FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3274

FusionGeneSummary for ATP11B_TFRC

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP11B_TFRC
Fusion gene ID: 3274
HgeneTgene
Gene symbol

ATP11B

TFRC

Gene ID

23200

7037

Gene nameATPase phospholipid transporting 11B (putative)transferrin receptor
SynonymsATPIF|ATPIRCD71|IMD46|T9|TFR|TFR1|TR|TRFR|p90
Cytomap

3q26.33

3q29

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IFATPase IRATPase, class VI, type 11BP4-ATPase flippase complex alpha subunit ATP11Btruncated ATPase 11B proteintransferrin receptor protein 1
Modification date2018052320180519
UniProtAcc

Q9Y2G3

P02786

Ensembl transtripts involved in fusion geneENST00000323116, ENST00000493826, 
ENST00000482794, 
ENST00000420415, 
ENST00000360110, ENST00000540528, 
ENST00000392396, ENST00000535031, 
ENST00000465288, 
Fusion gene scores* DoF score12 X 11 X 8=10562 X 2 X 2=8
# samples 122
** MAII scorelog2(12/1056*10)=-3.13750352374993
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: ATP11B [Title/Abstract] AND TFRC [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneTFRC

GO:0030890

positive regulation of B cell proliferation

26642240

TgeneTFRC

GO:0031623

receptor internalization

26642240

TgeneTFRC

GO:0033572

transferrin transport

26642240

TgeneTFRC

GO:0035690

cellular response to drug

16254249

TgeneTFRC

GO:0042102

positive regulation of T cell proliferation

26642240

TgeneTFRC

GO:0045830

positive regulation of isotype switching

26642240

TgeneTFRC

GO:0097286

iron ion import

7556058


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CV-6937-01AATP11Bchr3

182587119

+TFRCchr3

195785503

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000323116ENST00000420415ATP11Bchr3

182587119

+TFRCchr3

195785503

-
In-frameENST00000323116ENST00000360110ATP11Bchr3

182587119

+TFRCchr3

195785503

-
5CDS-3UTRENST00000323116ENST00000540528ATP11Bchr3

182587119

+TFRCchr3

195785503

-
5CDS-3UTRENST00000323116ENST00000392396ATP11Bchr3

182587119

+TFRCchr3

195785503

-
5CDS-3UTRENST00000323116ENST00000535031ATP11Bchr3

182587119

+TFRCchr3

195785503

-
5CDS-5UTRENST00000323116ENST00000465288ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3CDSENST00000493826ENST00000420415ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3CDSENST00000493826ENST00000360110ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000493826ENST00000540528ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000493826ENST00000392396ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000493826ENST00000535031ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-5UTRENST00000493826ENST00000465288ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3CDSENST00000482794ENST00000420415ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3CDSENST00000482794ENST00000360110ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000482794ENST00000540528ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000482794ENST00000392396ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-3UTRENST00000482794ENST00000535031ATP11Bchr3

182587119

+TFRCchr3

195785503

-
intron-5UTRENST00000482794ENST00000465288ATP11Bchr3

182587119

+TFRCchr3

195785503

-

Top

FusionProtFeatures for ATP11B_TFRC


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP11B

Q9Y2G3

TFRC

P02786

Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). Involved in regulation of sensitivity tocisplatin; may contribute to secretory vesicle transport ofcisplatin from Golgi to plasma membrane.{ECO:0000269|PubMed:23585472, ECO:0000305}. Cellular uptake of iron occurs via receptor-mediatedendocytosis of ligand-occupied transferrin receptor intospecialized endosomes. Endosomal acidification leads to ironrelease. The apotransferrin-receptor complex is then recycled tothe cell surface with a return to neutral pH and the concomitantloss of affinity of apotransferrin for its receptor. Transferrinreceptor is necessary for development of erythrocytes and thenervous system (By similarity). A second ligand, the heditaryhemochromatosis protein HFE, competes for binding with transferrinfor an overlapping C-terminal binding site. Positively regulates Tand B cell proliferation through iron uptake (PubMed:26642240).{ECO:0000250, ECO:0000269|PubMed:26642240,ECO:0000269|PubMed:3568132}. (Microbial infection) Acts as a receptor for new-worldarenaviruses: Guanarito, Junin and Machupo virus.{ECO:0000269|PubMed:17287727, ECO:0000269|PubMed:18268337}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730105_2896221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301_556221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730312_3416221178Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+173078_826221178Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730290_3116221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730342_3596221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+173056_776221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+173083_1046221178TransmembraneHelical
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-1319646_648512761MotifNote=Cell attachment site%3B required for binding to transferrin
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-1319646_648512761MotifNote=Cell attachment site%3B required for binding to transferrin
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-1319569_760512761RegionNote=Ligand-binding
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-1319569_760512761RegionNote=Ligand-binding

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301021_10256221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301048_10656221178Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301091_11776221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730360_8766221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730899_9106221178Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730931_9606221178Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730983_9976221178Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161021_1025-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161048_1065-86196Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16105_289-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161091_1177-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161_55-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16312_341-86196Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16360_876-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+1678_82-86196Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16899_910-86196Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16931_960-86196Topological domainCytoplasmic
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16983_997-86196Topological domainExtracellular
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301026_10476221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+17301066_10906221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730877_8986221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730911_9306221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730961_9826221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000323116+1730998_10206221178TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161026_1047-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+161066_1090-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16290_311-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16342_359-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+1656_77-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+1683_104-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16877_898-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16911_930-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16961_982-86196TransmembraneHelical
HgeneATP11Bchr3:182587119chr3:195785503ENST00000493826+16998_1020-86196TransmembraneHelical
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-1319223_313512761DomainNote=PA
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-1319223_313512761DomainNote=PA
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-131958_61512761MotifNote=Stop-transfer sequence
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-131958_61512761MotifNote=Stop-transfer sequence
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-131989_760512761Topological domainExtracellular
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-131989_760512761Topological domainExtracellular
TgeneTFRCchr3:182587119chr3:195785503ENST00000360110-131968_88512761TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneTFRCchr3:182587119chr3:195785503ENST00000392396-131968_88512761TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for ATP11B_TFRC


