSHKGQ_LST


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000265239_chr3_197619630_-_1339nt
ATGGACAGGGAAGAAAGGAAGACCATCAATCAGGGTCAAGAAGATGAAATGGAGATTTATGGTTACAATTTGAGTCGCTGGAAGCTTGCC
ATAGTTTCTTTAGGAGTGATTTGCTCTGGTGGGTTTCTCCTCCTCCTCCTCTATTGGATGCCTGAGTGGCGGGTGAAAGCGACCTGTGTC
AGAGCTGCAATTAAAGACTGTGAAGTAGTGCTGCTGAGGACTACTGATGAATTCAAAATGTGGTTTTGTGCAAAAATTCGCGTTCTTTCT
TTGGAAACTTACCCAGTTTCAAGTCCAAAATCTATGTCTAATAAGCTTTCAAATGGCCATGCAGTTTGTTTAATTGAGAATCCCACTGAA
GAAAATAGGCACAGGATCAGTAAATATTCACAGACTGAATCACAACAGATTCGTTATTTCACCCACCATAGTGTAAAATATTTCTGGAAT
GATACCATTCACAATTTTGATTTCTTAAAGGGACTGGATGAAGGTGTTTCTTGTACGTCAATTTATGAAAAGCATAGTGCAGGACTGACA
AAGGGGATGCATGCCTACAGAAAACTGCTTTATGGAGTAAATGAAATTGCTGTAAAAGTGCCTTCTGTTTTTAAGCTTCTAATTAAAGAG
GTTCTCAACCCATTTTACATTTTCCAGCTGTTCAGTGTTATACTGTGGAGCACTGATGAATACTATTACTATGCTCTAGCTATTGTGGTT
ATGTCCATAGTATCAATCGTAAGCTCACTATATTCCATTAGAAAGCAATATGTTATGTTGCATGACATGGTGGCAACTCATAGTACCGTA
AGAGTTTCAGTTTGTAGAGTAAATGAAGAAATAGAAGAAATCTTTTCTACCGACCTTGTGCCAGGAGATGTCATGGTCATTCCATTAAAT
GGGACAATAATGCCTTGTGATGCTGTGCTTATTAATGGTACCTGCATTGTAAACGAAAGCATGTTAACAGAAACTTGAGGAGAGGCTGGA
GTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACA
CCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAA
ACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGAT

>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000455191_chr3_197619630_-_1339nt
ATGGACAGGGAAGAAAGGAAGACCATCAATCAGGGTCAAGAAGATGAAATGGAGATTTATGGTTACAATTTGAGTCGCTGGAAGCTTGCC
ATAGTTTCTTTAGGAGTGATTTGCTCTGGTGGGTTTCTCCTCCTCCTCCTCTATTGGATGCCTGAGTGGCGGGTGAAAGCGACCTGTGTC
AGAGCTGCAATTAAAGACTGTGAAGTAGTGCTGCTGAGGACTACTGATGAATTCAAAATGTGGTTTTGTGCAAAAATTCGCGTTCTTTCT
TTGGAAACTTACCCAGTTTCAAGTCCAAAATCTATGTCTAATAAGCTTTCAAATGGCCATGCAGTTTGTTTAATTGAGAATCCCACTGAA
GAAAATAGGCACAGGATCAGTAAATATTCACAGACTGAATCACAACAGATTCGTTATTTCACCCACCATAGTGTAAAATATTTCTGGAAT
GATACCATTCACAATTTTGATTTCTTAAAGGGACTGGATGAAGGTGTTTCTTGTACGTCAATTTATGAAAAGCATAGTGCAGGACTGACA
AAGGGGATGCATGCCTACAGAAAACTGCTTTATGGAGTAAATGAAATTGCTGTAAAAGTGCCTTCTGTTTTTAAGCTTCTAATTAAAGAG
GTTCTCAACCCATTTTACATTTTCCAGCTGTTCAGTGTTATACTGTGGAGCACTGATGAATACTATTACTATGCTCTAGCTATTGTGGTT
ATGTCCATAGTATCAATCGTAAGCTCACTATATTCCATTAGAAAGCAATATGTTATGTTGCATGACATGGTGGCAACTCATAGTACCGTA
AGAGTTTCAGTTTGTAGAGTAAATGAAGAAATAGAAGAAATCTTTTCTACCGACCTTGTGCCAGGAGATGTCATGGTCATTCCATTAAAT
GGGACAATAATGCCTTGTGATGCTGTGCTTATTAATGGTACCTGCATTGTAAACGAAAGCATGTTAACAGAAACTTGAGGAGAGGCTGGA
GTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGAACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACA
CCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCATTGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAA
ACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTGGCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000265239_chr3_197619630_-_2246nt
TTTATTCAAATAATAGGAGCTCTACGAGTGACAGATGGCAGAAGGGCACATCTTCTGAAAACTTACTAAAAATTGGTGAATTACAAAATT
CTAAATTTTAATACCTTAATCATTTTGAAAGCAGTTCAGACAGAACCGAAACAGAAATATTTGGCATAAAATTCCAAATTTTTATGCTTA
GTTTTATTTTTATTATTAAAAGCCAGCTTTTGAAAGCTGTGCAAATATCAGGAATTGGGAAGAATGATGATATAGTGCTACTGGTAAGAA
AAATTTCTTCAATTTGTTTTCTCTGATATCGAATTTGACTTGGTTAAAAAACGTGTGCTCCAGCAGTCCAGAAAAGTTATATTTCTTGAT
CTTCCATTGTTTGAAGCACTGGACCTTTAATCCACTGTAGGTATGGACAGGGAAGAAAGGAAGACCATCAATCAGGGTCAAGAAGATGAA
ATGGAGATTTATGGTTACAATTTGAGTCGCTGGAAGCTTGCCATAGTTTCTTTAGGAGTGATTTGCTCTGGTGGGTTTCTCCTCCTCCTC
CTCTATTGGATGCCTGAGTGGCGGGTGAAAGCGACCTGTGTCAGAGCTGCAATTAAAGACTGTGAAGTAGTGCTGCTGAGGACTACTGAT
GAATTCAAAATGTGGTTTTGTGCAAAAATTCGCGTTCTTTCTTTGGAAACTTACCCAGTTTCAAGTCCAAAATCTATGTCTAATAAGCTT
TCAAATGGCCATGCAGTTTGTTTAATTGAGAATCCCACTGAAGAAAATAGGCACAGGATCAGTAAATATTCACAGACTGAATCACAACAG
ATTCGTTATTTCACCCACCATAGTGTAAAATATTTCTGGAATGATACCATTCACAATTTTGATTTCTTAAAGGGACTGGATGAAGGTGTT
TCTTGTACGTCAATTTATGAAAAGCATAGTGCAGGACTGACAAAGGGGATGCATGCCTACAGAAAACTGCTTTATGGAGTAAATGAAATT
GCTGTAAAAGTGCCTTCTGTTTTTAAGCTTCTAATTAAAGAGGTTCTCAACCCATTTTACATTTTCCAGCTGTTCAGTGTTATACTGTGG
AGCACTGATGAATACTATTACTATGCTCTAGCTATTGTGGTTATGTCCATAGTATCAATCGTAAGCTCACTATATTCCATTAGAAAGCAA
TATGTTATGTTGCATGACATGGTGGCAACTCATAGTACCGTAAGAGTTTCAGTTTGTAGAGTAAATGAAGAAATAGAAGAAATCTTTTCT
ACCGACCTTGTGCCAGGAGATGTCATGGTCATTCCATTAAATGGGACAATAATGCCTTGTGATGCTGTGCTTATTAATGGTACCTGCATT
GTAAACGAAAGCATGTTAACAGAAACTTGAGGAGAGGCTGGAGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGA
ACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCAT
TGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAAACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTG
GCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGATGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGG
CAAGGATAAGAGGAGAGGCAAGAAGAAGTGACCAAGTTCTCTTTTGTGTTTTCTGCTGGTATTCTGGAGGTGGGAAGGACTTGGAGAGAG
TTAAGAAACACCTGGTACCTCAAAGATGACTCATCTACAGGTTGTTTCCTATTGAGACTTTCCCAGGGAAGCCTGATTTCACTTTGCCTG
TTAATTTCACTCTGCCTGTTAGGTGGGTTTTCAAACCCTGATTTAGGATTACACCATTGACTTAGGGCTTCCTCATACCTTGCTGGGAAG
AAGTTTCTAGTAGTCCTGTGAAGATTCATTCTTCTTGCTCTTTCTCAGCAGAACAAAGGAGTTCACTGGCTTAGCTACAGTGACGCATTG
AAACTTGAGTAATTCCTGTAATGTCAGATTTTGATTTTACCCAATTTGTCTGTAGTGAAAAAACTCTTATGAGCAAAAGTATTCAGTAGG

