FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3261

FusionGeneSummary for ATP11A_MCF2L

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP11A_MCF2L
Fusion gene ID: 3261
HgeneTgene
Gene symbol

ATP11A

MCF2L

Gene ID

23250

23263

Gene nameATPase phospholipid transporting 11AMCF.2 cell line derived transforming sequence like
SynonymsATPIH|ATPISARHGEF14|DBS|OST
Cytomap

13q34

13q34

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IHATPase, class VI, type 11AP4-ATPase flippase complex alpha subunit ATP11Aphospholipid-translocating ATPasepotential phospholipid-transporting ATPase IHguanine nucleotide exchange factor DBSDBL's big sisterMCF2 transforming sequence-like protein
Modification date2018052320180519
UniProtAcc

P98196

O15068

Ensembl transtripts involved in fusion geneENST00000283558, ENST00000375630, 
ENST00000487903, ENST00000375645, 
ENST00000419448, 
ENST00000375608, 
ENST00000442652, ENST00000375604, 
ENST00000397030, ENST00000535094, 
ENST00000421756, ENST00000375601, 
ENST00000397036, ENST00000434480, 
ENST00000423482, ENST00000375597, 
ENST00000397024, ENST00000480321, 
ENST00000397021, 
Fusion gene scores* DoF score12 X 9 X 11=11884 X 7 X 4=112
# samples 206
** MAII scorelog2(20/1188*10)=-2.57046293102604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/112*10)=-0.900464326449086
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ATP11A [Title/Abstract] AND MCF2L [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A2-A3XT-01AATP11Achr13

113344769

+MCF2Lchr13

113728758

+
TCGALDLUADTCGA-05-4249-01AATP11Achr13

113344769

+MCF2Lchr13

113556513

+
TCGALDLUADTCGA-69-7979-01AATP11Achr13

113516885

+MCF2Lchr13

113556509

+
TCGALDLUADTCGA-95-7567-01AATP11Achr13

113344769

+MCF2Lchr13

113669077

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283558ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000283558ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000283558ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375630ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375630ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000487903ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000487903ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
In-frameENST00000375645ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-intronENST00000375645ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-3CDSENST00000419448ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
intron-intronENST00000419448ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113728758

+
5CDS-5UTRENST00000283558ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000283558ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000283558ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000375630ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000375630ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375630ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000487903ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000487903ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000487903ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000375645ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000375645ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-intronENST00000375645ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-5UTRENST00000419448ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-5UTRENST00000419448ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
intron-intronENST00000419448ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113556513

+
5CDS-5UTRENST00000283558ENST00000375608ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000283558ENST00000442652ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000375604ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000397030ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000535094ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000421756ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000375601ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000397036ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000434480ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000423482ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000375597ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000397024ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000480321ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000283558ENST00000397021ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000375630ENST00000375608ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000375630ENST00000442652ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000375604ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000397030ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000535094ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000421756ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000375601ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000397036ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000434480ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000423482ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000375597ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000397024ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000480321ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375630ENST00000397021ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000487903ENST00000375608ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000487903ENST00000442652ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000375604ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000397030ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000535094ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000421756ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000375601ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000397036ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000434480ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000423482ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000375597ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000397024ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000480321ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000487903ENST00000397021ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000375645ENST00000375608ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-5UTRENST00000375645ENST00000442652ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000375604ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000397030ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000535094ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000421756ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000375601ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000397036ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000434480ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000423482ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000375597ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000397024ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000480321ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
5CDS-intronENST00000375645ENST00000397021ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-5UTRENST00000419448ENST00000375608ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-5UTRENST00000419448ENST00000442652ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000375604ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000397030ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000535094ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000421756ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000375601ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000397036ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000434480ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000423482ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000375597ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000397024ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000480321ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
intron-intronENST00000419448ENST00000397021ATP11Achr13

113516885

+MCF2Lchr13

113556509

+
Frame-shitENST00000283558ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000283558ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000283558ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375630ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375630ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000487903ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000487903ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
Frame-shitENST00000375645ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
5CDS-intronENST00000375645ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000375608ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000442652ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000375604ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000397030ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000535094ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000421756ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-3CDSENST00000419448ENST00000375601ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000397036ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000434480ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000423482ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000375597ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000397024ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000480321ATP11Achr13