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000420415_chr3_195785503_-_871aa
MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLFEQFRRVANFTFLIIFLVQLMIDTPTSPVTS
GLPLFFVITVTAIKQGTEDWLRHNSDNEVNGAPVTVVRSGGLVKTRSKNIRVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGE
TNLKTHVAVPETALLQTVANLDTLVAVIECQQPEADLYRFMGRMIITQQMEEIVRPLGPESLLLRGARLKNTKEIFGVAVYTGMETKMAL
NYKSKSQKRSAVEKSMNTFLIITLVILISEAVISTILKTTWQAEEKWDEPWTNQKTEHQRNSSKILRFISDFLAFLVLYNFIIPISLTVT
VEMQKFLGSFFIGWDLDLTHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFRECSINGMKYQEINGRLVPEGPTPDSSEGNL
STLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYTASSPDEKALVEAAAR
IGIVFIGNSEETMEVKTLGKLERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESSILPKCIGGEIEKTRIHVDEFALVKHPVTGQ
FLTQDSNWASKVEKLTLDNAAFPFLATSGIPAVSFCFCEDTDTPTLGTTMDTTKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLD
TERYNSQLLSFVRDLNQYRADIKEMGLSLQWLTSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVETHFLSPYVSPKESPFRHV

>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000360110_chr3_195785503_-_871aa
MWRWIRQQLGFDPPHQSDTRTIYVANRFPQNGLYTPQKFIDNRIISSKYTVWNFVPKNLFEQFRRVANFTFLIIFLVQLMIDTPTSPVTS
GLPLFFVITVTAIKQGTEDWLRHNSDNEVNGAPVTVVRSGGLVKTRSKNIRVGDIVRIAKDEIFPADLVLLSSDRLDGSCHVTTASLDGE
TNLKTHVAVPETALLQTVANLDTLVAVIECQQPEADLYRFMGRMIITQQMEEIVRPLGPESLLLRGARLKNTKEIFGVAVYTGMETKMAL
NYKSKSQKRSAVEKSMNTFLIITLVILISEAVISTILKTTWQAEEKWDEPWTNQKTEHQRNSSKILRFISDFLAFLVLYNFIIPISLTVT
VEMQKFLGSFFIGWDLDLTHEESDQKAQVNTSDLNEELGQVEYVFTDKTGTLTENEMQFRECSINGMKYQEINGRLVPEGPTPDSSEGNL
STLSSLSHLNNLSHLTTSSSFRTSPENETELIKEHDLFFKAVSLCHTVQISNVQTDCTGDGPWQSNLAPSQLEYTASSPDEKALVEAAAR
IGIVFIGNSEETMEVKTLGKLERYKLLHILEFDSDRRRMSVIVQAPSGEKLLFAKGAESSILPKCIGGEIEKTRIHVDEFALVKHPVTGQ
FLTQDSNWASKVEKLTLDNAAFPFLATSGIPAVSFCFCEDTDTPTLGTTMDTTKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLD
TERYNSQLLSFVRDLNQYRADIKEMGLSLQWLTSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVETHFLSPYVSPKESPFRHV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000420415_chr3_195785503_-_2613nt
ATGTGGCGCTGGATCCGGCAGCAGCTGGGTTTTGACCCACCACATCAGAGTGACACAAGAACCATCTACGTAGCCAACAGGTTTCCTCAG
AATGGCCTTTACACACCTCAGAAATTTATAGATAACAGGATCATTTCATCTAAGTACACTGTGTGGAATTTTGTTCCAAAAAATTTATTT
GAACAGTTCAGAAGAGTGGCAAACTTTTATTTTCTTATTATATTTTTGGTTCAGCTTATGATTGATACACCTACCAGTCCAGTTACCAGT
GGACTTCCATTATTCTTTGTGATAACAGTAACTGCCATAAAGCAGGGATATGAAGATTGGTTACGGCATAACTCAGATAATGAAGTAAAT
GGAGCTCCTGTTTATGTTGTTCGAAGTGGTGGCCTTGTAAAAACTAGATCAAAAAACATTCGGGTGGGTGATATTGTTCGAATAGCCAAA
GATGAAATTTTTCCTGCAGACTTGGTGCTTCTGTCCTCAGATCGACTGGATGGTTCCTGTCACGTTACAACTGCTAGTTTGGACGGAGAA
ACTAACCTGAAGACACATGTGGCAGTTCCAGAAACAGCATTATTACAAACAGTTGCCAATTTGGACACTCTAGTAGCTGTAATAGAATGC
CAGCAACCAGAAGCAGACTTATACAGATTCATGGGACGAATGATCATAACCCAACAAATGGAAGAAATTGTAAGACCTCTGGGGCCGGAG
AGTCTCCTGCTTCGTGGAGCCAGATTAAAAAACACAAAAGAAATTTTTGGTGTTGCGGTATACACTGGAATGGAAACTAAGATGGCATTA
AATTACAAGAGCAAATCACAGAAACGATCTGCAGTAGAAAAGTCAATGAATACATTTTTGATAATTTATCTAGTAATTCTTATATCTGAA
GCTGTCATCAGCACTATCTTGAAGTATACATGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGA
AATAGCAGTAAGATTCTGAGATTTATTTCAGACTTCCTTGCTTTTTTGGTTCTCTACAATTTCATCATTCCAATTTCATTATATGTGACA
GTCGAAATGCAGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCATGAAGAATCAGATCAGAAAGCTCAAGTCAAT
ACTTCCGATCTGAATGAAGAGCTTGGACAGGTAGAGTACGTGTTTACAGATAAAACTGGTACACTGACAGAAAATGAGATGCAGTTTCGG
GAATGTTCAATTAATGGCATGAAATACCAAGAAATTAATGGTAGACTTGTACCCGAAGGACCAACACCAGACTCTTCAGAAGGAAACTTA
TCTTATCTTAGTAGTTTATCCCATCTTAACAACTTATCCCATCTTACAACCAGTTCCTCTTTCAGAACCAGTCCTGAAAATGAAACTGAA
CTAATTAAAGAACATGATCTCTTCTTTAAAGCAGTCAGTCTCTGTCACACTGTACAGATTAGCAATGTTCAAACTGACTGCACTGGTGAT
GGTCCCTGGCAATCCAACCTGGCACCATCGCAGTTGGAGTACTATGCATCTTCACCAGATGAAAAGGCTCTAGTAGAAGCTGCTGCAAGG
ATTGGTATTGTGTTTATTGGCAATTCTGAAGAAACTATGGAGGTTAAAACTCTTGGAAAACTGGAACGGTACAAACTGCTTCATATTCTG
GAATTTGATTCAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAGGTGAGAAGTTATTATTTGCTAAAGGAGCTGAGTCATCA
ATTCTCCCTAAATGTATAGGTGGAGAAATAGAAAAAACCAGAATTCATGTAGATGAATTTGCTTTGGTGAAGCATCCGGTTACTGGGCAA
TTTCTATATCAGGACAGCAACTGGGCCAGCAAAGTTGAGAAACTCACTTTAGACAATGCTGCTTTCCCTTTCCTTGCATATTCTGGAATC
CCAGCAGTTTCTTTCTGTTTTTGCGAGGACACAGATTATCCTTATTTGGGTACCACCATGGACACCTATAAGGAACTGATTGAGAGGATT
CCTGAGTTGAACAAAGTGGCACGAGCAGCTGCAGAGGTCGCTGGTCAGTTCGTGATTAAACTAACCCATGATGTTGAATTGAACCTGGAC
TATGAGAGGTACAACAGCCAACTGCTTTCATTTGTGAGGGATCTGAACCAATACAGAGCAGACATAAAGGAAATGGGCCTGAGTTTACAG
TGGCTGTATTCTGCTCGTGGAGACTTCTTCCGTGCTACTTCCAGACTAACAACAGATTTCGGGAATGCTGAGAAAACAGACAGATTTGTC
ATGAAGAAACTCAATGATCGTGTCATGAGAGTGGAGTATCACTTCCTCTCTCCCTACGTATCTCCAAAAGAGTCTCCTTTCCGACATGTC
TTCTGGGGCTCCGGCTCTCACACGCTGCCAGCTTTACTGGAGAACTTGAAACTGCGTAAACAAAATAACGGTGCTTTTAATGAAACGCTG
TTCAGAAACCAGTTGGCTCTAGCTACTTGGACTATTCAGGGAGCTGCAAATGCCCTCTCTGGTGACGTTTGGGACATTGACAATGAGTTT

>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000360110_chr3_195785503_-_2613nt
ATGTGGCGCTGGATCCGGCAGCAGCTGGGTTTTGACCCACCACATCAGAGTGACACAAGAACCATCTACGTAGCCAACAGGTTTCCTCAG
AATGGCCTTTACACACCTCAGAAATTTATAGATAACAGGATCATTTCATCTAAGTACACTGTGTGGAATTTTGTTCCAAAAAATTTATTT
GAACAGTTCAGAAGAGTGGCAAACTTTTATTTTCTTATTATATTTTTGGTTCAGCTTATGATTGATACACCTACCAGTCCAGTTACCAGT
GGACTTCCATTATTCTTTGTGATAACAGTAACTGCCATAAAGCAGGGATATGAAGATTGGTTACGGCATAACTCAGATAATGAAGTAAAT
GGAGCTCCTGTTTATGTTGTTCGAAGTGGTGGCCTTGTAAAAACTAGATCAAAAAACATTCGGGTGGGTGATATTGTTCGAATAGCCAAA
GATGAAATTTTTCCTGCAGACTTGGTGCTTCTGTCCTCAGATCGACTGGATGGTTCCTGTCACGTTACAACTGCTAGTTTGGACGGAGAA
ACTAACCTGAAGACACATGTGGCAGTTCCAGAAACAGCATTATTACAAACAGTTGCCAATTTGGACACTCTAGTAGCTGTAATAGAATGC
CAGCAACCAGAAGCAGACTTATACAGATTCATGGGACGAATGATCATAACCCAACAAATGGAAGAAATTGTAAGACCTCTGGGGCCGGAG
AGTCTCCTGCTTCGTGGAGCCAGATTAAAAAACACAAAAGAAATTTTTGGTGTTGCGGTATACACTGGAATGGAAACTAAGATGGCATTA
AATTACAAGAGCAAATCACAGAAACGATCTGCAGTAGAAAAGTCAATGAATACATTTTTGATAATTTATCTAGTAATTCTTATATCTGAA
GCTGTCATCAGCACTATCTTGAAGTATACATGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGA
AATAGCAGTAAGATTCTGAGATTTATTTCAGACTTCCTTGCTTTTTTGGTTCTCTACAATTTCATCATTCCAATTTCATTATATGTGACA
GTCGAAATGCAGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCATGAAGAATCAGATCAGAAAGCTCAAGTCAAT
ACTTCCGATCTGAATGAAGAGCTTGGACAGGTAGAGTACGTGTTTACAGATAAAACTGGTACACTGACAGAAAATGAGATGCAGTTTCGG
GAATGTTCAATTAATGGCATGAAATACCAAGAAATTAATGGTAGACTTGTACCCGAAGGACCAACACCAGACTCTTCAGAAGGAAACTTA
TCTTATCTTAGTAGTTTATCCCATCTTAACAACTTATCCCATCTTACAACCAGTTCCTCTTTCAGAACCAGTCCTGAAAATGAAACTGAA
CTAATTAAAGAACATGATCTCTTCTTTAAAGCAGTCAGTCTCTGTCACACTGTACAGATTAGCAATGTTCAAACTGACTGCACTGGTGAT
GGTCCCTGGCAATCCAACCTGGCACCATCGCAGTTGGAGTACTATGCATCTTCACCAGATGAAAAGGCTCTAGTAGAAGCTGCTGCAAGG
ATTGGTATTGTGTTTATTGGCAATTCTGAAGAAACTATGGAGGTTAAAACTCTTGGAAAACTGGAACGGTACAAACTGCTTCATATTCTG
GAATTTGATTCAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAGGTGAGAAGTTATTATTTGCTAAAGGAGCTGAGTCATCA
ATTCTCCCTAAATGTATAGGTGGAGAAATAGAAAAAACCAGAATTCATGTAGATGAATTTGCTTTGGTGAAGCATCCGGTTACTGGGCAA
TTTCTATATCAGGACAGCAACTGGGCCAGCAAAGTTGAGAAACTCACTTTAGACAATGCTGCTTTCCCTTTCCTTGCATATTCTGGAATC
CCAGCAGTTTCTTTCTGTTTTTGCGAGGACACAGATTATCCTTATTTGGGTACCACCATGGACACCTATAAGGAACTGATTGAGAGGATT
CCTGAGTTGAACAAAGTGGCACGAGCAGCTGCAGAGGTCGCTGGTCAGTTCGTGATTAAACTAACCCATGATGTTGAATTGAACCTGGAC
TATGAGAGGTACAACAGCCAACTGCTTTCATTTGTGAGGGATCTGAACCAATACAGAGCAGACATAAAGGAAATGGGCCTGAGTTTACAG
TGGCTGTATTCTGCTCGTGGAGACTTCTTCCGTGCTACTTCCAGACTAACAACAGATTTCGGGAATGCTGAGAAAACAGACAGATTTGTC
ATGAAGAAACTCAATGATCGTGTCATGAGAGTGGAGTATCACTTCCTCTCTCCCTACGTATCTCCAAAAGAGTCTCCTTTCCGACATGTC
TTCTGGGGCTCCGGCTCTCACACGCTGCCAGCTTTACTGGAGAACTTGAAACTGCGTAAACAAAATAACGGTGCTTTTAATGAAACGCTG
TTCAGAAACCAGTTGGCTCTAGCTACTTGGACTATTCAGGGAGCTGCAAATGCCCTCTCTGGTGACGTTTGGGACATTGACAATGAGTTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000420415_chr3_195785503_-_5531nt
GGTCAATAATGAAGGTGGCTGCGGCGCGGCGGCAGGCTCAGCTGCGCCGGGCGGGGGCGGCGCCGGGGCCGCGCCTGTAGGACTCGGGGC
CGACGCCGCGGGATGGGGACGCGGCGCGGGGAGTGAGGCAGTGGCGGCGGCGGCGGTAAGCGGAACTTCGGCCCGAGGGGCTCGCCCGCT
CCCGCCTCTGTCTTGTCGGCCTCCACCTGCAGCCCCGCGGCCCCCGCGCCCCGCGGGACCCGGACGGCGACGACGGGGGAATGTGGCGCT
GGATCCGGCAGCAGCTGGGTTTTGACCCACCACATCAGAGTGACACAAGAACCATCTACGTAGCCAACAGGTTTCCTCAGAATGGCCTTT
ACACACCTCAGAAATTTATAGATAACAGGATCATTTCATCTAAGTACACTGTGTGGAATTTTGTTCCAAAAAATTTATTTGAACAGTTCA
GAAGAGTGGCAAACTTTTATTTTCTTATTATATTTTTGGTTCAGCTTATGATTGATACACCTACCAGTCCAGTTACCAGTGGACTTCCAT
TATTCTTTGTGATAACAGTAACTGCCATAAAGCAGGGATATGAAGATTGGTTACGGCATAACTCAGATAATGAAGTAAATGGAGCTCCTG
TTTATGTTGTTCGAAGTGGTGGCCTTGTAAAAACTAGATCAAAAAACATTCGGGTGGGTGATATTGTTCGAATAGCCAAAGATGAAATTT
TTCCTGCAGACTTGGTGCTTCTGTCCTCAGATCGACTGGATGGTTCCTGTCACGTTACAACTGCTAGTTTGGACGGAGAAACTAACCTGA
AGACACATGTGGCAGTTCCAGAAACAGCATTATTACAAACAGTTGCCAATTTGGACACTCTAGTAGCTGTAATAGAATGCCAGCAACCAG
AAGCAGACTTATACAGATTCATGGGACGAATGATCATAACCCAACAAATGGAAGAAATTGTAAGACCTCTGGGGCCGGAGAGTCTCCTGC
TTCGTGGAGCCAGATTAAAAAACACAAAAGAAATTTTTGGTGTTGCGGTATACACTGGAATGGAAACTAAGATGGCATTAAATTACAAGA
GCAAATCACAGAAACGATCTGCAGTAGAAAAGTCAATGAATACATTTTTGATAATTTATCTAGTAATTCTTATATCTGAAGCTGTCATCA
GCACTATCTTGAAGTATACATGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGAAATAGCAGTA
AGATTCTGAGATTTATTTCAGACTTCCTTGCTTTTTTGGTTCTCTACAATTTCATCATTCCAATTTCATTATATGTGACAGTCGAAATGC
AGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCATGAAGAATCAGATCAGAAAGCTCAAGTCAATACTTCCGATC
TGAATGAAGAGCTTGGACAGGTAGAGTACGTGTTTACAGATAAAACTGGTACACTGACAGAAAATGAGATGCAGTTTCGGGAATGTTCAA
TTAATGGCATGAAATACCAAGAAATTAATGGTAGACTTGTACCCGAAGGACCAACACCAGACTCTTCAGAAGGAAACTTATCTTATCTTA
GTAGTTTATCCCATCTTAACAACTTATCCCATCTTACAACCAGTTCCTCTTTCAGAACCAGTCCTGAAAATGAAACTGAACTAATTAAAG
AACATGATCTCTTCTTTAAAGCAGTCAGTCTCTGTCACACTGTACAGATTAGCAATGTTCAAACTGACTGCACTGGTGATGGTCCCTGGC
AATCCAACCTGGCACCATCGCAGTTGGAGTACTATGCATCTTCACCAGATGAAAAGGCTCTAGTAGAAGCTGCTGCAAGGATTGGTATTG
TGTTTATTGGCAATTCTGAAGAAACTATGGAGGTTAAAACTCTTGGAAAACTGGAACGGTACAAACTGCTTCATATTCTGGAATTTGATT
CAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAGGTGAGAAGTTATTATTTGCTAAAGGAGCTGAGTCATCAATTCTCCCTA
AATGTATAGGTGGAGAAATAGAAAAAACCAGAATTCATGTAGATGAATTTGCTTTGGTGAAGCATCCGGTTACTGGGCAATTTCTATATC
AGGACAGCAACTGGGCCAGCAAAGTTGAGAAACTCACTTTAGACAATGCTGCTTTCCCTTTCCTTGCATATTCTGGAATCCCAGCAGTTT
CTTTCTGTTTTTGCGAGGACACAGATTATCCTTATTTGGGTACCACCATGGACACCTATAAGGAACTGATTGAGAGGATTCCTGAGTTGA
ACAAAGTGGCACGAGCAGCTGCAGAGGTCGCTGGTCAGTTCGTGATTAAACTAACCCATGATGTTGAATTGAACCTGGACTATGAGAGGT
ACAACAGCCAACTGCTTTCATTTGTGAGGGATCTGAACCAATACAGAGCAGACATAAAGGAAATGGGCCTGAGTTTACAGTGGCTGTATT
CTGCTCGTGGAGACTTCTTCCGTGCTACTTCCAGACTAACAACAGATTTCGGGAATGCTGAGAAAACAGACAGATTTGTCATGAAGAAAC
TCAATGATCGTGTCATGAGAGTGGAGTATCACTTCCTCTCTCCCTACGTATCTCCAAAAGAGTCTCCTTTCCGACATGTCTTCTGGGGCT
CCGGCTCTCACACGCTGCCAGCTTTACTGGAGAACTTGAAACTGCGTAAACAAAATAACGGTGCTTTTAATGAAACGCTGTTCAGAAACC
AGTTGGCTCTAGCTACTTGGACTATTCAGGGAGCTGCAAATGCCCTCTCTGGTGACGTTTGGGACATTGACAATGAGTTTTAAATGTGAT
ACCCATAGCTTCCATGAGAACAGCAGGGTAGTCTGGTTTCTAGACTTGTGCTGATCGTGCTAAATTTTCAGTAGGGCTACAAAACCTGAT
GTTAAAATTCCATCCCATCATCTTGGTACTACTAGATGTCTTTAGGCAGCAGCTTTTAATACAGGGTAGATAACCTGTACTTCAAGTTAA
AGTGAATAACCACTTAAAAAATGTCCATGATGGAATATTCCCCTATCTCTAGAATTTTAAGTGCTTTGTAATGGGAACTGCCTCTTTCCT
GTTGTTGTTAATGAAAATGTCAGAAACCAGTTATGTGAATGATCTCTCTGAATCCTAAGGGCTGGTCTCTGCTGAAGGTTGTAAGTGGTC
GCTTACTTTGAGTGATCCTCCAACTTCATTTGATGCTAAATAGGAGATACCAGGTTGAAAGACCTTCTCCAAATGAGATCTAAGCCTTTC
CATAAGGAATGTAGCTGGTTTCCTCATTCCTGAAAGAAACAGTTAACTTTCAGAAGAGATGGGCTTGTTTTCTTGCCAATGAGGTCTGAA
ATGGAGGTCCTTCTGCTGGATAAAATGAGGTTCAACTGTTGATTGCAGGAATAAGGCCTTAATATGTTAACCTCAGTGTCATTTATGAAA
AGAGGGGACCAGAAGCCAAAGACTTAGTATATTTTCTTTTCCTCTGTCCCTTCCCCCATAAGCCTCCATTTAGTTCTTTGTTATTTTTGT
TTCTTCCAAAGCACATTGAAAGAGAACCAGTTTCAGGTGTTTAGTTGCAGACTCAGTTTGTCAGACTTTAAAGAATAATATGCTGCCAAA
TTTTGGCCAAAGTGTTAATCTTAGGGGAGAGCTTTCTGTCCTTTTGGCACTGAGATATTTATTGTTTATTTATCAGTGACAGAGTTCACT
ATAAATGGTGTTTTTTTAATAGAATATAATTATCGGAAGCAGTGCCTTCCATAATTATGACAGTTATACTGTCGGTTTTTTTTAAATAAA
AGCAGCATCTGCTAATAAAACCCAACAGATACTGGAAGTTTTGCATTTATGGTCAACACTTAAGGGTTTTAGAAAACAGCCGTCAGCCAA
ATGTAATTGAATAAAGTTGAAGCTAAGATTTAGAGATGAATTAAATTTAATTAGGGGTTGCTAAGAAGCGAGCACTGACCAGATAAGAAT
GCTGGTTTTCCTAAATGCAGTGAATTGTGACCAAGTTATAAATCAATGTCACTTAAAGGCTGTGGTAGTACTCCTGCAAAATTTTATAGC
TCAGTTTATCCAAGGTGTAACTCTAATTCCCATTTTGCAAAATTTCCAGTACCTTTGTCACAATCCTAACACATTATCGGGAGCAGTGTC
TTCCATAATGTATAAAGAACAAGGTAGTTTTTACCTACCACAGTGTCTGTATCGGAGACAGTGATCTCCATATGTTACACTAAGGGTGTA
AGTAATTATCGGGAACAGTGTTTCCCATAATTTTCTTCATGCAATGACATCTTCAAAGCTTGAAGATCGTTAGTATCTAACATGTATCCC
AACTCCTATAATTCCCTATCTTTTAGTTTTAGTTGCAGAAACATTTTGTGGTCATTAAGCATTGGGTGGGTAAATTCAACCACTGTAAAA
TGAAATTACTACAAAATTTGAAATTTAGCTTGGGTTTTTGTTACCTTTATGGTTTCTCCAGGTCCTCTACTTAATGAGATAGTAGCATAC
ATTTATAATGTTTGCTATTGACAAGTCATTTTAACTTTATCACATTATTTGCATGTTACCTCCTATAAACTTAGTGCGGACAAGTTTTAA
TCCAGAATTGACCTTTTGACTTAAAGCAGAGGGACTTTGTATAGAAGGTTTGGGGGCTGTGGGGAAGGAGAGTCCCCTGAAGGTCTGACA
CGTCTGCCTACCCATTCGTGGTGATCAATTAAATGTAGGTATGAATAAGTTCGAAGCTCCGTGAGTGAACCATCATTATAAACGTGATGA
TCAGCTGTTTGTCATAGGGCAGTTGGAAACGGCCTCCTAGGGAAAAGTTCATAGGGTCTCTTCAGGTTCTTAGTGTCACTTACCTAGATT
TACAGCCTCACTTGAATGTGTCACTACTCACAGTCTCTTTAATCTTCAGTTTTATCTTTAATCTCCTCTTTTATCTTGGACTGACATTTA
GCGTAGCTAAGTGAAAAGGTCATAGCTGAGATTCCTGGTTCGGGTGTTACGCACACGTACTTAAATGAAAGCATGTGGCATGTTCATCGT
ATAACACAATATGAATACAGGGCATGCATTTTGCAGCAGTGAGTCTCTTCAGAAAACCCTTTTCTACAGTTAGGGTTGAGTTACTTCCTA
TCAAGCCAGTACGTGCTAACAGGCTCAATATTCCTGAATGAAATATCAGACTAGTGACAAGCTCCTGGTCTTGAGATGTCTTCTCGTTAA
GGAGATGGGCCTTTTGGAGGTAAAGGATAAAATGAATGAGTTCTGTCATGATTCACTATTCTAGAACTTGCATGACCTTTACTGTGTTAG
CTCTTTGAATGTTCTTGAAATTTTAGACTTTCTTTGTAAACAAATGATATGTCCTTATCATTGTATAAAAGCTGTTATGTGCAACAGTGT

>In-frame_ATP11B_ENST00000323116_chr3_182587119_+_TFRC_ENST00000360110_chr3_195785503_-_5531nt
GGTCAATAATGAAGGTGGCTGCGGCGCGGCGGCAGGCTCAGCTGCGCCGGGCGGGGGCGGCGCCGGGGCCGCGCCTGTAGGACTCGGGGC
CGACGCCGCGGGATGGGGACGCGGCGCGGGGAGTGAGGCAGTGGCGGCGGCGGCGGTAAGCGGAACTTCGGCCCGAGGGGCTCGCCCGCT
CCCGCCTCTGTCTTGTCGGCCTCCACCTGCAGCCCCGCGGCCCCCGCGCCCCGCGGGACCCGGACGGCGACGACGGGGGAATGTGGCGCT
GGATCCGGCAGCAGCTGGGTTTTGACCCACCACATCAGAGTGACACAAGAACCATCTACGTAGCCAACAGGTTTCCTCAGAATGGCCTTT
ACACACCTCAGAAATTTATAGATAACAGGATCATTTCATCTAAGTACACTGTGTGGAATTTTGTTCCAAAAAATTTATTTGAACAGTTCA
GAAGAGTGGCAAACTTTTATTTTCTTATTATATTTTTGGTTCAGCTTATGATTGATACACCTACCAGTCCAGTTACCAGTGGACTTCCAT
TATTCTTTGTGATAACAGTAACTGCCATAAAGCAGGGATATGAAGATTGGTTACGGCATAACTCAGATAATGAAGTAAATGGAGCTCCTG
TTTATGTTGTTCGAAGTGGTGGCCTTGTAAAAACTAGATCAAAAAACATTCGGGTGGGTGATATTGTTCGAATAGCCAAAGATGAAATTT
TTCCTGCAGACTTGGTGCTTCTGTCCTCAGATCGACTGGATGGTTCCTGTCACGTTACAACTGCTAGTTTGGACGGAGAAACTAACCTGA
AGACACATGTGGCAGTTCCAGAAACAGCATTATTACAAACAGTTGCCAATTTGGACACTCTAGTAGCTGTAATAGAATGCCAGCAACCAG
AAGCAGACTTATACAGATTCATGGGACGAATGATCATAACCCAACAAATGGAAGAAATTGTAAGACCTCTGGGGCCGGAGAGTCTCCTGC
TTCGTGGAGCCAGATTAAAAAACACAAAAGAAATTTTTGGTGTTGCGGTATACACTGGAATGGAAACTAAGATGGCATTAAATTACAAGA
GCAAATCACAGAAACGATCTGCAGTAGAAAAGTCAATGAATACATTTTTGATAATTTATCTAGTAATTCTTATATCTGAAGCTGTCATCA
GCACTATCTTGAAGTATACATGGCAAGCTGAAGAAAAATGGGATGAACCTTGGTATAACCAAAAAACAGAACATCAAAGAAATAGCAGTA
AGATTCTGAGATTTATTTCAGACTTCCTTGCTTTTTTGGTTCTCTACAATTTCATCATTCCAATTTCATTATATGTGACAGTCGAAATGC
AGAAATTTCTTGGATCATTTTTTATTGGCTGGGATCTTGATCTGTATCATGAAGAATCAGATCAGAAAGCTCAAGTCAATACTTCCGATC
TGAATGAAGAGCTTGGACAGGTAGAGTACGTGTTTACAGATAAAACTGGTACACTGACAGAAAATGAGATGCAGTTTCGGGAATGTTCAA
TTAATGGCATGAAATACCAAGAAATTAATGGTAGACTTGTACCCGAAGGACCAACACCAGACTCTTCAGAAGGAAACTTATCTTATCTTA
GTAGTTTATCCCATCTTAACAACTTATCCCATCTTACAACCAGTTCCTCTTTCAGAACCAGTCCTGAAAATGAAACTGAACTAATTAAAG
AACATGATCTCTTCTTTAAAGCAGTCAGTCTCTGTCACACTGTACAGATTAGCAATGTTCAAACTGACTGCACTGGTGATGGTCCCTGGC
AATCCAACCTGGCACCATCGCAGTTGGAGTACTATGCATCTTCACCAGATGAAAAGGCTCTAGTAGAAGCTGCTGCAAGGATTGGTATTG
TGTTTATTGGCAATTCTGAAGAAACTATGGAGGTTAAAACTCTTGGAAAACTGGAACGGTACAAACTGCTTCATATTCTGGAATTTGATT
CAGATCGTAGGAGAATGAGTGTAATTGTTCAGGCACCTTCAGGTGAGAAGTTATTATTTGCTAAAGGAGCTGAGTCATCAATTCTCCCTA
AATGTATAGGTGGAGAAATAGAAAAAACCAGAATTCATGTAGATGAATTTGCTTTGGTGAAGCATCCGGTTACTGGGCAATTTCTATATC
AGGACAGCAACTGGGCCAGCAAAGTTGAGAAACTCACTTTAGACAATGCTGCTTTCCCTTTCCTTGCATATTCTGGAATCCCAGCAGTTT
CTTTCTGTTTTTGCGAGGACACAGATTATCCTTATTTGGGTACCACCATGGACACCTATAAGGAACTGATTGAGAGGATTCCTGAGTTGA
ACAAAGTGGCACGAGCAGCTGCAGAGGTCGCTGGTCAGTTCGTGATTAAACTAACCCATGATGTTGAATTGAACCTGGACTATGAGAGGT
ACAACAGCCAACTGCTTTCATTTGTGAGGGATCTGAACCAATACAGAGCAGACATAAAGGAAATGGGCCTGAGTTTACAGTGGCTGTATT
CTGCTCGTGGAGACTTCTTCCGTGCTACTTCCAGACTAACAACAGATTTCGGGAATGCTGAGAAAACAGACAGATTTGTCATGAAGAAAC
TCAATGATCGTGTCATGAGAGTGGAGTATCACTTCCTCTCTCCCTACGTATCTCCAAAAGAGTCTCCTTTCCGACATGTCTTCTGGGGCT
CCGGCTCTCACACGCTGCCAGCTTTACTGGAGAACTTGAAACTGCGTAAACAAAATAACGGTGCTTTTAATGAAACGCTGTTCAGAAACC
AGTTGGCTCTAGCTACTTGGACTATTCAGGGAGCTGCAAATGCCCTCTCTGGTGACGTTTGGGACATTGACAATGAGTTTTAAATGTGAT
ACCCATAGCTTCCATGAGAACAGCAGGGTAGTCTGGTTTCTAGACTTGTGCTGATCGTGCTAAATTTTCAGTAGGGCTACAAAACCTGAT
GTTAAAATTCCATCCCATCATCTTGGTACTACTAGATGTCTTTAGGCAGCAGCTTTTAATACAGGGTAGATAACCTGTACTTCAAGTTAA
AGTGAATAACCACTTAAAAAATGTCCATGATGGAATATTCCCCTATCTCTAGAATTTTAAGTGCTTTGTAATGGGAACTGCCTCTTTCCT
GTTGTTGTTAATGAAAATGTCAGAAACCAGTTATGTGAATGATCTCTCTGAATCCTAAGGGCTGGTCTCTGCTGAAGGTTGTAAGTGGTC
GCTTACTTTGAGTGATCCTCCAACTTCATTTGATGCTAAATAGGAGATACCAGGTTGAAAGACCTTCTCCAAATGAGATCTAAGCCTTTC
CATAAGGAATGTAGCTGGTTTCCTCATTCCTGAAAGAAACAGTTAACTTTCAGAAGAGATGGGCTTGTTTTCTTGCCAATGAGGTCTGAA
ATGGAGGTCCTTCTGCTGGATAAAATGAGGTTCAACTGTTGATTGCAGGAATAAGGCCTTAATATGTTAACCTCAGTGTCATTTATGAAA
AGAGGGGACCAGAAGCCAAAGACTTAGTATATTTTCTTTTCCTCTGTCCCTTCCCCCATAAGCCTCCATTTAGTTCTTTGTTATTTTTGT
TTCTTCCAAAGCACATTGAAAGAGAACCAGTTTCAGGTGTTTAGTTGCAGACTCAGTTTGTCAGACTTTAAAGAATAATATGCTGCCAAA
TTTTGGCCAAAGTGTTAATCTTAGGGGAGAGCTTTCTGTCCTTTTGGCACTGAGATATTTATTGTTTATTTATCAGTGACAGAGTTCACT
ATAAATGGTGTTTTTTTAATAGAATATAATTATCGGAAGCAGTGCCTTCCATAATTATGACAGTTATACTGTCGGTTTTTTTTAAATAAA
AGCAGCATCTGCTAATAAAACCCAACAGATACTGGAAGTTTTGCATTTATGGTCAACACTTAAGGGTTTTAGAAAACAGCCGTCAGCCAA
ATGTAATTGAATAAAGTTGAAGCTAAGATTTAGAGATGAATTAAATTTAATTAGGGGTTGCTAAGAAGCGAGCACTGACCAGATAAGAAT
GCTGGTTTTCCTAAATGCAGTGAATTGTGACCAAGTTATAAATCAATGTCACTTAAAGGCTGTGGTAGTACTCCTGCAAAATTTTATAGC
TCAGTTTATCCAAGGTGTAACTCTAATTCCCATTTTGCAAAATTTCCAGTACCTTTGTCACAATCCTAACACATTATCGGGAGCAGTGTC
TTCCATAATGTATAAAGAACAAGGTAGTTTTTACCTACCACAGTGTCTGTATCGGAGACAGTGATCTCCATATGTTACACTAAGGGTGTA
AGTAATTATCGGGAACAGTGTTTCCCATAATTTTCTTCATGCAATGACATCTTCAAAGCTTGAAGATCGTTAGTATCTAACATGTATCCC
AACTCCTATAATTCCCTATCTTTTAGTTTTAGTTGCAGAAACATTTTGTGGTCATTAAGCATTGGGTGGGTAAATTCAACCACTGTAAAA
TGAAATTACTACAAAATTTGAAATTTAGCTTGGGTTTTTGTTACCTTTATGGTTTCTCCAGGTCCTCTACTTAATGAGATAGTAGCATAC
ATTTATAATGTTTGCTATTGACAAGTCATTTTAACTTTATCACATTATTTGCATGTTACCTCCTATAAACTTAGTGCGGACAAGTTTTAA
TCCAGAATTGACCTTTTGACTTAAAGCAGAGGGACTTTGTATAGAAGGTTTGGGGGCTGTGGGGAAGGAGAGTCCCCTGAAGGTCTGACA
CGTCTGCCTACCCATTCGTGGTGATCAATTAAATGTAGGTATGAATAAGTTCGAAGCTCCGTGAGTGAACCATCATTATAAACGTGATGA
TCAGCTGTTTGTCATAGGGCAGTTGGAAACGGCCTCCTAGGGAAAAGTTCATAGGGTCTCTTCAGGTTCTTAGTGTCACTTACCTAGATT
TACAGCCTCACTTGAATGTGTCACTACTCACAGTCTCTTTAATCTTCAGTTTTATCTTTAATCTCCTCTTTTATCTTGGACTGACATTTA
GCGTAGCTAAGTGAAAAGGTCATAGCTGAGATTCCTGGTTCGGGTGTTACGCACACGTACTTAAATGAAAGCATGTGGCATGTTCATCGT
ATAACACAATATGAATACAGGGCATGCATTTTGCAGCAGTGAGTCTCTTCAGAAAACCCTTTTCTACAGTTAGGGTTGAGTTACTTCCTA
TCAAGCCAGTACGTGCTAACAGGCTCAATATTCCTGAATGAAATATCAGACTAGTGACAAGCTCCTGGTCTTGAGATGTCTTCTCGTTAA
GGAGATGGGCCTTTTGGAGGTAAAGGATAAAATGAATGAGTTCTGTCATGATTCACTATTCTAGAACTTGCATGACCTTTACTGTGTTAG
CTCTTTGAATGTTCTTGAAATTTTAGACTTTCTTTGTAAACAAATGATATGTCCTTATCATTGTATAAAAGCTGTTATGTGCAACAGTGT


Top

FusionGenePPI for ATP11B_TFRC


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP11BTMEM30A, IFNA21TFRCHFE, GABARAP, TFRC, TF, SVIP, PXK, RYK, BST2, HDAC5, LAPTM4A, LAPTM4B, OPTN, RAB8A, HGS, PARK2, SH3BP4, KCNA3, KCNA5, FBXO6, ATP6V1B1, ESR1, B4GALT1, FN1, VCAM1, ATF2, ITGA4, MYO1G, MARCH1, MARCH8, CLN3, ADRB2, RPA1, RPA2, RPA3, ASB4, LGR4, RANBP9, TP53, HUWE1, CAV1, SGTA, MDM2, CUL7, RNF2, EGFR, ZFP36, DLK1, NTRK1, TCTN3, RPGRIP1L, POC5, TMEM17, TMEM216, AHSA1, ERBB2, GJB2, PDGFRA, RAB5C, RAB7A, ATP6AP2, GOLT1B, ARFGAP1, AP2B1, SENP3, ESRRB, CDC73, COX15, PDHA1, TRIM25, LMNA, BRCA1, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP11B_TFRC


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneTFRCP02786DB01592IronTransferrin receptor protein 1small moleculeapproved

Top

RelatedDiseases for ATP11B_TFRC


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneTFRCC0162316Iron deficiency anemia3CTD_human
TgeneTFRCC0012715Iron Metabolism Disorders2CTD_human
TgeneTFRCC0028754Obesity2CTD_human
TgeneTFRCC0079487Helicobacter Infections2CTD_human
TgeneTFRCC1458155Mammary Neoplasms2CTD_human
TgeneTFRCC0000786Spontaneous abortion1CTD_human
TgeneTFRCC0003756Arenaviridae Infections1CTD_human
TgeneTFRCC0005283beta Thalassemia1CTD_human
TgeneTFRCC0005695Bladder Neoplasm1CTD_human
TgeneTFRCC0007621Neoplastic Cell Transformation1CTD_human
TgeneTFRCC0009404Colorectal Neoplasms1CTD_human
TgeneTFRCC0017638Glioma1CTD_human
TgeneTFRCC0021368Inflammation1CTD_human
TgeneTFRCC0023434Chronic Lymphocytic Leukemia1CTD_human
TgeneTFRCC0024121Lung Neoplasms1CTD_human
TgeneTFRCC0024305Lymphoma, Non-Hodgkin1CTD_human
TgeneTFRCC0027055Myocardial Reperfusion Injury1CTD_human
TgeneTFRCC0032460Polycystic Ovary Syndrome1CTD_human
TgeneTFRCC0085110Severe Combined Immunodeficiency1CTD_human
TgeneTFRCC0151744Myocardial Ischemia1CTD_human
TgeneTFRCC4225219IMMUNODEFICIENCY 461ORPHANET;UNIPROT