FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32552

FusionGeneSummary for SAFB2_LONP1

check button Fusion gene summary
Fusion gene informationFusion gene name: SAFB2_LONP1
Fusion gene ID: 32552
HgeneTgene
Gene symbol

SAFB2

LONP1

Gene ID

9667

9361

Gene namescaffold attachment factor B2lon peptidase 1, mitochondrial
Synonyms-CODASS|LON|LONP|LonHS|PIM1|PRSS15|hLON
Cytomap

19p13.3

19p13.3

Type of geneprotein-codingprotein-coding
Descriptionscaffold attachment factor B2lon protease homolog, mitochondrialhLON ATP-dependent proteaselon protease-like proteinmitochondrial ATP-dependent protease Lonmitochondrial lon protease-like proteinserine protease 15
Modification date2018052320180523
UniProtAcc

Q14151

P36776

Ensembl transtripts involved in fusion geneENST00000252542, ENST00000591310, 
ENST00000360614, ENST00000585374, 
ENST00000593119, ENST00000540670, 
ENST00000590729, ENST00000590511, 
Fusion gene scores* DoF score6 X 6 X 6=2162 X 3 X 3=18
# samples 73
** MAII scorelog2(7/216*10)=-1.6256044852185
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: SAFB2 [Title/Abstract] AND LONP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
Tumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneLONP1

GO:0034599

cellular response to oxidative stress

17420247

TgeneLONP1

GO:0051260

protein homooligomerization

14739292

TgeneLONP1

GO:0051603

proteolysis involved in cellular protein catabolic process

8248235|17420247


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-78-8660-01ASAFB2chr19

5598804

-LONP1chr19

5708414

-
TCGARVTGCTTCGA-2G-AAFL-01ASAFB2chr19

5621320

-LONP1chr19

5692219

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000252542ENST00000360614SAFB2chr19

5598804

-LONP1chr19

5708414

-
In-frameENST00000252542ENST00000585374SAFB2chr19

5598804

-LONP1chr19

5708414

-
In-frameENST00000252542ENST00000593119SAFB2chr19

5598804

-LONP1chr19

5708414

-
In-frameENST00000252542ENST00000540670SAFB2chr19

5598804

-LONP1chr19

5708414

-
In-frameENST00000252542ENST00000590729SAFB2chr19

5598804

-LONP1chr19

5708414

-
5CDS-intronENST00000252542ENST00000590511SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-3CDSENST00000591310ENST00000360614SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-3CDSENST00000591310ENST00000585374SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-3CDSENST00000591310ENST00000593119SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-3CDSENST00000591310ENST00000540670SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-3CDSENST00000591310ENST00000590729SAFB2chr19

5598804

-LONP1chr19

5708414

-
intron-intronENST00000591310ENST00000590511SAFB2chr19

5598804

-LONP1chr19

5708414

-
In-frameENST00000252542ENST00000360614SAFB2chr19

5621320

-LONP1chr19

5692219

-
In-frameENST00000252542ENST00000585374SAFB2chr19

5621320

-LONP1chr19

5692219

-
Frame-shiftENST00000252542ENST00000593119SAFB2chr19

5621320

-LONP1chr19

5692219

-
In-frameENST00000252542ENST00000540670SAFB2chr19

5621320

-LONP1chr19

5692219

-
In-frameENST00000252542ENST00000590729SAFB2chr19

5621320

-LONP1chr19

5692219

-
5CDS-intronENST00000252542ENST00000590511SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-3CDSENST00000591310ENST00000360614SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-3CDSENST00000591310ENST00000585374SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-3CDSENST00000591310ENST00000593119SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-3CDSENST00000591310ENST00000540670SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-3CDSENST00000591310ENST00000590729SAFB2chr19

5621320

-LONP1chr19

5692219

-
intron-intronENST00000591310ENST00000590511SAFB2chr19

5621320

-LONP1chr19

5692219

-

Top

FusionProtFeatures for SAFB2_LONP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
SAFB2

Q14151

LONP1

P36776

Binds to scaffold/matrix attachment region (S/MAR) DNA.Can function as an estrogen receptor corepressor and can alsoinhibit cell proliferation. ATP-dependent serine protease that mediates theselective degradation of misfolded, unassembled or oxidativelydamaged polypeptides as well as certain short-lived regulatoryproteins in the mitochondrial matrix. May also have a chaperonefunction in the assembly of inner membrane protein complexes.Participates in the regulation of mitochondrial gene expressionand in the maintenance of the integrity of the mitochondrialgenome. Binds to mitochondrial promoters and RNA in a single-stranded, site-specific, and strand-specific manner. May regulatemitochondrial DNA replication and/or gene expression using site-specific, single-stranded DNA binding to target the degradation ofregulatory proteins binding to adjacent sites in mitochondrialpromoters (PubMed:12198491, PubMed:15870080, PubMed:17420247,PubMed:8248235). Endogenous substrates include mitochondrialsteroidogenic acute regulatory (StAR) protein, helicase Twinkle(TWNK) and the large ribosomal subunit protein bL32m. bL32m isprotected from degradation by LONP1 when it is bound to a nucleicacid (RNA), but TWNK is not (PubMed:17579211, PubMed:28377575).{ECO:0000255|HAMAP-Rule:MF_03120, ECO:0000269|PubMed:12198491,ECO:0000269|PubMed:15870080, ECO:0000269|PubMed:17420247,ECO:0000269|PubMed:17579211, ECO:0000269|PubMed:28377575,ECO:0000269|PubMed:8248235}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321482_545594954Compositional biasNote=Lys-rich
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-132130_64594954DomainSAP
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321407_485594954DomainRRM
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-22130_6491954DomainSAP
TgeneLONP1chr19:5598804chr19:5708414ENST00000360614-318759_949290960DomainLon proteolytic
TgeneLONP1chr19:5598804chr19:5708414ENST00000360614-318523_530290960Nucleotide bindingATP

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321619_724594954Compositional biasNote=Glu-rich
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321621_788594954Compositional biasNote=Arg-rich
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321792_926594954Compositional biasNote=Gly-rich
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221482_54591954Compositional biasNote=Lys-rich
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221619_72491954Compositional biasNote=Glu-rich
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221621_78891954Compositional biasNote=Arg-rich
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221792_92691954Compositional biasNote=Gly-rich
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221407_48591954DomainRRM
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321713_730594954MotifNuclear localization signal
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221713_73091954MotifNuclear localization signal
TgeneLONP1chr19:5598804chr19:5708414ENST00000360614-318124_368290960DomainLon N-terminal
TgeneLONP1chr19:5621320chr19:5692219ENST00000360614-1618124_368901960DomainLon N-terminal
TgeneLONP1chr19:5621320chr19:5692219ENST00000360614-1618759_949901960DomainLon proteolytic
TgeneLONP1chr19:5621320chr19:5692219ENST00000360614-1618523_530901960Nucleotide bindingATP


Top

FusionGeneSequence for SAFB2_LONP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000360614_chr19_5708414_-_1264aa
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCV
KGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDL
DLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY
GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVD
NPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
IEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIA
VSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIG
RGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDE
SKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGS
TLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLS
LAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000585374_chr19_5708414_-_1264aa
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCV
KGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDL
DLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY
GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVD
NPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
IEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIA
VSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIG
RGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDE
SKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGS
TLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLS
LAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000593119_chr19_5708414_-_1264aa
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCV
KGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDL
DLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY
GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVD
NPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
IEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIA
VSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIG
RGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDE
SKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGS
TLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLS
LAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000540670_chr19_5708414_-_1264aa
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCV
KGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDL
DLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY
GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVD
NPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
IEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIA
VSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIG
RGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDE
SKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGS
TLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLS
LAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000590729_chr19_5708414_-_1264aa
MAETLPGSGDSGPGTASLGPGVAETGTRRLSELRVIDLRAELKKRNLDTGGNKSVLMERLKKAVKEEGQDPDEIGIELEATSKKSAKRCV
KGLKMEEEGTEDNGLEDDSRDGQEDMEASLENLQNMGMMDMSVLDETEVANSSAPDFGEDGTDGLLDSFCDSKEYVAAQLRQLPAQPPEH
AVDGEGFKNTLETSSLNFKVTPDIEESLLEPENEKILDILGETCKSEPVKEESSELEQPFAQDTSSVGPDRKLAEEEDLFDSAHPEEGDL
DLASESTAHAQSSKADSLLAVVKREPAEQPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDA
CNEVPPAPKESSTSEGADQKMSSFKEEKDIKPIIKDEKGRVGSGSGRNLWVSGLSSTTRATDLKNLFSKYGKVVGAKVVTNARSPGARCY
GFVTMSTSDEATKCISHLHRTELHGRMISVEKAKNEPAGKKLSDRKECEVKKEKLSSVDRHHSVEIKIEKTVIKKEEKIEKKEEKKPEDI
KKEEKDQDELKPGPTNRSRVTKSGSRGMERTVVMDKSKGEPVISVKTTSRSKERALTAEIVKTIRDIIALNPLYRESVLQMMQAGQRVVD
NPIYLSDMGAALTGAESHELQDVLEETNIPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDA
IEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIA
VSQLRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIG
RGYQGDPSSALLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCGLDE
SKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDVTPPGVVMGLAWTAMGGS
TLFVETSLRRPQDKDAKGDKDGSLEVTGQLGEVMKESARIAYTFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLS
LAMGRPVRQNLAMTGEVSLTGKILPVGGIKEKTIAAKRAGVTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYREIFDIAFPDEQAEALA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000360614_chr19_5708414_-_3792nt
ATGGCGGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTC
AGCGAGCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTC
AAGAAGGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTT
AAAGGACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTG
GAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGAT
GGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCAT
GCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAG
CCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTT
GCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTA
GATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCA
GGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCT
AGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCT
TGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATA
AAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCT
ACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTAT
GGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTA
GAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGA
CATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATT
AAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGG
ACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATC
GTGAAGACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGAC
AACCCCATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCT
AAGCGGCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAG
ATCAAGCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCC
ATCGAGGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGC
CTGCTGGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAG
AACCTGGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCC
GTTAGCCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATC
GCCCGCGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTG
GGCGCCATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGC
CGAGGCTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTG
CCCGTGGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATC
AACGTGTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAG
AGCAAGGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTG
GAGAAGGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTG
GGGAAGCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCC
ACGCTGTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTG
GGGGAGGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTG
ACCTCACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCC
CTGGCCATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAG
GAGAAGACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTC
ATCACCGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCC

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000585374_chr19_5708414_-_3792nt
ATGGCGGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTC
AGCGAGCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTC
AAGAAGGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTT
AAAGGACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTG
GAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGAT
GGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCAT
GCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAG
CCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTT
GCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTA
GATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCA
GGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCT
AGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCT
TGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATA
AAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCT
ACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTAT
GGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTA
GAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGA
CATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATT
AAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGG
ACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATC
GTGAAGACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGAC
AACCCCATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCT
AAGCGGCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAG
ATCAAGCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCC
ATCGAGGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGC
CTGCTGGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAG
AACCTGGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCC
GTTAGCCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATC
GCCCGCGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTG
GGCGCCATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGC
CGAGGCTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTG
CCCGTGGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATC
AACGTGTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAG
AGCAAGGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTG
GAGAAGGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTG
GGGAAGCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCC
ACGCTGTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTG
GGGGAGGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTG
ACCTCACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCC
CTGGCCATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAG
GAGAAGACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTC
ATCACCGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCC

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000593119_chr19_5708414_-_3792nt
ATGGCGGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTC
AGCGAGCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTC
AAGAAGGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTT
AAAGGACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTG
GAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGAT
GGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCAT
GCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAG
CCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTT
GCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTA
GATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCA
GGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCT
AGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCT
TGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATA
AAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCT
ACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTAT
GGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTA
GAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGA
CATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATT
AAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGG
ACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATC
GTGAAGACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGAC
AACCCCATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCT
AAGCGGCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAG
ATCAAGCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCC
ATCGAGGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGC
CTGCTGGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAG
AACCTGGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCC
GTTAGCCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATC
GCCCGCGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTG
GGCGCCATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGC
CGAGGCTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTG
CCCGTGGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATC
AACGTGTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAG
AGCAAGGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTG
GAGAAGGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTG
GGGAAGCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCC
ACGCTGTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTG
GGGGAGGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTG
ACCTCACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCC
CTGGCCATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAG
GAGAAGACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTC
ATCACCGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCC

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000540670_chr19_5708414_-_3792nt
ATGGCGGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTC
AGCGAGCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTC
AAGAAGGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTT
AAAGGACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTG
GAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGAT
GGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCAT
GCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAG
CCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTT
GCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTA
GATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCA
GGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCT
AGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCT
TGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATA
AAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCT
ACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTAT
GGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTA
GAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGA
CATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATT
AAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGG
ACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATC
GTGAAGACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGAC
AACCCCATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCT
AAGCGGCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAG
ATCAAGCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCC
ATCGAGGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGC
CTGCTGGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAG
AACCTGGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCC
GTTAGCCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATC
GCCCGCGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTG
GGCGCCATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGC
CGAGGCTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTG
CCCGTGGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATC
AACGTGTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAG
AGCAAGGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTG
GAGAAGGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTG
GGGAAGCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCC
ACGCTGTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTG
GGGGAGGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTG
ACCTCACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCC
CTGGCCATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAG
GAGAAGACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTC
ATCACCGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCC

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000590729_chr19_5708414_-_3792nt
ATGGCGGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTC
AGCGAGCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTC
AAGAAGGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTT
AAAGGACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTG
GAGAACCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGAT
GGCACGGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCAT
GCTGTGGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAG
CCAGAAAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTT
GCACAGGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTA
GATTTGGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCA
GGCGATGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCT
AGCGAGGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCT
TGTAATGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATA
AAGCCAATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCT
ACGGATCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTAT
GGATTCGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTA
GAGAAGGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGA
CATCATTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATT
AAGAAGGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGG
ACGGTCGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATC
GTGAAGACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGAC
AACCCCATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCT
AAGCGGCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAG
ATCAAGCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCC
ATCGAGGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGC
CTGCTGGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAG
AACCTGGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCC
GTTAGCCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATC
GCCCGCGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTG
GGCGCCATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGC
CGAGGCTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTG
CCCGTGGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATC
AACGTGTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAG
AGCAAGGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTG
GAGAAGGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTG
GGGAAGCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCC
ACGCTGTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTG
GGGGAGGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTG
ACCTCACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCC
CTGGCCATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAG
GAGAAGACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTC
ATCACCGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000360614_chr19_5708414_-_4255nt
CTCCCGCCGGGAACTGCCGGGACGCATGCGAGCTGCAGATTCAGCGCTTGCGCGTTGTGCCGGGGAACCCGCGGTTGGTGGACGCGCGAG
CGTCCTTGCTGCTAAGTACGCTAGTGGGGGCGGTGCGCGTGCGCGTGCGCGGCCGCAAAGCGGGGCGGGAGGAAACGAGTGCGTTTTCCT
CTTAGGCGGCGCCATTTTGTGTTCAGAGCCGCTATAGCTGCCGGCGGTGTGCGACTGAGTCGGTGGCGAAGACGGGAACGCGACGATGGC
GGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTCAGCGA
GCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTCAAGAA
GGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTTAAAGG
ACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTGGAGAA
CCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCAC
GGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGT
GGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGA
AAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACA
GGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTT
GGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGA
TGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGA
GGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAA
TGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCC
AATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGA
TCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATT
CGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAA
GGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCA
TTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAA
GGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGT
CGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATCGTGAA
GACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGACAACCC
CATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCTAAGCG
GCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAGATCAA
GCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCCATCGA
GGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGCCTGCT
GGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAGAACCT
GGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCCGTTAG
CCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATCGCCCG
CGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTGGGCGC
CATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGCCGAGG
CTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTGCCCGT
GGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATCAACGT
GTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAGAGCAA
GGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTGGAGAA
GGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTGGGGAA
GCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCCACGCT
GTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTGGGGGA
GGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTGACCTC
ACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCCCTGGC
CATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAGGAGAA
GACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTCATCAC
CGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCCGTGGA
ACGGTGACGGCCACCCCGGGACTGCAGGCGGCGGATGTCAGGCCCTGTCTGGGCCAGAACTGAGCGCTGTGGGGAGCGCGCCCGGACCTG
GCAGTGGAGCCACCGAGCGAGCAGCTCGGTCCAGTGACCCAGATCCCAGGGACCTCAGTCGGCTTAATCAGAGTGTGGCATAGAAGCTAT