>In-frame_ATP13A3_ENST00000256031_chr3_194170874_-_IQCG_ENST00000455191_chr3_197619630_-_2244nt
TTTATTCAAATAATAGGAGCTCTACGAGTGACAGATGGCAGAAGGGCACATCTTCTGAAAACTTACTAAAAATTGGTGAATTACAAAATT
CTAAATTTTAATACCTTAATCATTTTGAAAGCAGTTCAGACAGAACCGAAACAGAAATATTTGGCATAAAATTCCAAATTTTTATGCTTA
GTTTTATTTTTATTATTAAAAGCCAGCTTTTGAAAGCTGTGCAAATATCAGGAATTGGGAAGAATGATGATATAGTGCTACTGGTAAGAA
AAATTTCTTCAATTTGTTTTCTCTGATATCGAATTTGACTTGGTTAAAAAACGTGTGCTCCAGCAGTCCAGAAAAGTTATATTTCTTGAT
CTTCCATTGTTTGAAGCACTGGACCTTTAATCCACTGTAGGTATGGACAGGGAAGAAAGGAAGACCATCAATCAGGGTCAAGAAGATGAA
ATGGAGATTTATGGTTACAATTTGAGTCGCTGGAAGCTTGCCATAGTTTCTTTAGGAGTGATTTGCTCTGGTGGGTTTCTCCTCCTCCTC
CTCTATTGGATGCCTGAGTGGCGGGTGAAAGCGACCTGTGTCAGAGCTGCAATTAAAGACTGTGAAGTAGTGCTGCTGAGGACTACTGAT
GAATTCAAAATGTGGTTTTGTGCAAAAATTCGCGTTCTTTCTTTGGAAACTTACCCAGTTTCAAGTCCAAAATCTATGTCTAATAAGCTT
TCAAATGGCCATGCAGTTTGTTTAATTGAGAATCCCACTGAAGAAAATAGGCACAGGATCAGTAAATATTCACAGACTGAATCACAACAG
ATTCGTTATTTCACCCACCATAGTGTAAAATATTTCTGGAATGATACCATTCACAATTTTGATTTCTTAAAGGGACTGGATGAAGGTGTT
TCTTGTACGTCAATTTATGAAAAGCATAGTGCAGGACTGACAAAGGGGATGCATGCCTACAGAAAACTGCTTTATGGAGTAAATGAAATT
GCTGTAAAAGTGCCTTCTGTTTTTAAGCTTCTAATTAAAGAGGTTCTCAACCCATTTTACATTTTCCAGCTGTTCAGTGTTATACTGTGG
AGCACTGATGAATACTATTACTATGCTCTAGCTATTGTGGTTATGTCCATAGTATCAATCGTAAGCTCACTATATTCCATTAGAAAGCAA
TATGTTATGTTGCATGACATGGTGGCAACTCATAGTACCGTAAGAGTTTCAGTTTGTAGAGTAAATGAAGAAATAGAAGAAATCTTTTCT
ACCGACCTTGTGCCAGGAGATGTCATGGTCATTCCATTAAATGGGACAATAATGCCTTGTGATGCTGTGCTTATTAATGGTACCTGCATT
GTAAACGAAAGCATGTTAACAGAAACTTGAGGAGAGGCTGGAGTTCTGGATGGAGAAATACGATAAGGACACAGAAATGAAACAGAATGA
ACTAAATGCTCTCAAAGCCACAAAGGCCAGTGACTTAGCACACCTTCAAGACCTGGCAAAGATGATAAGAGAGTATGAACAGGTCATCAT
TGAAGATCGTATAGAAAAGGAGAGGAGCAAGAAGAAGGTAAAACAGGATCTCTTGGAATTAAAGAGCGTTATAAAGCTCCAGGCCTGGTG
GCGAGGCACTATGATACGGAGAGAAATTGGTGGTTTCAAGATGCCTAAAGACAAAGTTGATAGCAAGGATTCAAAAGGCAAAGGTAAAGG
CAAGGATAAGAGGAGAGGCAAGAAGAAGTGACCAAGTTCTCTTTTGTGTTTTCTGCTGGTATTCTGGAGGTGGGAAGGACTTGGAGAGAG
TTAAGAAACACCTGGTACCTCAAAGATGACTCATCTACAGGTTGTTTCCTATTGAGACTTTCCCAGGGAAGCCTGATTTCACTTTGCCTG
TTAATTTCACTCTGCCTGTTAGGTGGGTTTTCAAACCCTGATTTAGGATTACACCATTGACTTAGGGCTTCCTCATACCTTGCTGGGAAG
AAGTTTCTAGTAGTCCTGTGAAGATTCATTCTTCTTGCTCTTTCTCAGCAGAACAAAGGAGTTCACTGGCTTAGCTACAGTGACGCATTG
AAACTTGAGTAATTCCTGTAATGTCAGATTTTGATTTTACCCAATTTGTCTGTAGTGAAAAAACTCTTATGAGCAAAAGTATTCAGTAGG


Top

FusionGenePPI for ATP13A3_IQCG


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP13A3LGALS3, LGALS8, LGALS9, P2RY8, ISLR, YIPF3, C5AR2, GPR114, TPRA1, TMCO3, MAS1IQCGBAG6, GSK3B


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP13A3_IQCG


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP13A3_IQCG


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource