FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 3258

FusionGeneSummary for ATP11A_DHRS12

check button Fusion gene summary
Fusion gene informationFusion gene name: ATP11A_DHRS12
Fusion gene ID: 3258
HgeneTgene
Gene symbol

ATP11A

DHRS12

Gene ID

23250

79758

Gene nameATPase phospholipid transporting 11Adehydrogenase/reductase 12
SynonymsATPIH|ATPISSDR40C1
Cytomap

13q34

13q14.3

Type of geneprotein-codingprotein-coding
Descriptionprobable phospholipid-transporting ATPase IHATPase, class VI, type 11AP4-ATPase flippase complex alpha subunit ATP11Aphospholipid-translocating ATPasepotential phospholipid-transporting ATPase IHdehydrogenase/reductase SDR family member 12dehydrogenase/reductase (SDR family) member 12short-chain dehydrogenase/reductase family 40C member 1
Modification date2018052320180519
UniProtAcc

P98196

A0PJE2

Ensembl transtripts involved in fusion geneENST00000283558, ENST00000375630, 
ENST00000487903, ENST00000375645, 
ENST00000419448, 
ENST00000444610, 
ENST00000218981, ENST00000280056, 
ENST00000490949, 
Fusion gene scores* DoF score12 X 9 X 11=11884 X 3 X 3=36
# samples 204
** MAII scorelog2(20/1188*10)=-2.57046293102604
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/36*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ATP11A [Title/Abstract] AND DHRS12 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-YL-A8SQ-01BATP11Achr13

113516889

+DHRS12chr13

52365393

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000283558ENST00000444610ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000283558ENST00000218981ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000283558ENST00000280056ATP11Achr13

113516889

+DHRS12chr13

52365393

-
5CDS-5UTRENST00000283558ENST00000490949ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375630ENST00000444610ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375630ENST00000218981ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375630ENST00000280056ATP11Achr13

113516889

+DHRS12chr13

52365393

-
5CDS-5UTRENST00000375630ENST00000490949ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000487903ENST00000444610ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000487903ENST00000218981ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000487903ENST00000280056ATP11Achr13

113516889

+DHRS12chr13

52365393

-
5CDS-5UTRENST00000487903ENST00000490949ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375645ENST00000444610ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375645ENST00000218981ATP11Achr13