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000585374_chr19_5708414_-_4254nt
CTCCCGCCGGGAACTGCCGGGACGCATGCGAGCTGCAGATTCAGCGCTTGCGCGTTGTGCCGGGGAACCCGCGGTTGGTGGACGCGCGAG
CGTCCTTGCTGCTAAGTACGCTAGTGGGGGCGGTGCGCGTGCGCGTGCGCGGCCGCAAAGCGGGGCGGGAGGAAACGAGTGCGTTTTCCT
CTTAGGCGGCGCCATTTTGTGTTCAGAGCCGCTATAGCTGCCGGCGGTGTGCGACTGAGTCGGTGGCGAAGACGGGAACGCGACGATGGC
GGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTCAGCGA
GCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTCAAGAA
GGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTTAAAGG
ACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTGGAGAA
CCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCAC
GGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGT
GGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGA
AAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACA
GGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTT
GGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGA
TGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGA
GGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAA
TGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCC
AATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGA
TCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATT
CGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAA
GGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCA
TTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAA
GGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGT
CGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATCGTGAA
GACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGACAACCC
CATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCTAAGCG
GCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAGATCAA
GCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCCATCGA
GGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGCCTGCT
GGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAGAACCT
GGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCCGTTAG
CCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATCGCCCG
CGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTGGGCGC
CATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGCCGAGG
CTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTGCCCGT
GGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATCAACGT
GTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAGAGCAA
GGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTGGAGAA
GGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTGGGGAA
GCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCCACGCT
GTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTGGGGGA
GGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTGACCTC
ACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCCCTGGC
CATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAGGAGAA
GACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTCATCAC
CGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCCGTGGA
ACGGTGACGGCCACCCCGGGACTGCAGGCGGCGGATGTCAGGCCCTGTCTGGGCCAGAACTGAGCGCTGTGGGGAGCGCGCCCGGACCTG
GCAGTGGAGCCACCGAGCGAGCAGCTCGGTCCAGTGACCCAGATCCCAGGGACCTCAGTCGGCTTAATCAGAGTGTGGCATAGAAGCTAT

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000593119_chr19_5708414_-_4254nt
CTCCCGCCGGGAACTGCCGGGACGCATGCGAGCTGCAGATTCAGCGCTTGCGCGTTGTGCCGGGGAACCCGCGGTTGGTGGACGCGCGAG
CGTCCTTGCTGCTAAGTACGCTAGTGGGGGCGGTGCGCGTGCGCGTGCGCGGCCGCAAAGCGGGGCGGGAGGAAACGAGTGCGTTTTCCT
CTTAGGCGGCGCCATTTTGTGTTCAGAGCCGCTATAGCTGCCGGCGGTGTGCGACTGAGTCGGTGGCGAAGACGGGAACGCGACGATGGC
GGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTCAGCGA
GCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTCAAGAA
GGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTTAAAGG
ACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTGGAGAA
CCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCAC
GGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGT
GGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGA
AAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACA
GGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTT
GGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGA
TGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGA
GGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAA
TGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCC
AATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGA
TCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATT
CGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAA
GGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCA
TTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAA
GGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGT
CGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATCGTGAA
GACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGACAACCC
CATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCTAAGCG
GCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAGATCAA
GCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCCATCGA
GGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGCCTGCT
GGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAGAACCT
GGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCCGTTAG
CCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATCGCCCG
CGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTGGGCGC
CATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGCCGAGG
CTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTGCCCGT
GGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATCAACGT
GTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAGAGCAA
GGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTGGAGAA
GGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTGGGGAA
GCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCCACGCT
GTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTGGGGGA
GGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTGACCTC
ACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCCCTGGC
CATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAGGAGAA
GACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTCATCAC
CGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCCGTGGA
ACGGTGACGGCCACCCCGGGACTGCAGGCGGCGGATGTCAGGCCCTGTCTGGGCCAGAACTGAGCGCTGTGGGGAGCGCGCCCGGACCTG
GCAGTGGAGCCACCGAGCGAGCAGCTCGGTCCAGTGACCCAGATCCCAGGGACCTCAGTCGGCTTAATCAGAGTGTGGCATAGAAGCTAT

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000540670_chr19_5708414_-_4254nt
CTCCCGCCGGGAACTGCCGGGACGCATGCGAGCTGCAGATTCAGCGCTTGCGCGTTGTGCCGGGGAACCCGCGGTTGGTGGACGCGCGAG
CGTCCTTGCTGCTAAGTACGCTAGTGGGGGCGGTGCGCGTGCGCGTGCGCGGCCGCAAAGCGGGGCGGGAGGAAACGAGTGCGTTTTCCT
CTTAGGCGGCGCCATTTTGTGTTCAGAGCCGCTATAGCTGCCGGCGGTGTGCGACTGAGTCGGTGGCGAAGACGGGAACGCGACGATGGC
GGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTCAGCGA
GCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTCAAGAA
GGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTTAAAGG
ACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTGGAGAA
CCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCAC
GGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGT
GGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGA
AAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACA
GGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTT
GGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGA
TGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGA
GGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAA
TGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCC
AATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGA
TCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATT
CGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAA
GGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCA
TTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAA
GGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGT
CGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATCGTGAA
GACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGACAACCC
CATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCTAAGCG
GCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAGATCAA
GCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCCATCGA
GGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGCCTGCT
GGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAGAACCT
GGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCCGTTAG
CCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATCGCCCG
CGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTGGGCGC
CATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGCCGAGG
CTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTGCCCGT
GGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATCAACGT
GTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAGAGCAA
GGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTGGAGAA
GGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTGGGGAA
GCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCCACGCT
GTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTGGGGGA
GGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTGACCTC
ACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCCCTGGC
CATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAGGAGAA
GACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTCATCAC
CGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCCGTGGA
ACGGTGACGGCCACCCCGGGACTGCAGGCGGCGGATGTCAGGCCCTGTCTGGGCCAGAACTGAGCGCTGTGGGGAGCGCGCCCGGACCTG
GCAGTGGAGCCACCGAGCGAGCAGCTCGGTCCAGTGACCCAGATCCCAGGGACCTCAGTCGGCTTAATCAGAGTGTGGCATAGAAGCTAT

>In-frame_SAFB2_ENST00000252542_chr19_5598804_-_LONP1_ENST00000590729_chr19_5708414_-_4134nt
CTCCCGCCGGGAACTGCCGGGACGCATGCGAGCTGCAGATTCAGCGCTTGCGCGTTGTGCCGGGGAACCCGCGGTTGGTGGACGCGCGAG
CGTCCTTGCTGCTAAGTACGCTAGTGGGGGCGGTGCGCGTGCGCGTGCGCGGCCGCAAAGCGGGGCGGGAGGAAACGAGTGCGTTTTCCT
CTTAGGCGGCGCCATTTTGTGTTCAGAGCCGCTATAGCTGCCGGCGGTGTGCGACTGAGTCGGTGGCGAAGACGGGAACGCGACGATGGC
GGAGACTCTGCCCGGGTCGGGCGACTCGGGCCCTGGCACGGCTTCTCTCGGCCCGGGCGTTGCGGAGACTGGGACGAGGCGGCTCAGCGA
GCTGCGGGTGATCGATCTGCGGGCGGAGCTGAAGAAGCGGAACCTGGACACGGGCGGCAACAAGAGCGTCCTGATGGAGCGGCTCAAGAA
GGCGGTTAAAGAAGAGGGGCAAGATCCTGATGAAATTGGCATCGAGTTAGAAGCCACCAGCAAGAAGTCAGCCAAGAGATGTGTTAAAGG
ACTGAAGATGGAGGAGGAAGGCACAGAAGATAATGGCCTGGAAGACGATTCCAGAGACGGGCAGGAGGACATGGAAGCAAGTCTGGAGAA
CCTGCAGAATATGGGCATGATGGACATGAGTGTGCTAGACGAAACTGAAGTGGCGAATAGCAGTGCTCCAGATTTTGGGGAGGATGGCAC
GGACGGCCTTCTCGATTCCTTTTGTGATAGTAAAGAATACGTGGCTGCACAGCTGAGACAGCTCCCGGCTCAGCCCCCAGAGCATGCTGT
GGATGGGGAAGGATTTAAGAACACTTTGGAAACTTCATCGTTGAACTTCAAAGTAACTCCGGACATTGAAGAATCCCTTTTGGAGCCAGA
AAATGAGAAAATACTCGACATTTTGGGGGAAACTTGTAAATCTGAGCCAGTAAAAGAAGAAAGTTCCGAGCTGGAGCAGCCATTTGCACA
GGACACAAGTAGCGTGGGGCCAGACAGAAAGCTTGCGGAGGAAGAGGACCTATTTGACAGCGCCCATCCGGAAGAGGGTGATTTAGATTT
GGCCAGCGAGTCAACAGCACACGCTCAGTCGAGCAAGGCAGACAGCCTGTTAGCGGTAGTGAAAAGGGAGCCCGCGGAGCAGCCAGGCGA
TGGCGAGAGGACGGACTGTGAGCCTGTAGGGCTAGAGCCGGCAGTTGAGCAGAGTAGTGCGGCCTCCGAGCTCGCGGAGGCCTCTAGCGA
GGAGCTCGCAGAAGCACCCACGGAAGCCCCAAGCCCAGAAGCCAGAGATAGCAAAGAAGACGGGAGGAAGTTTGATTTTGACGCTTGTAA
TGAAGTCCCTCCGGCTCCTAAAGAGTCCTCAACCAGTGAGGGCGCTGATCAGAAAATGAGCTCTTTTAAGGAAGAAAAAGATATAAAGCC
AATCATTAAAGATGAAAAAGGTCGGGTCGGCAGCGGTTCTGGTCGGAACCTGTGGGTCAGCGGGCTGTCCTCCACAACACGCGCTACGGA
TCTCAAGAACCTTTTCAGCAAGTATGGGAAGGTTGTCGGGGCCAAAGTGGTAACGAACGCCCGCAGCCCGGGGGCTCGATGCTATGGATT
CGTCACCATGTCGACATCTGACGAGGCGACCAAGTGCATCAGCCATCTCCACAGAACTGAGCTGCATGGACGAATGATCTCCGTAGAGAA
GGCCAAAAATGAGCCTGCTGGGAAAAAGCTTTCCGACAGAAAAGAGTGCGAAGTGAAGAAGGAAAAATTATCGAGTGTCGACAGACATCA
TTCTGTGGAGATCAAAATTGAAAAAACTGTAATTAAGAAGGAAGAGAAGATTGAGAAGAAGGAGGAAAAAAAGCCTGAAGACATTAAGAA
GGAAGAAAAAGACCAGGATGAGCTGAAACCCGGACCTACAAATCGGTCTAGAGTCACCAAATCAGGAAGCAGAGGAATGGAGCGGACGGT
CGTGATGGATAAATCGAAAGGAGAGCCCGTCATTAGCGTGAAAACCACAAGCAGGTCCAAAGAGAGAGCCCTGACTGCAGAGATCGTGAA
GACCATCCGGGACATCATTGCCTTGAACCCTCTCTACAGGGAGTCAGTGCTGCAGATGATGCAGGCTGGCCAGCGGGTGGTGGACAACCC
CATCTACCTGAGCGACATGGGCGCCGCGCTCACCGGGGCCGAGTCCCATGAGCTGCAGGACGTCCTGGAAGAGACCAATATTCCTAAGCG
GCTGTACAAGGCCCTCTCCCTGCTGAAGAAGGAATTTGAACTGAGCAAGCTGCAGCAGCGCCTGGGGCGGGAGGTGGAGGAGAAGATCAA
GCAGACCCACCGTAAGTACCTGCTGCAGGAGCAGCTAAAGATCATCAAGAAGGAGCTGGGCCTGGAGAAGGACGACAAGGATGCCATCGA
GGAGAAGTTCCGGGAGCGCCTGAAGGAGCTCGTGGTCCCCAAGCACGTCATGGATGTTGTGGACGAGGAGCTGAGCAAGCTGGGCCTGCT
GGACAACCACTCCTCGGAGTTCAATGTCACCCGCAACTACCTAGACTGGCTCACGTCCATCCCTTGGGGCAAGTACAGCAACGAGAACCT
GGACCTGGCGCGGGCACAGGCAGTGCTGGAGGAAGACCACTACGGCATGGAGGACGTCAAGAAACGCATCCTGGAGTTCATTGCCGTTAG
CCAGCTCCGCGGCTCCACCCAGGGCAAGATCCTCTGCTTCTATGGCCCCCCTGGCGTGGGTAAGACCAGCATTGCTCGCTCCATCGCCCG
CGCCCTGAACCGAGAGTACTTCCGCTTCAGCGTCGGGGGCATGACTGACGTGGCTGAGATCAAGGGCCACAGGCGGACCTACGTGGGCGC
CATGCCCGGGAAGATCATCCAGTGTTTGAAGAAGACCAAGACGGAGAACCCCCTGATCCTCATCGACGAGGTGGACAAGATCGGCCGAGG
CTACCAGGGGGACCCGTCGTCGGCACTGCTGGAGCTGCTGGACCCAGAGCAGAATGCCAACTTCCTGGACCACTACCTGGACGTGCCCGT
GGACTTGTCCAAGGTGCTGTTCATCTGCACGGCCAACGTCACGGACACCATCCCCGAGCCGCTGCGAGACCGTATGGAGATGATCAACGT
GTCGGGCTACGTGGCCCAGGAGAAGCTGGCCATTGCGGAGCGCTACCTGGTGCCCCAGGCTCGCGCCCTGTGTGGCTTGGATGAGAGCAA
GGCCAAGCTGTCATCGGACGTGCTGACGCTGCTCATCAAGCAGTACTGCCGCGAGAGCGGTGTCCGCAACCTGCAGAAGCAAGTGGAGAA
GGTGTTACGGAAATCGGCCTACAAGATTGTCAGCGGCGAGGCCGAGTCCGTGGAGGTGACGCCCGAGAACCTGCAGGACTTCGTGGGGAA
GCCCGTGTTCACCGTGGAGCGCATGTATGACGTGACACCGCCCGGCGTGGTCATGGGGCTGGCCTGGACCGCAATGGGAGGCTCCACGCT
GTTTGTGGAGACATCCCTGAGACGGCCACAGGACAAGGATGCCAAGGGTGACAAGGATGGCAGCCTGGAGGTGACAGGCCAGCTGGGGGA
GGTGATGAAGGAGAGCGCCCGCATAGCCTACACCTTCGCCAGAGCCTTCCTCATGCAGCACGCCCCCGCCAATGACTACCTGGTGACCTC
ACACATCCACCTGCATGTGCCCGAGGGCGCCACCCCCAAGGACGGCCCAAGCGCAGGCTGCACCATCGTCACGGCCCTGCTGTCCCTGGC
CATGGGCAGGCCTGTCCGGCAGAATCTGGCCATGACTGGCGAAGTCTCCCTCACGGGCAAGATCCTGCCTGTTGGTGGCATCAAGGAGAA
GACCATTGCGGCCAAGCGCGCAGGGGTGACGTGCATCGTCCTGCCAGCCGAGAACAAGAAGGACTTCTACGACCTGGCAGCCTTCATCAC
CGAGGGCCTGGAGGTGCACTTCGTGGAACACTACCGGGAGATCTTCGACATCGCCTTCCCGGACGAGCAGGCAGAGGCGCTGGCCGTGGA


Top

FusionGenePPI for SAFB2_LONP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
SAFB2SAFB, ESR1, SORBS3, CHGB, MAP1LC3A, RB1CC1, NCOR1, HDAC3, TOPORS, CUL3, COPS5, CAND1, SRCAP, IK, APOA1, FNTA, FUS, GIT2, ZSCAN18, MOV10, CUL7, OBSL1, EZH2, SUZ12, EED, BMI1, TP53, RSPH9, RBMX, FNDC4, ZFP41, HNRNPUL1, CCAR1, SSB, HNRNPA1, MYO1C, PPP1CB, PPP1CC, EMC2, MATR3, MPHOSPH8, CAMKK1, MEX3C, ELAVL2, DHPS, TRIP6, APOBEC3D, CAPN13, CIZ1, CLK3, COX15, VDAC1, G3BP1LONP1USP2, ATG101, GBAS, MYC, ICT1, MME, PSMA3, SIRT7, CUL1, A2M, CDC37, CYP2C8, ECSIT, IFIT3, IFIT5, LOXL4, MAST1, RNF32, APOE, DYNC1H1, C1QBP, ITGA4, SOX2, ADRB2, LATS2, ILK, TUBG1, CUL7, EGFR, C9orf173, GCAT, CLPX, PSMC4, PSMC5, SF3B1, TATDN1, NTRK1, CEP162, OFD1, CEP164, CNTRL, RPGRIP1L, DCTN1, NDUFS7, LRPPRC, ATL3, MTMR11, KLHDC8A, C19orf45, RASL10B, DCAF12L2, MRPL4, DCAF4, NEU4, FOXRED1, UPF3A, C9orf24, MRPS24, MKLN1, COQ2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneSAFB2chr19:5598804chr19:5708414ENST00000252542-1321600_953594954SAFB1
HgeneSAFB2chr19:5621320chr19:5692219ENST00000252542-221600_95391954SAFB1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for SAFB2_LONP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for SAFB2_LONP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneLONP1C1838180CODAS syndrome2ORPHANET;UNIPROT