113344769

+MCF2Lchr13

113669077

+
intron-intronENST00000419448ENST00000397021ATP11Achr13

113344769

+MCF2Lchr13

113669077

+

Top

FusionProtFeatures for ATP11A_MCF2L


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP11A

P98196

MCF2L

O15068

Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). May be involved in the uptake offarnesyltransferase inhibitor drugs, such as lonafarnib.{ECO:0000269|PubMed:15860663, ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+827503_529330985Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+930503_5293621138Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+828503_5293651097Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+828503_5293361068Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+830503_5293301124Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+829503_5293381114Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+829503_5293621138Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+830503_5293321126Coiled coilOntology_term=ECO:0000255
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+8271055_1116330985DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+827631_811330985DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+827829_945330985DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+9301055_11163621138DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+930631_8113621138DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+930829_9453621138DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+8281055_11163651097DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+828631_8113651097DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+828829_9453651097DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+8281055_11163361068DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+828631_8113361068DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+828829_9453361068DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+8301055_11163301124DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+830631_8113301124DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+830829_9453301124DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+8291055_11163381114DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+829631_8113381114DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+829829_9453381114DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+8291055_11163621138DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+829631_8113621138DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+829829_9453621138DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+8301055_11163321126DomainSH3
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+830631_8113321126DomainDH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+830829_9453321126DomainPH
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+827351_456330985RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+828351_4563361068RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+830351_4563301124RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+829351_4563381114RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+830351_4563321126RepeatNote=Spectrin

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291024_1029131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291051_1068131135Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291094_1134131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129111_296131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291_61131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129319_349131135Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129373_881131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+12983_88131135Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129903_914131135Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129935_964131135Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129987_1000131135Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301024_1029132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301051_1068132857Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301094_1134132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130111_296132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301_61132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130319_349132857Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130373_881132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+13083_88132857Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130903_914132857Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130935_964132857Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130987_1000132857Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301024_1029132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301051_1068132878Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301094_1134132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130111_296132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301_61132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130319_349132878Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130373_881132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+13083_88132878Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130903_914132878Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130935_964132878Topological domainCytoplasmic
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130987_1000132878Topological domainExtracellular
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291001_1023131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291030_1050131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+1291069_1093131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129297_318131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129350_372131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+12962_82131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129882_902131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+12989_110131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129915_934131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000283558+129965_986131135TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301001_1023132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301030_1050132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+1301069_1093132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130297_318132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130350_372132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+13062_82132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130882_902132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+13089_110132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130915_934132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000375645+130965_986132857TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301001_1023132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301030_1050132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+1301069_1093132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130297_318132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130350_372132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+13062_82132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130882_902132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+13089_110132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130915_934132878TransmembraneHelical
HgeneATP11Achr13:113344769chr13:113728758ENST00000487903+130965_986132878TransmembraneHelical
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375597+82752_224330985DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+93052_2243621138DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+82852_2243651097DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000421756+82852_2243361068DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000423482+83052_2243301124DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000434480+82952_2243381114DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+82952_2243621138DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000535094+83052_2243321126DomainCRAL-TRIO
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000375608+930351_4563621138RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000397030+828351_4563651097RepeatNote=Spectrin
TgeneMCF2Lchr13:113344769chr13:113728758ENST00000442652+829351_4563621138RepeatNote=Spectrin


Top

FusionGeneSequence for ATP11A_MCF2L


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_789aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_745aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_807aa
MDCSLVRTLVHRYVKAILDAASQKIATFTDIGNSLAHVEHLLRDLASFEEKSGVAVERARALSLDGEQLIGNKHYAVDSIRPKCQELRHL
CDQFSAEIARRRGLLSKSLELHRRLETSMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNAIYKEYESILNQDL
MEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQPVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRG
SAGEEEESLAILRRHVMSELLDTERAYVEELLCVLEGYAAEMDNPLMAHLLSTGLHNKKDVLFGNMEEITHFHNRIFLRELENYTDCPEL
VGRCFLERMEDFQITEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSRNCEGAEDLQEALS
SILGILKAVNDSMHLIAITGTDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHEKAVLFCKKREENGEGTEKAPSYS
YKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQAPTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRG
NSRNIKKLEERKTDPLSLEGYVSSAPLTKPPEKGKGWSKTSHSLEAPEDDGGWSSAEEQINSSDAEEDGGLGPKKLVPGKYTVVADHEKG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2367nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2235nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_2421nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGAC
ATCGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGG
GCCCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTC
TGTGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAG
TGGTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATC
GAGAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTC
ATGGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCC
AGGCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCT
GAGAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGC
TCAGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAG
CTGCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGAT
GTTTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTG
GTTGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGA
CAGTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAG
AGGATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGC
TCCATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAG
CTGCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAG
CGGCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGC
TACAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGC
GAGGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAG
GCTTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGA
AACTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCC
CCCGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATT
AACTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGA
GGCCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACC
ACTGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2631nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC
CCACGTGCCCCGAGCCCACCCGTGACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCC
GTCCCCGCCTGATCTCCCCGCAGAGTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTT

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2455nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_5575nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTAAGACCCCGCGCTCAGCCC
CGGACTGCCCCGCACGTGGCTGCCGCTGACCCTCGCCCCTTGCAGGTACGTCAGGGACCCGACCACTGGCAAGGAGGGCTGGGTGCCGGC
CAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGCCCACGTGCCCCGAGCCCACCCGTG
ACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCCGTCCCCGCCTGATCTCCCCGCAGA
GTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGG
CCTCGGCGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCAC
CGCCCCCACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGG
CTTCCCCGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCT
CCACCGTGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGG
CCAACGGCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATT
TTTTGTGGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATT
TTTTTGTTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCC
TGAAGCTCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGA
GATTCCTTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAG
GGACTTGATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGG
CGTGGACCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCAC
TCCCCACGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTAT
TCAAGTCACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCC
TTTCGGTGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCT
GTCCCCGTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGC
TACCCTCCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCT
CTGATGTGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGC
TGCGCGCCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATG
GAATTTTAAAAGCAGAGTTCTTTATTGTATGGATGACGTTTGAATAAATATCAGCAACTCCTGCCATCTGCCTTTGTCTGTCAAGACACA
GAACGTCTCAGCAGTCGGGGTTTCCAGGGCCGCAGTGCACTGTGCTTGCACATGGTAAGTCATTGTTGGGACGGAAAAGAAGCCGGCAGT
GGGCAGGGCCCAGCGTGCGGCTCAGGCACCGAGCAACCGCTTTGCTTTCTTCTGTCAGACGGCGATGATGACAAAATAGCAACAAGGTTG
TGCGTGTCAGAAACGCAAAGGCAGCAGAGGAAGCGTAGTGGAACCATTACAGAATCACAATGCAGCCGACACTCTCCAGACCAGAAAAGG
GAGCATAAAGAAAGGGTATTGATCCAATAGAAGAAGGGAAGGGTGGAGAAAGGGGAAAGCATGGTTAACAGGAAACAACATGTAACGGAA
GAGACAGCCCAGATGTGTCTGGCTCACAACAGACGTGATCATGTTATGCTGGCCTGGAAGAGCATCGGATCAGACGTGACAAGTCACTGC
TTAGAGACCATCAAGCAAATTTATATATAGATTGGAGATTTAAAATAAAAGAAGACAGAACAGACAAACACCATAAGAAAGCTGGTGTAG
CAGTATCGATGACCTGAAATGGGATTCAGGACAGTTCATAGAGTAAAGGGGGCTGCGTGGCAATCAGGAACTCATAAGCCACTGACTATA
AAGCTCAAAACACAGCAAAGTTGGCAGTCGGCAGACAGCAATGTTGACTGTCATGAAAAGTGATCCCTGTTTGCCCCTAAACGTAGAGAA
ATCTGCGTTATTTTCCAGCACACATGGAGCACAAACAAAATATTTGCAAAACAATGGGAAGATCATTGAAACACTGTTTGGCAATTTAAA
AGCTTGTTTCTAACTCACGGGATGCGGGCAGTCTGCTCTCTAGAACTGGACAGCGTGCACAGAGCCACGGGAGGGAGCAGCCACGGCCAG
CTCAGATTGGTGTCGACAGCTTAGTGGTGTCTGATTTTATACATGACAAAATGAACGAGTTAACCATTTAAGCCAAAAAAATAAGACTAG
CGTAACCCAAAGAAAGTATTTAAATACTTCTGTCAATTAGGACAGTTGAGAAAAGAGAATAACAAAATCAAAAGCAAAACTCAAACTTTG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2724nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2323nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG

>In-frame_ATP11A_ENST00000283558_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2631nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC
CCACGTGCCCCGAGCCCACCCGTGACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCC
GTCCCCGCCTGATCTCCCCGCAGAGTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTT

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2455nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_5575nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTAAGACCCCGCGCTCAGCCC
CGGACTGCCCCGCACGTGGCTGCCGCTGACCCTCGCCCCTTGCAGGTACGTCAGGGACCCGACCACTGGCAAGGAGGGCTGGGTGCCGGC
CAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGCCCACGTGCCCCGAGCCCACCCGTG
ACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCCGTCCCCGCCTGATCTCCCCGCAGA
GTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGG
CCTCGGCGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCAC
CGCCCCCACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGG
CTTCCCCGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCT
CCACCGTGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGG
CCAACGGCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATT
TTTTGTGGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATT
TTTTTGTTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCC
TGAAGCTCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGA
GATTCCTTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAG
GGACTTGATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGG
CGTGGACCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCAC
TCCCCACGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTAT
TCAAGTCACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCC
TTTCGGTGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCT
GTCCCCGTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGC
TACCCTCCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCT
CTGATGTGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGC
TGCGCGCCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATG
GAATTTTAAAAGCAGAGTTCTTTATTGTATGGATGACGTTTGAATAAATATCAGCAACTCCTGCCATCTGCCTTTGTCTGTCAAGACACA
GAACGTCTCAGCAGTCGGGGTTTCCAGGGCCGCAGTGCACTGTGCTTGCACATGGTAAGTCATTGTTGGGACGGAAAAGAAGCCGGCAGT
GGGCAGGGCCCAGCGTGCGGCTCAGGCACCGAGCAACCGCTTTGCTTTCTTCTGTCAGACGGCGATGATGACAAAATAGCAACAAGGTTG
TGCGTGTCAGAAACGCAAAGGCAGCAGAGGAAGCGTAGTGGAACCATTACAGAATCACAATGCAGCCGACACTCTCCAGACCAGAAAAGG
GAGCATAAAGAAAGGGTATTGATCCAATAGAAGAAGGGAAGGGTGGAGAAAGGGGAAAGCATGGTTAACAGGAAACAACATGTAACGGAA
GAGACAGCCCAGATGTGTCTGGCTCACAACAGACGTGATCATGTTATGCTGGCCTGGAAGAGCATCGGATCAGACGTGACAAGTCACTGC
TTAGAGACCATCAAGCAAATTTATATATAGATTGGAGATTTAAAATAAAAGAAGACAGAACAGACAAACACCATAAGAAAGCTGGTGTAG
CAGTATCGATGACCTGAAATGGGATTCAGGACAGTTCATAGAGTAAAGGGGGCTGCGTGGCAATCAGGAACTCATAAGCCACTGACTATA
AAGCTCAAAACACAGCAAAGTTGGCAGTCGGCAGACAGCAATGTTGACTGTCATGAAAAGTGATCCCTGTTTGCCCCTAAACGTAGAGAA
ATCTGCGTTATTTTCCAGCACACATGGAGCACAAACAAAATATTTGCAAAACAATGGGAAGATCATTGAAACACTGTTTGGCAATTTAAA
AGCTTGTTTCTAACTCACGGGATGCGGGCAGTCTGCTCTCTAGAACTGGACAGCGTGCACAGAGCCACGGGAGGGAGCAGCCACGGCCAG
CTCAGATTGGTGTCGACAGCTTAGTGGTGTCTGATTTTATACATGACAAAATGAACGAGTTAACCATTTAAGCCAAAAAAATAAGACTAG
CGTAACCCAAAGAAAGTATTTAAATACTTCTGTCAATTAGGACAGTTGAGAAAAGAGAATAACAAAATCAAAAGCAAAACTCAAACTTTG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2724nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2323nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG

>In-frame_ATP11A_ENST00000375630_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2631nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC
CCACGTGCCCCGAGCCCACCCGTGACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCC
GTCCCCGCCTGATCTCCCCGCAGAGTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTT

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2455nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_5575nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTAAGACCCCGCGCTCAGCCC
CGGACTGCCCCGCACGTGGCTGCCGCTGACCCTCGCCCCTTGCAGGTACGTCAGGGACCCGACCACTGGCAAGGAGGGCTGGGTGCCGGC
CAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGCCCACGTGCCCCGAGCCCACCCGTG
ACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCCGTCCCCGCCTGATCTCCCCGCAGA
GTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGG
CCTCGGCGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCAC
CGCCCCCACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGG
CTTCCCCGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCT
CCACCGTGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGG
CCAACGGCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATT
TTTTGTGGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATT
TTTTTGTTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCC
TGAAGCTCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGA
GATTCCTTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAG
GGACTTGATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGG
CGTGGACCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCAC
TCCCCACGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTAT
TCAAGTCACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCC
TTTCGGTGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCT
GTCCCCGTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGC
TACCCTCCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCT
CTGATGTGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGC
TGCGCGCCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATG
GAATTTTAAAAGCAGAGTTCTTTATTGTATGGATGACGTTTGAATAAATATCAGCAACTCCTGCCATCTGCCTTTGTCTGTCAAGACACA
GAACGTCTCAGCAGTCGGGGTTTCCAGGGCCGCAGTGCACTGTGCTTGCACATGGTAAGTCATTGTTGGGACGGAAAAGAAGCCGGCAGT
GGGCAGGGCCCAGCGTGCGGCTCAGGCACCGAGCAACCGCTTTGCTTTCTTCTGTCAGACGGCGATGATGACAAAATAGCAACAAGGTTG
TGCGTGTCAGAAACGCAAAGGCAGCAGAGGAAGCGTAGTGGAACCATTACAGAATCACAATGCAGCCGACACTCTCCAGACCAGAAAAGG
GAGCATAAAGAAAGGGTATTGATCCAATAGAAGAAGGGAAGGGTGGAGAAAGGGGAAAGCATGGTTAACAGGAAACAACATGTAACGGAA
GAGACAGCCCAGATGTGTCTGGCTCACAACAGACGTGATCATGTTATGCTGGCCTGGAAGAGCATCGGATCAGACGTGACAAGTCACTGC
TTAGAGACCATCAAGCAAATTTATATATAGATTGGAGATTTAAAATAAAAGAAGACAGAACAGACAAACACCATAAGAAAGCTGGTGTAG
CAGTATCGATGACCTGAAATGGGATTCAGGACAGTTCATAGAGTAAAGGGGGCTGCGTGGCAATCAGGAACTCATAAGCCACTGACTATA
AAGCTCAAAACACAGCAAAGTTGGCAGTCGGCAGACAGCAATGTTGACTGTCATGAAAAGTGATCCCTGTTTGCCCCTAAACGTAGAGAA
ATCTGCGTTATTTTCCAGCACACATGGAGCACAAACAAAATATTTGCAAAACAATGGGAAGATCATTGAAACACTGTTTGGCAATTTAAA
AGCTTGTTTCTAACTCACGGGATGCGGGCAGTCTGCTCTCTAGAACTGGACAGCGTGCACAGAGCCACGGGAGGGAGCAGCCACGGCCAG
CTCAGATTGGTGTCGACAGCTTAGTGGTGTCTGATTTTATACATGACAAAATGAACGAGTTAACCATTTAAGCCAAAAAAATAAGACTAG
CGTAACCCAAAGAAAGTATTTAAATACTTCTGTCAATTAGGACAGTTGAGAAAAGAGAATAACAAAATCAAAAGCAAAACTCAAACTTTG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2724nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2323nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG

>In-frame_ATP11A_ENST00000487903_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375608_chr13_113728758_+_2631nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC
CCACGTGCCCCGAGCCCACCCGTGACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCC
GTCCCCGCCTGATCTCCCCGCAGAGTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTT

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000442652_chr13_113728758_+_2455nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGC

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375604_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000397030_chr13_113728758_+_5575nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTAAGACCCCGCGCTCAGCCC
CGGACTGCCCCGCACGTGGCTGCCGCTGACCCTCGCCCCTTGCAGGTACGTCAGGGACCCGACCACTGGCAAGGAGGGCTGGGTGCCGGC
CAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGGTAAGGCCCACGTGCCCCGAGCCCACCCGTG
ACGCTGCCAAGGGCCCGGGCGAGGAAGCTGCCCCGTGTGTGCCCGGCAGAGCCGACGCCGAAGCCCGTCCCCGCCTGATCTCCCCGCAGA
GTCGAGCCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGG
CCTCGGCGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCAC
CGCCCCCACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGG
CTTCCCCGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCT
CCACCGTGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGG
CCAACGGCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATT
TTTTGTGGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATT
TTTTTGTTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCC
TGAAGCTCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGA
GATTCCTTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAG
GGACTTGATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGG
CGTGGACCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCAC
TCCCCACGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTAT
TCAAGTCACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCC
TTTCGGTGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCT
GTCCCCGTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGC
TACCCTCCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCT
CTGATGTGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGC
TGCGCGCCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATG
GAATTTTAAAAGCAGAGTTCTTTATTGTATGGATGACGTTTGAATAAATATCAGCAACTCCTGCCATCTGCCTTTGTCTGTCAAGACACA
GAACGTCTCAGCAGTCGGGGTTTCCAGGGCCGCAGTGCACTGTGCTTGCACATGGTAAGTCATTGTTGGGACGGAAAAGAAGCCGGCAGT
GGGCAGGGCCCAGCGTGCGGCTCAGGCACCGAGCAACCGCTTTGCTTTCTTCTGTCAGACGGCGATGATGACAAAATAGCAACAAGGTTG
TGCGTGTCAGAAACGCAAAGGCAGCAGAGGAAGCGTAGTGGAACCATTACAGAATCACAATGCAGCCGACACTCTCCAGACCAGAAAAGG
GAGCATAAAGAAAGGGTATTGATCCAATAGAAGAAGGGAAGGGTGGAGAAAGGGGAAAGCATGGTTAACAGGAAACAACATGTAACGGAA
GAGACAGCCCAGATGTGTCTGGCTCACAACAGACGTGATCATGTTATGCTGGCCTGGAAGAGCATCGGATCAGACGTGACAAGTCACTGC
TTAGAGACCATCAAGCAAATTTATATATAGATTGGAGATTTAAAATAAAAGAAGACAGAACAGACAAACACCATAAGAAAGCTGGTGTAG
CAGTATCGATGACCTGAAATGGGATTCAGGACAGTTCATAGAGTAAAGGGGGCTGCGTGGCAATCAGGAACTCATAAGCCACTGACTATA
AAGCTCAAAACACAGCAAAGTTGGCAGTCGGCAGACAGCAATGTTGACTGTCATGAAAAGTGATCCCTGTTTGCCCCTAAACGTAGAGAA
ATCTGCGTTATTTTCCAGCACACATGGAGCACAAACAAAATATTTGCAAAACAATGGGAAGATCATTGAAACACTGTTTGGCAATTTAAA
AGCTTGTTTCTAACTCACGGGATGCGGGCAGTCTGCTCTCTAGAACTGGACAGCGTGCACAGAGCCACGGGAGGGAGCAGCCACGGCCAG
CTCAGATTGGTGTCGACAGCTTAGTGGTGTCTGATTTTATACATGACAAAATGAACGAGTTAACCATTTAAGCCAAAAAAATAAGACTAG
CGTAACCCAAAGAAAGTATTTAAATACTTCTGTCAATTAGGACAGTTGAGAAAAGAGAATAACAAAATCAAAAGCAAAACTCAAACTTTG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000535094_chr13_113728758_+_2724nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000421756_chr13_113728758_+_2323nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG

>In-frame_ATP11A_ENST00000375645_chr13_113344769_+_MCF2L_ENST00000375601_chr13_113728758_+_4198nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACGTCAAAGCCATCTTGGACGCAGCGTCCCAGAAGATAGCAACCTTCACAGACAT
CGGCAACAGCCTGGCGCATGTGGAGCACCTGCTGAGGGACCTGGCCAGCTTCGAGGAGAAATCAGGCGTGGCCGTGGAGAGGGCCCGGGC
CCTGTCTCTGGACGGCGAGCAGCTCATTGGGAACAAGCACTACGCGGTAGACTCCATCCGCCCAAAGTGCCAGGAGCTCCGGCACCTCTG
TGACCAGTTCTCTGCGGAGATCGCAAGGAGGAGGGGGCTGCTCAGCAAGTCCCTGGAGCTGCACCGCCGCCTGGAGACGTCCATGAAGTG
GTGTGATGAAGGGATTTACCTGCTGGCCTCACAACCTGTGGACAAGTGCCAGTCCCAGGACGGCGCGGAGGCTGCCCTCCAGGAAATCGA
GAAGTTTTTGGAGACCGGTGCGGAAAATAAGATCCAGGAGCTCAACGCGATTTACAAGGAATACGAATCCATCCTCAACCAAGATCTCAT
GGAGCACGTGCGAAAGGTCTTCCAGAAGCAGGCAAGCATGGAGGAGGTGTTCCACCGCAGGCAGGCCAGCCTGAAGAAGCTGGCGGCCAG
GCAGACGCGGCCCGTGCAGCCGGTGGCCCCCAGACCCGAGGCACTGGCAAAGTCGCCCTGCCCCTCCCCAGGCATTCGGCGAGGCTCTGA
GAACTCCAGCTCCGAGGGCGGTGCGCTCCGGAGAGGGCCCTACCGGAGGGCCAAGAGTGAGATGAGTGAGAGCCGGCAGGGCCGCGGCTC
AGCGGGGGAGGAGGAGGAAAGCCTGGCCATCCTGCGCAGGCACGTGATGAGCGAGCTCCTGGACACAGAACGGGCCTACGTGGAGGAGCT
GCTGTGCGTCCTGGAGGGCTACGCCGCGGAGATGGATAACCCACTGATGGCTCACCTCCTGTCAACAGGCCTTCACAACAAGAAGGATGT
TTTGTTTGGAAACATGGAGGAAATCTATCACTTCCACAACAGGATATTCCTCAGGGAGCTGGAAAACTACACTGACTGCCCAGAACTGGT
TGGAAGATGCTTTCTGGAGAGGATGGAAGATTTCCAGATCTATGAGAAGTACTGTCAGAACAAGCCCCGCTCTGAGAGCCTGTGGAGACA
GTGCTCCGACTGCCCGTTTTTCCAGGAATGCCAGAGAAAGCTGGACCACAAGCTGAGCCTGGACTCCTACCTGCTGAAGCCAGTGCAGAG
GATCACCAAGTACCAGCTGCTGCTCAAGGAAATGCTGAAATACAGCAGGAACTGCGAGGGGGCTGAGGACCTGCAGGAGGCGCTGAGCTC
CATCCTGGGCATCCTGAAGGCCGTGAACGACTCCATGCACCTCATCGCTATCACCGGCTATGACGGGAATCTCGGCGACCTGGGCAAGCT
GCTGATGCAGGGCTCGTTCAGCGTCTGGACCGACCACAAGAGGGGCCACACCAAGGTGAAGGAGCTGGCCAGGTTCAAGCCCATGCAGCG
GCACCTGTTCCTGCACGAGAAGGCAGTGCTCTTCTGCAAGAAGAGGGAGGAGAATGGGGAGGGGTATGAGAAAGCTCCCTCCTACAGCTA
CAAGCAGTCCTTAAACATGGCTGCCGTTGGCATTACGGAGAACGTGAAGGGAGATGCTAAGAAGTTCGAGATCTGGTACAACGCGCGCGA
GGAGGTCTACATCGTCCAGGCGCCAACTCCTGAGATTAAAGCCGCGTGGGTGAATGAAATTCGGAAAGTGCTGACCAGCCAGCTGCAGGC
TTGTAGAGAAGCCAGCCAGCACCGGGCGCTGGAGCAGTCACAGAGCCTGCCCCTGCCGGCCCCGACCAGCACCAGTCCCTCAAGAGGAAA
CTCAAGGAACATCAAGAAGCTGGAAGAAAGGAAAACAGACCCCCTAAGCCTGGAGGGATACGTCAGCTCAGCGCCACTGACAAAGCCCCC
CGAAAAGGGCAAAGGTTGGAGCAAAACGTCCCACTCACTGGAGGCACCTGAGGACGACGGGGGCTGGTCAAGTGCAGAGGAGCAGATTAA
CTCGTCCGACGCAGAGGAGGACGGCGGGTTGGGCCCCAAGAAGCTGGTTCCAGGTAAATACACGGTCGTGGCGGACCACGAGAAGGGAGG