113516889

+DHRS12chr13

52365393

-
In-frameENST00000375645ENST00000280056ATP11Achr13

113516889

+DHRS12chr13

52365393

-
5CDS-5UTRENST00000375645ENST00000490949ATP11Achr13

113516889

+DHRS12chr13

52365393

-
intron-3CDSENST00000419448ENST00000444610ATP11Achr13

113516889

+DHRS12chr13

52365393

-
intron-3CDSENST00000419448ENST00000218981ATP11Achr13

113516889

+DHRS12chr13

52365393

-
intron-3CDSENST00000419448ENST00000280056ATP11Achr13

113516889

+DHRS12chr13

52365393

-
intron-5UTRENST00000419448ENST00000490949ATP11Achr13

113516889

+DHRS12chr13

52365393

-

Top

FusionProtFeatures for ATP11A_DHRS12


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ATP11A

P98196

DHRS12

A0PJE2

Catalytic component of a P4-ATPase flippase complexwhich catalyzes the hydrolysis of ATP coupled to the transport ofaminophospholipids from the outer to the inner leaflet of variousmembranes and ensures the maintenance of asymmetric distributionof phospholipids. Phospholipid translocation seems also to beimplicated in vesicle formation and in uptake of lipid signalingmolecules (Probable). May be involved in the uptake offarnesyltransferase inhibitor drugs, such as lonafarnib.{ECO:0000269|PubMed:15860663, ECO:0000305}. Putative oxidoreductase. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529111_2969971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291_619971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529319_3499971135Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529373_8819971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+252983_889971135Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529903_9149971135Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529935_9649971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529987_10009971135Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530111_2969972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301_619972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530319_3499972857Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530373_8819972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+253083_889972857Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530903_9149972857Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530935_9649972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530987_10009972857Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530111_2969972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301_619972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530319_3499972878Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530373_8819972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+253083_889972878Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530903_9149972878Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530935_9649972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530987_10009972878Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529297_3189971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529350_3729971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+252962_829971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529882_9029971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+252989_1109971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529915_9349971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+2529965_9869971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530297_3189972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530350_3729972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+253062_829972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530882_9029972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+253089_1109972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530915_9349972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+2530965_9869972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530297_3189972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530350_3729972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+253062_829972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530882_9029972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+253089_1109972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530915_9349972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+2530965_9869972878TransmembraneHelical
TgeneDHRS12chr13:113516889chr13:52365393ENST00000218981-1847_5342243Nucleotide bindingNAD or NADP
TgeneDHRS12chr13:113516889chr13:52365393ENST00000280056-1847_5342272Nucleotide bindingNAD or NADP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291024_10299971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291051_10689971135Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291094_11349971135Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301024_10299972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301051_10689972857Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301094_11349972857Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301024_10299972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301051_10689972878Topological domainExtracellular
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301094_11349972878Topological domainCytoplasmic
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291001_10239971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291030_10509971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000283558+25291069_10939971135TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301001_10239972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301030_10509972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000375645+25301069_10939972857TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301001_10239972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301030_10509972878TransmembraneHelical
HgeneATP11Achr13:113516889chr13:52365393ENST00000487903+25301069_10939972878TransmembraneHelical
TgeneDHRS12chr13:113516889chr13:52365393ENST00000444610-21047_5391318Nucleotide bindingNAD or NADP


Top

FusionGeneSequence for ATP11A_DHRS12


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_1224aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_1198aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_1227aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPDRNEQELRKVVGEAQTASPLPRFLEIMMH

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_1224aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_1198aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_1227aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPDRNEQELRKVVGEAQTASPLPRFLEIMMH

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_1224aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_1198aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_1227aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPDRNEQELRKVVGEAQTASPLPRFLEIMMH

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_1224aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_1198aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPGVRQAMPGFHARFGDRLRSEAQGADTMLW

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_1227aa
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFTFLIIFLVQLIIDTP
TSPVTSGLPLFFVITVTAIKQGTEDWLRHKADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVRPLGSENLLLRGATLKNTEKIFGVAIYTG
METKMALNTQSKSQKRSAVEKSMNAFLIVTLCILISKALINTVLKYMWQSEPFRDEPWTNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVYVPHVICNGQVLPES
SGIDMIDSSPSVNGREREELFFRALCLCHTVQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEITLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVATKRLIQEETEGICKLLQA
AKVALQDREKKLAEATEQIEKDLTLLGATAVEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNYRELFLEICRSCSAVLCCRMAPLQKAQIVKL
IKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSDTAIPKFKHLKKMLLVHGHFTYIRISELVQYFFTKNVCFIFPQFLY
QFFCGFSQQTLYDTATLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALLRWRVFIYWTLLGLFDALVFFFGATFVFENT
TVTSNGQNIFLHIVDLSDPKQIWKFVENFKQEHKLHVLINNAGCMVNKRELTEDGLEKNFAANTLGVYILTTGLIPVLEKEHDPRVITVS
SGGMLVQKLNTNDLQSERTPFDGTMVTAQNKRQQVVLTERWAQGHPAIHFSSMHPGWADTPDRNEQELRKVVGEAQTASPLPRFLEIMMH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3672nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG
CTGGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACA

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_3594nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_3681nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCAT
GAAGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGAT

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3672nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG
CTGGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACA

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_3594nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_3681nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCAT
GAAGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGAT

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3672nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG
CTGGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACA

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_3594nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_3681nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCAT
GAAGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGAT

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3672nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG
CTGGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACA

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_3594nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGG

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_3681nt
ATGGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACAC
AGGGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTT
ATACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCC
ACAAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAA
GCAGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGAC
ATTGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACC
GCCAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTT
CACGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTG
GTGAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGA
ATGGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTAT
CTCTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAAT
CAGAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATC
CCTGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACT
GGCGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACG
GAAAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCG
TCAGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACC
GTCCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGAC
GAGGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAAC
CACATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAA
ATTTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGT
AACGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCT
GCCAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCT
GTTGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAG
ATGGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAG
CAGAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCA
GCAGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTAC
AGGGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTA
ATCAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATA
GGTGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTT
CACGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATAC
CAGTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTC
CTGTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTG
CGCTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACA
ACTGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAG
CAGGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTT
GCTGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCC
TCAGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAAC
AAGAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACC
CCAGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCAT
GAAGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3954nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGC
GTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCCTGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCG
GTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTAGGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTT

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_4811nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGGTGACTTCCTCCCTGGCTGTGAAGGCAGCTGACACAGGGC
TAGGGGCAGCAGCTGGGCCTTCGAGGCGCACCTTCCCCTCCGTGAAACCTGGGGTGGGACTGTCCCCTGGGGGGTGCCTGGGCTTCTTTG
GCGAGATGATTGCTTTGCCTGCTGAGGTTAGTTTTGGGAAGCGCTTCACTCCAGGTTGGTAGCTTCTTTGGAGACTTGTGATAACCCTGT
CATCAAGGTCCTGTGAGAACGGGAGAGGCAGTTCCTACCTTGGGAATGGAAGATTTTCTCTGCAGTTTGCTGAGGCCCAGGAGGGGCGCT
ATTCAAAGCTGCACTGCAAAGGGAGTAACGGACTCTGCTTCTCTGCAGTGCAAAGGGTGTAAGGGACTCTGCTTCTCTATTTTTGGAAGC
AGTGATCTGTTCACGTCTCTCCCCAGTGGGCTCCTAAGGGGGCAGGCGTGTGAGTGGACGCCATCCGAAGACAGCACTTGACCTCGGGTG
GAAGCCAGGCTCTTTGCTTGGCTTCTCTTTCCTCTGTTCTTGATGAGAACCACCCTTGCTTGAGGAATTCTGAAGCGCTGGTGACCCCTG
GGGTATCCGGGAGGATGGCCGCACCCCTTCCTGCTGATCACCCAAACGTGGTCTCCCGTCCAGCCCTGGCTGCAGCCTCCCAGTTCCCAA
ACTGCACTTTACATATCAATCCATGCTGCCTGATCCCTGTGGGACCTTTGACAGCAGGGATGGGGGTCTAACAGCTGTAGGGTGCTGCCA
CTCCAGCAGGCGTCGGTTCAAGGCCTGAGCAGCACAGGGACATGGACCCAGCCACGCTGCAGCAGCTCACACCTCTCTGCGGTTCCCTCT
CACTTTTAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGCGTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCC
TGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCGGTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTA
GGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTTGTGCCTCACAGCGAGGCCTACAAGGGATGGGAACTTTTATT

>In-frame_ATP11A_ENST00000283558_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_4224nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCATGA
AGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGATTG
GCCTCACCAACTCCATGACCTCAGGCAGCTCACCTGGGCTCTCTGCAGCTCTTTCCTCCTCTACAAACAAGGGAACTGAAAGCAGCAGCA
GCCACAGCACACACCCCAGGGTGCACCCGCGGCGCCAAGAACTGGTCTCAGCGCTGTCTGCGGATTAACGCATTTGTCCTCAAGCCTCTG
TGGAGTGGCCACTACTGTCTATTATCACACCCATTTACAGATGAGGGAACTGAGGCCCAGAGAGGCTAAGACCTCCCAGCCGGGCCTGGC
CATGGGGTTTTGGGAATCAGGCTCTCACACACTGCTGGCATGGCCTTTCTGAAAATCACTATTTATCAGAAGCCTTGGAATTCATCCTAA
GAAATAAAGATAGGGAAAACAAGGTTGCTTATCACAGTGCTGGTGGTAGGAGATGAAGTTAATAAATTATAGAACACCTGTGCAAAATCT

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3954nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGC
GTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCCTGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCG
GTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTAGGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTT

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_4811nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGGTGACTTCCTCCCTGGCTGTGAAGGCAGCTGACACAGGGC
TAGGGGCAGCAGCTGGGCCTTCGAGGCGCACCTTCCCCTCCGTGAAACCTGGGGTGGGACTGTCCCCTGGGGGGTGCCTGGGCTTCTTTG
GCGAGATGATTGCTTTGCCTGCTGAGGTTAGTTTTGGGAAGCGCTTCACTCCAGGTTGGTAGCTTCTTTGGAGACTTGTGATAACCCTGT
CATCAAGGTCCTGTGAGAACGGGAGAGGCAGTTCCTACCTTGGGAATGGAAGATTTTCTCTGCAGTTTGCTGAGGCCCAGGAGGGGCGCT
ATTCAAAGCTGCACTGCAAAGGGAGTAACGGACTCTGCTTCTCTGCAGTGCAAAGGGTGTAAGGGACTCTGCTTCTCTATTTTTGGAAGC
AGTGATCTGTTCACGTCTCTCCCCAGTGGGCTCCTAAGGGGGCAGGCGTGTGAGTGGACGCCATCCGAAGACAGCACTTGACCTCGGGTG
GAAGCCAGGCTCTTTGCTTGGCTTCTCTTTCCTCTGTTCTTGATGAGAACCACCCTTGCTTGAGGAATTCTGAAGCGCTGGTGACCCCTG
GGGTATCCGGGAGGATGGCCGCACCCCTTCCTGCTGATCACCCAAACGTGGTCTCCCGTCCAGCCCTGGCTGCAGCCTCCCAGTTCCCAA
ACTGCACTTTACATATCAATCCATGCTGCCTGATCCCTGTGGGACCTTTGACAGCAGGGATGGGGGTCTAACAGCTGTAGGGTGCTGCCA
CTCCAGCAGGCGTCGGTTCAAGGCCTGAGCAGCACAGGGACATGGACCCAGCCACGCTGCAGCAGCTCACACCTCTCTGCGGTTCCCTCT
CACTTTTAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGCGTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCC
TGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCGGTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTA
GGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTTGTGCCTCACAGCGAGGCCTACAAGGGATGGGAACTTTTATT

>In-frame_ATP11A_ENST00000375630_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_4224nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCATGA
AGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGATTG
GCCTCACCAACTCCATGACCTCAGGCAGCTCACCTGGGCTCTCTGCAGCTCTTTCCTCCTCTACAAACAAGGGAACTGAAAGCAGCAGCA
GCCACAGCACACACCCCAGGGTGCACCCGCGGCGCCAAGAACTGGTCTCAGCGCTGTCTGCGGATTAACGCATTTGTCCTCAAGCCTCTG
TGGAGTGGCCACTACTGTCTATTATCACACCCATTTACAGATGAGGGAACTGAGGCCCAGAGAGGCTAAGACCTCCCAGCCGGGCCTGGC
CATGGGGTTTTGGGAATCAGGCTCTCACACACTGCTGGCATGGCCTTTCTGAAAATCACTATTTATCAGAAGCCTTGGAATTCATCCTAA
GAAATAAAGATAGGGAAAACAAGGTTGCTTATCACAGTGCTGGTGGTAGGAGATGAAGTTAATAAATTATAGAACACCTGTGCAAAATCT

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3954nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGC
GTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCCTGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCG
GTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTAGGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTT

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_4811nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGGTGACTTCCTCCCTGGCTGTGAAGGCAGCTGACACAGGGC
TAGGGGCAGCAGCTGGGCCTTCGAGGCGCACCTTCCCCTCCGTGAAACCTGGGGTGGGACTGTCCCCTGGGGGGTGCCTGGGCTTCTTTG
GCGAGATGATTGCTTTGCCTGCTGAGGTTAGTTTTGGGAAGCGCTTCACTCCAGGTTGGTAGCTTCTTTGGAGACTTGTGATAACCCTGT
CATCAAGGTCCTGTGAGAACGGGAGAGGCAGTTCCTACCTTGGGAATGGAAGATTTTCTCTGCAGTTTGCTGAGGCCCAGGAGGGGCGCT
ATTCAAAGCTGCACTGCAAAGGGAGTAACGGACTCTGCTTCTCTGCAGTGCAAAGGGTGTAAGGGACTCTGCTTCTCTATTTTTGGAAGC
AGTGATCTGTTCACGTCTCTCCCCAGTGGGCTCCTAAGGGGGCAGGCGTGTGAGTGGACGCCATCCGAAGACAGCACTTGACCTCGGGTG
GAAGCCAGGCTCTTTGCTTGGCTTCTCTTTCCTCTGTTCTTGATGAGAACCACCCTTGCTTGAGGAATTCTGAAGCGCTGGTGACCCCTG
GGGTATCCGGGAGGATGGCCGCACCCCTTCCTGCTGATCACCCAAACGTGGTCTCCCGTCCAGCCCTGGCTGCAGCCTCCCAGTTCCCAA
ACTGCACTTTACATATCAATCCATGCTGCCTGATCCCTGTGGGACCTTTGACAGCAGGGATGGGGGTCTAACAGCTGTAGGGTGCTGCCA
CTCCAGCAGGCGTCGGTTCAAGGCCTGAGCAGCACAGGGACATGGACCCAGCCACGCTGCAGCAGCTCACACCTCTCTGCGGTTCCCTCT
CACTTTTAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGCGTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCC
TGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCGGTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTA
GGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTTGTGCCTCACAGCGAGGCCTACAAGGGATGGGAACTTTTATT

>In-frame_ATP11A_ENST00000487903_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_4224nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCATGA
AGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGATTG
GCCTCACCAACTCCATGACCTCAGGCAGCTCACCTGGGCTCTCTGCAGCTCTTTCCTCCTCTACAAACAAGGGAACTGAAAGCAGCAGCA
GCCACAGCACACACCCCAGGGTGCACCCGCGGCGCCAAGAACTGGTCTCAGCGCTGTCTGCGGATTAACGCATTTGTCCTCAAGCCTCTG
TGGAGTGGCCACTACTGTCTATTATCACACCCATTTACAGATGAGGGAACTGAGGCCCAGAGAGGCTAAGACCTCCCAGCCGGGCCTGGC
CATGGGGTTTTGGGAATCAGGCTCTCACACACTGCTGGCATGGCCTTTCTGAAAATCACTATTTATCAGAAGCCTTGGAATTCATCCTAA
GAAATAAAGATAGGGAAAACAAGGTTGCTTATCACAGTGCTGGTGGTAGGAGATGAAGTTAATAAATTATAGAACACCTGTGCAAAATCT

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000444610_chr13_52365393_-_3954nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGC
GTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCCTGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCG
GTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTAGGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTT

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000218981_chr13_52365393_-_4811nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGGTGTGAGGCAGGCGATGCCGGGGTTCCACGCCAGGTTCGGGGACCGCCTGCGCTCCGAGGCCCAGGGCGCGGACACCATGCTGTGGCT
GGCCCTCTCCTCTGCCGCAGCCGCACAGCCCAGCGGCCGCTTCTTTCAAGGTGACTTCCTCCCTGGCTGTGAAGGCAGCTGACACAGGGC
TAGGGGCAGCAGCTGGGCCTTCGAGGCGCACCTTCCCCTCCGTGAAACCTGGGGTGGGACTGTCCCCTGGGGGGTGCCTGGGCTTCTTTG
GCGAGATGATTGCTTTGCCTGCTGAGGTTAGTTTTGGGAAGCGCTTCACTCCAGGTTGGTAGCTTCTTTGGAGACTTGTGATAACCCTGT
CATCAAGGTCCTGTGAGAACGGGAGAGGCAGTTCCTACCTTGGGAATGGAAGATTTTCTCTGCAGTTTGCTGAGGCCCAGGAGGGGCGCT
ATTCAAAGCTGCACTGCAAAGGGAGTAACGGACTCTGCTTCTCTGCAGTGCAAAGGGTGTAAGGGACTCTGCTTCTCTATTTTTGGAAGC
AGTGATCTGTTCACGTCTCTCCCCAGTGGGCTCCTAAGGGGGCAGGCGTGTGAGTGGACGCCATCCGAAGACAGCACTTGACCTCGGGTG
GAAGCCAGGCTCTTTGCTTGGCTTCTCTTTCCTCTGTTCTTGATGAGAACCACCCTTGCTTGAGGAATTCTGAAGCGCTGGTGACCCCTG
GGGTATCCGGGAGGATGGCCGCACCCCTTCCTGCTGATCACCCAAACGTGGTCTCCCGTCCAGCCCTGGCTGCAGCCTCCCAGTTCCCAA
ACTGCACTTTACATATCAATCCATGCTGCCTGATCCCTGTGGGACCTTTGACAGCAGGGATGGGGGTCTAACAGCTGTAGGGTGCTGCCA
CTCCAGCAGGCGTCGGTTCAAGGCCTGAGCAGCACAGGGACATGGACCCAGCCACGCTGCAGCAGCTCACACCTCTCTGCGGTTCCCTCT
CACTTTTAGATCGGAAGCCAGTTTCTACACACTTGCCTCTCGCTACAGCGTCCTCCTCACCGGCCGAAGAGGAGAAACTCATTGAAATCC
TGGAACAGCTGGCTCAGACATTTAAATAGGCCAACCCAGACACAGTGCGGTACCAGAATTGCCTTAGAAGATACCAGAAGGTGCGGTCTA
GGGACCAGTGAATAAGAAGACCCCACTTCAACTTCCCCTCGAAGACGTTGTGCCTCACAGCGAGGCCTACAAGGGATGGGAACTTTTATT

>In-frame_ATP11A_ENST00000375645_chr13_113516889_+_DHRS12_ENST00000280056_chr13_52365393_-_4224nt
GCGGCCGCACTAGTACCCCGGAGCCCATGGGCGCGCCGAGCCGGGCGCGGGGGCGCTGAACGGCGGAGCGGGAGCGGCCGGAGGAGCCAT
GGACTGCAGCCTCGTGCGGACGCTCGTGCACAGATACTGTGCAGGAGAAGAGAATTGGGTGGACAGCAGGACCATCTACGTGGGACACAG
GGAGCCACCTCCGGGCGCAGAGGCCTACATCCCACAGAGATACCCAGACAACAGGATCGTCTCGTCCAAGTACACATTTTGGAACTTTAT
ACCCAAGAATTTATTTGAACAATTCAGAAGAGTAGCCAACTTTTATTTCCTTATCATATTTCTGGTGCAGTTGATTATTGATACACCCAC
AAGTCCAGTGACAAGCGGACTTCCACTCTTCTTTGTCATTACTGTGACGGCTATCAAACAGGGTTATGAAGACTGGCTTCGACATAAAGC
AGACAATGCCATGAACCAGTGTCCTGTTCATTTCATTCAGCACGGCAAGCTCGTTCGGAAACAAAGTCGAAAGCTGCGAGTTGGGGACAT
TGTCATGGTTAAGGAGGACGAGACCTTTCCCTGCGACTTGATCTTCCTTTCCAGCAACCGGGGAGATGGGACGTGCCACGTCACCACCGC
CAGCTTGGATGGAGAATCCAGCCATAAAACGCATTACGCGGTCCAGGACACCAAAGGCTTCCACACAGAGGAGGATATCGGCGGACTTCA
CGCCACCATCGAGTGTGAGCAGCCCCAGCCCGACCTCTACAAGTTCGTGGGTCGCATCAACGTTTACAGTGACCTGAATGACCCCGTGGT
GAGGCCCTTAGGATCGGAAAACCTGCTGCTTAGAGGAGCTACACTGAAGAACACTGAGAAAATCTTTGGTGTGGCTATTTACACGGGAAT
GGAAACCAAGATGGCATTAAATTATCAATCAAAATCTCAGAAGCGATCTGCCGTGGAAAAATCGATGAATGCGTTCCTCATTGTGTATCT
CTGCATTCTGATCAGCAAAGCCCTGATAAACACTGTGCTGAAATACATGTGGCAGAGTGAGCCCTTTCGGGATGAGCCGTGGTATAATCA
GAAAACGGAGTCGGAAAGGCAGAGGAATCTGTTCCTCAAGGCATTCACGGACTTCCTGGCCTTCATGGTCCTCTTTAACTACATCATCCC
TGTGTCCATGTACGTCACGGTCGAGATGCAGAAGTTCCTCGGCTCTTACTTCATCACCTGGGACGAAGACATGTTTGACGAGGAGACTGG
CGAGGGGCCTCTGGTGAACACGTCGGACCTCAATGAAGAGCTGGGACAGGTGGAGTACATCTTCACAGACAAGACCGGCACCCTCACGGA
AAACAACATGGAGTTCAAGGAGTGCTGCATCGAAGGCCATGTCTACGTGCCCCACGTCATCTGCAACGGGCAGGTCCTCCCAGAGTCGTC
AGGAATCGACATGATTGACTCGTCCCCCAGCGTCAACGGGAGGGAGCGCGAGGAGCTGTTTTTCCGGGCCCTCTGTCTCTGCCACACCGT
CCAGGTGAAAGACGATGACAGCGTAGACGGCCCCAGGAAATCGCCGGACGGGGGGAAATCCTGTGTGTACATCTCATCCTCGCCCGACGA
GGTGGCGCTGGTCGAAGGTGTCCAGAGACTTGGCTTTACCTACCTAAGGCTGAAGGACAATTACATGGAGATATTAAACAGGGAGAACCA
CATCGAAAGGTTTGAATTGCTGGAAATTTTGAGTTTTGACTCAGTCAGAAGGAGAATGAGTGTAATTGTAAAATCTGCTACAGGAGAAAT
TTATCTGTTTTGCAAAGGAGCAGATTCTTCGATATTCCCCCGAGTGATAGAAGGCAAAGTTGACCAGATCCGAGCCAGAGTGGAGCGTAA
CGCAGTGGAGGGGCTCCGAACTTTGTGTGTTGCTTATAAAAGGCTGATCCAAGAAGAATATGAAGGCATTTGTAAGCTGCTGCAGGCTGC
CAAAGTGGCCCTTCAAGATCGAGAGAAAAAGTTAGCAGAAGCCTATGAGCAAATAGAGAAAGATCTTACTCTGCTTGGTGCTACAGCTGT
TGAGGACCGGCTGCAGGAGAAAGCTGCAGACACCATCGAGGCCCTGCAGAAGGCCGGGATCAAAGTCTGGGTTCTCACGGGAGACAAGAT
GGAGACGGCCGCGGCCACGTGCTACGCCTGCAAGCTCTTCCGCAGGAACACGCAGCTGCTGGAGCTGACCACCAAGAGGATCGAGGAGCA
GAGCCTGCACGACGTCCTGTTCGAGCTGAGCAAGACGGTCCTGCGCCACAGCGGGAGCCTGACCAGAGACAACCTGTCCGGACTTTCAGC
AGATATGCAGGACTACGGTTTAATTATCGACGGAGCTGCACTGTCTCTGATAATGAAGCCTCGAGAAGACGGGAGTTCCGGCAACTACAG
GGAGCTCTTCCTGGAAATCTGCCGGAGCTGCAGCGCGGTGCTCTGCTGCCGCATGGCGCCCTTGCAGAAGGCTCAGATTGTTAAATTAAT
CAAATTTTCAAAAGAGCACCCAATCACGTTAGCAATTGGCGATGGTGCAAATGATGTCAGCATGATTCTGGAAGCGCACGTGGGCATAGG
TGTCATCGGCAAGGAAGGCCGCCAGGCTGCCAGGAACAGCGACTATGCAATCCCAAAGTTTAAGCATTTGAAGAAGATGCTGCTTGTTCA
CGGGCATTTTTATTACATTAGGATCTCTGAGCTCGTGCAGTACTTCTTCTATAAGAACGTCTGCTTCATCTTCCCTCAGTTTTTATACCA
GTTCTTCTGTGGGTTTTCACAACAGACTTTGTACGACACCGCGTATCTGACCCTCTACAACATCAGCTTCACCTCCCTCCCCATCCTCCT
GTACAGCCTCATGGAGCAGCATGTTGGCATTGACGTGCTCAAGAGAGACCCGACCCTGTACAGGGACGTCGCCAAGAATGCCCTGCTGCG
CTGGCGCGTGTTCATCTACTGGACGCTCCTGGGACTGTTTGACGCACTGGTGTTCTTCTTTGGTGCTTATTTCGTGTTTGAAAATACAAC
TGTGACAAGCAACGGGCAGAACATTTTTCTGCACATTGTGGACTTGTCTGATCCCAAGCAAATCTGGAAATTTGTTGAAAATTTCAAGCA
GGAACATAAACTCCATGTTCTGATCAATAATGCAGGTTGCATGGTCAATAAAAGAGAGCTCACAGAAGATGGACTTGAAAAAAACTTTGC
TGCCAATACTCTGGGTGTGTACATTCTCACGACCGGCCTGATCCCTGTGCTGGAGAAAGAACACGACCCCCGAGTGATAACCGTCTCCTC
AGGAGGAATGTTGGTTCAGAAACTGAACACCAATGATCTCCAGTCCGAAAGAACACCATTTGATGGAACTATGGTCTATGCACAAAACAA
GAGGCAGCAAGTGGTTCTGACGGAGCGGTGGGCCCAAGGGCACCCGGCCATCCATTTTTCTTCCATGCATCCTGGCTGGGCCGACACCCC
AGACAGGAATGAGCAGGAGCTGAGGAAGGTAGTGGGAGAGGCCCAGACTGCCTCACCACTCCCCAGGTTTTTGGAAATAATGATGCATGA
AGGTAAATGCCAGCCACAAGGACACAGCTCGAATGATCTGGAAGCGTGTTGGAGCAGCGGTGGAGGGGAGCAGAATTCTCTTCCGGATTG
GCCTCACCAACTCCATGACCTCAGGCAGCTCACCTGGGCTCTCTGCAGCTCTTTCCTCCTCTACAAACAAGGGAACTGAAAGCAGCAGCA
GCCACAGCACACACCCCAGGGTGCACCCGCGGCGCCAAGAACTGGTCTCAGCGCTGTCTGCGGATTAACGCATTTGTCCTCAAGCCTCTG
TGGAGTGGCCACTACTGTCTATTATCACACCCATTTACAGATGAGGGAACTGAGGCCCAGAGAGGCTAAGACCTCCCAGCCGGGCCTGGC
CATGGGGTTTTGGGAATCAGGCTCTCACACACTGCTGGCATGGCCTTTCTGAAAATCACTATTTATCAGAAGCCTTGGAATTCATCCTAA
GAAATAAAGATAGGGAAAACAAGGTTGCTTATCACAGTGCTGGTGGTAGGAGATGAAGTTAATAAATTATAGAACACCTGTGCAAAATCT


Top

FusionGenePPI for ATP11A_DHRS12


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ATP11ATMEM30A, NPDC1, PICK1, TRIM25DHRS12H3F3A


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ATP11A_DHRS12


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ATP11A_DHRS12


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneATP11AC1800706Idiopathic Pulmonary Fibrosis1CTD_human;ORPHANET