CCCCGATGCGCTGCGCGTGAGGAGCGGGGACGTGGTGGAGCTGGTGCAGGAGGGCGACGAGGGCCTCTGGTACGTCAGGGACCCGACCAC
TGGCAAGGAGGGCTGGGTGCCGGCCAGCAGCCTGTCCGTCCGGCTCGGCCCGTCCGGCTCGGCCCAGTGCCTGAGCAGCTCAGAGTCGAG
CCCGGGGTCGGCCGTGCTGAGCAACTCGTCCAGCTGCAGCGAGGGCGGCCAGGCCCCCTTCTCCGACCTGCAGGGGTAGCGCGGCCTCGG
CGCCGGAGACCCGCGCGCTGTCTGGGGCTGCGGTGGCGTGGGGAGGGCGCGGCCCCCGGACGCCCCGAGGAAGGGGCACCTCACCGCCCC
CACCCAGAGCGCCTGGCCGTGCGGGCTGCAGAGGACCCCTCCGGGGCAGAGGCAGGTTCCACGGAAGACCCCGGCCCGCTGGGGCTTCCC
CGGAGACTCCAGAGCCCACAGAGGAGGGGCCGCAGGGAACAGCCCCGGGCGGCAGGCGCCGGGCAGCGGCATCTCGTCCTGGCTCCACCG
TGCTGCTTCTGCCTCTGGACGGTGCTTTCAGGGGACGCGCGGACCGTGGTGGAGCTGCTTCCGGAGAAGTGGAGGATCCTCTGGCCAACG
GCCTGAGGAGAGCGGGGCACGGGGTCTCTTTAGCTTTTACAAGTTTTAGGATTTTTTCAAGCAGGGATCAATCCCGTGGCCATTTTTTGT
GGTACTTTGGCCTCAATTCTTCACCAGGAATCACTGTGTTTACATGAAATGACAATTTGATACTGTATTTGATAGAAAACTATTTTTTTG
TTACCGGGGTTTACATAGAAGCACGTTGTTTATACCACTAAGTGACTTTGGGGGGGCTCTCCCATGGAAACGGATGGCACTCCCTGAAGC
TCCCTGGTCACAGGTGGATGAAAACGTGTCCGTGGGTGACATCAGGTGGTGTCTCCACCACCAAAAGCAGTTAGAAGCCAAGGAGATTCC
TTTATCTACCTAGGGTTCATTTTCAAAAGAAAATTTAAACTATAATTTAAACAATTAACGTTCTTTTCTACAAAAAAAATGCAGGGACTT
GATTTTTTTAAAGAGCTTCACTGAATTAGGATATTTTTATTGCTTTTAAAGAAAATACAAAGATGCAGTTTCTGCAGGGTGTGGCGTGGA
CCAGTGCTGCCGACCATAGCTCAGAGAGCCCTGCCCCTGCCTCACTGCACTGCAGCCTCCTCGGAGGCCGCACCTCCACTCCACTCCCCA
CGCGCCCCCTGCCTCCCACCCAGGTCCACCTGCCACCTGGTGACCACCTTGAGTACAGAAGTGAAAGTGGGGAGAGTATTTTATTCAAGT
CACAGCAGAACTGGAAAAAAACTCTTCTGTTTTACCAACTTCTTGTGTTTCAGAAACATATTCTGTTCAAAACTTTTGAAGCCCTTTCGG
TGTCTAGTCTGCAGATGTTTTTGTATGTGTGCACCTCTGACCATGTGTGTACATATGTGTCTTGCTGGAAAGGACATATTCGCTGTCCCC
GTGCTGCTGGGAGGGCCGCCTCACAGCCTCACGGTTCCCAGCCCCAGCACAGTGGAGGCAGGCGTGGCTGCATTCCCCTCACGCTACCCT
CCCAGCGGCTTGTAGCCGTCACTGGCCAGACCTCCAGGGTGCGGAATCAAATAGGAAGCATGCAGAGACTCGGCAGCTTTTCCTCTGATG
TGTAAGTTATTTGGAACGCGTGCTGTGTCCCGCGATGTCCCTGATGTACTGTGCAGGCGCGGTGCCTCCGTCTCGTCGCACAGCTGCGCG
CCCTTGTGTGACCCTCCCCATAAAGGCACTTTACAGCTTCATGTTTCATCCACTGTCACTTTTTTTTAACTGCTGATGTAAATGGAATTT


Top

FusionGenePPI for ATP11A_MCF2L


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP11ATMEM30A, NPDC1, PICK1, TRIM25MCF2LRAC1, CDC42, RHOA, YAE1D1, RABAC1, AIMP2, GNB1, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP11A_MCF2L


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP11A_MCF2L


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP11AC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET