FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32318

FusionGeneSummary for RSU1_LARP4B

check button Fusion gene summary
Fusion gene informationFusion gene name: RSU1_LARP4B
Fusion gene ID: 32318
HgeneTgene
Gene symbol

RSU1

LARP4B

Gene ID

6251

23185

Gene nameRas suppressor protein 1La ribonucleoprotein domain family member 4B
SynonymsRSP-1KIAA0217|LARP5
Cytomap

10p13

10p15.3

Type of geneprotein-codingprotein-coding
Descriptionras suppressor protein 1ras suppressor protein 1 variant 1ras suppressor protein 1 variant 2ras suppressor protein 1 variant 3ras suppressor protein 1 variant 5rsu-1la-related protein 4BLa ribonucleoprotein domain family, member 5la-related protein 5
Modification date2018052220180519
UniProtAcc

Q15404

Q92615

Ensembl transtripts involved in fusion geneENST00000377921, ENST00000345264, 
ENST00000602389, ENST00000464074, 
ENST00000316157, ENST00000469487, 
Fusion gene scores* DoF score6 X 4 X 6=1445 X 5 X 3=75
# samples 66
** MAII scorelog2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/75*10)=-0.321928094887362
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RSU1 [Title/Abstract] AND LARP4B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVCHOLTCGA-W5-AA2U-01ARSU1chr10

16858972

-LARP4Bchr10

863829

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000377921ENST00000316157RSU1chr10

16858972

-LARP4Bchr10

863829

-
5CDS-intronENST00000377921ENST00000469487RSU1chr10

16858972

-LARP4Bchr10

863829

-
Frame-shitENST00000345264ENST00000316157RSU1chr10

16858972

-LARP4Bchr10

863829

-
5CDS-intronENST00000345264ENST00000469487RSU1chr10

16858972

-LARP4Bchr10

863829

-
intron-3CDSENST00000602389ENST00000316157RSU1chr10

16858972

-LARP4Bchr10

863829

-
intron-intronENST00000602389ENST00000469487RSU1chr10

16858972

-LARP4Bchr10

863829

-
intron-3CDSENST00000464074ENST00000316157RSU1chr10

16858972

-LARP4Bchr10

863829

-
intron-intronENST00000464074ENST00000469487RSU1chr10

16858972

-LARP4Bchr10

863829

-

Top

FusionProtFeatures for RSU1_LARP4B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RSU1

Q15404

LARP4B

Q92615

Potentially plays a role in the Ras signal transductionpathway. Capable of suppressing v-Ras transformation in vitro. Stimulates mRNA translation.{ECO:0000269|PubMed:20573744}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-29110_13336278RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-29135_15636278RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-29158_17936278RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-29181_20236278RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-2941_6336278RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-2964_8536278RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr10:863829ENST00000345264-2987_10936278RepeatNote=LRR 3
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-18110_13336278RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-18135_15636278RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-18158_17936278RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-18181_20236278RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-1841_6336278RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-1864_8536278RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr10:863829ENST00000377921-1887_10936278RepeatNote=LRR 3
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-18110_133-64225RepeatNote=LRR 4
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-18135_156-64225RepeatNote=LRR 5
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-18158_179-64225RepeatNote=LRR 6
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-18181_202-64225RepeatNote=LRR 7
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-1841_63-64225RepeatNote=LRR 1
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-1864_85-64225RepeatNote=LRR 2
HgeneRSU1chr10:16858972chr10:863829ENST00000602389-1887_109-64225RepeatNote=LRR 3
TgeneLARP4Bchr10:16858972chr10:863829ENST00000316157-1217150_239510739DomainHTH La-type RNA-binding
TgeneLARP4Bchr10:16858972chr10:863829ENST00000316157-1217240_307510739DomainNote=RRM


Top

FusionGeneSequence for RSU1_LARP4B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_LARP4B_ENST00000316157_chr10_863829_-_265aa
MSKSLKKLVEESREKNQPEVDMSDRGISNMLDVNGL_QPDTVSNATKASVAKLRAGAVQLPSITWSCRQFEDRGLV_KQAI_LDNRTIQR
KDPQCRRKREHPSCSGLQRALGAGFLCCISNVRAIPLPSSFTR_SQGGGETEGNPQCGQTSFRPHCDRV_IGAGERSRHGIAKAQLRRDL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_LARP4B_ENST00000316157_chr10_863829_-_796nt
ATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGGTGGACATGAGTGACCGGGGCATCTCCAACATG
CTGGATGTCAACGGCCTCTAGCAGCCAGACACAGTCTCCAACGCCACCAAAGCCTCCGTCGCCAAGCTTCGAGCTGGGGCTGTCCAGCTT
CCCTCCATTACCTGGAGCTGCCGGCAATTTGAAGACAGAGGACTTGTTTGAAAACAGGCTATCTAGCTTGATAATAGGACCATCCAAAGA
AAGGACCCTCAGTGCAGACGCAAGCGTGAACACCCTTCCTGTAGTGGTCTCCAGAGAGCCCTCGGTGCCGGCTTCTTGTGCTGTATCAGC
AACGTACGAGCGATCCCCCTCCCCAGCTCATTTACCCGATGATCCCAAGGTGGCGGAGAAACAGAGGGAAACCCACAGTGTGGACAGACT
TCCTTCCGCCCTCACTGCGACCGCGTGTAAATCGGTGCAGGTGAACGGAGCCGCCACGGAATTGCGAAAGCCCAGCTACGCAGAGATTTG
TCAGAGAACGAGTAAAGAGCCTCCTTCTTCCCCATTGCAACCCCAAAAAGAACAAAAGCCAAACACTGTTGGTTGTGGGAAGGAGGAAAA
GAAGCTGGCAGAGCCCGCAGAGAGATACCGGGAGCCCCCAGCCCTCAAGTCCACACCTGGAGCCCCCAGAGACCAGAGGCGGCCGGCGGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RSU1_ENST00000377921_chr10_16858972_-_LARP4B_ENST00000316157_chr10_863829_-_4480nt
GGGCAGCTGGAGTGCGTTCTGCCGAAGCTTGTGGTTGCACGCCCATCGTCTTAGGGGCTACCTTCCGTGGTGAGTGTGTGCGGTGTTGCA
CTTGGGGTTGCTTCTCGCTGCGTGGCCGCAGCGGGGCTGAACCCTTCCCACTCCATCCCCTCCCCGCACCCGGACCAGCCCCTGGGACGC
CCTCGGACGCCCACCCGCTCCAACCCTGGGGAAGCCTCAGAGTGGCAGCGAAGGCCTCTTGCCTTTCCGCCTCTGCGCTTGCTGTCATCG
CCCACGTGCTTTGTTGTTGTTCGGTGCAGACCATGTCCAAGTCTCTGAAGAAGTTGGTGGAGGAGAGCCGGGAGAAGAACCAGCCCGAGG
TGGACATGAGTGACCGGGGCATCTCCAACATGCTGGATGTCAACGGCCTCTAGCAGCCAGACACAGTCTCCAACGCCACCAAAGCCTCCG
TCGCCAAGCTTCGAGCTGGGGCTGTCCAGCTTCCCTCCATTACCTGGAGCTGCCGGCAATTTGAAGACAGAGGACTTGTTTGAAAACAGG
CTATCTAGCTTGATAATAGGACCATCCAAAGAAAGGACCCTCAGTGCAGACGCAAGCGTGAACACCCTTCCTGTAGTGGTCTCCAGAGAG
CCCTCGGTGCCGGCTTCTTGTGCTGTATCAGCAACGTACGAGCGATCCCCCTCCCCAGCTCATTTACCCGATGATCCCAAGGTGGCGGAG
AAACAGAGGGAAACCCACAGTGTGGACAGACTTCCTTCCGCCCTCACTGCGACCGCGTGTAAATCGGTGCAGGTGAACGGAGCCGCCACG
GAATTGCGAAAGCCCAGCTACGCAGAGATTTGTCAGAGAACGAGTAAAGAGCCTCCTTCTTCCCCATTGCAACCCCAAAAAGAACAAAAG
CCAAACACTGTTGGTTGTGGGAAGGAGGAAAAGAAGCTGGCAGAGCCCGCAGAGAGATACCGGGAGCCCCCAGCCCTCAAGTCCACACCT
GGAGCCCCCAGAGACCAGAGGCGGCCGGCGGGGGGCCGGCCCTCGCCCTCGGCCATGGGGAAGCGTCTCAGCCGAGAGCAGAGCACTCCC
CCCAAGTCTCCTCAGTGAAAACCGTACGTCTGGGAGGGGTCGCAGAGCGCTGTGTTAACCACAAACGAGACACTCTCCCACTCAGTGCGA
GGGCGAGCCGCTGGTTAGGAGCTTGCAGTGTCTGAGGCCTGTGGGATCCTCAAGTTGGTTTTCTTCTGTGAGTTGGATTCTCCCCCTCTT
GAAAAAAAATCGATTTTTCAGGATTTAATTAATACAAACCTTATTTTAGGTTGGTGCTTAACTGGAGGTGATGCATAAGTCTGATTTTTT
TTTCCAAGATAGAAAAAGCATTTATCCTAACAAATTGGTATTTTTTATTAAGCCTCCATGTGGCTCTGAATGCAAGCTATATATAGTGAG
TTTTTCTAAATTAAGGGAACTCTGCTTTTTTTTTTTTTTTTTAAGTAACTGGTCTGTAAGTGCATATCTCTAGAACGTCCCCGCAGATGA
ATGAGGGCCAGTGGCCTTGGCAGAGGCAGGTGTGGCCTCGTAGAGGCAGTGCTGGCCGCGCCAGGGCATCAGTGCTGATGTGGGAGCTGT
GCTTCCACCTAAGCCGTTGGTAGGGGACTGTGGCATTTAAGAATGTAGAGAGCGCATCCTTTTTGATCTCCTGGGCGGAGTGAACCTGCA
GGGGCCACCCCAGAAACCTTGGTTCTGATGCACTGCAAGCAAGTAACCAGCTTCTCACTCCAGTTTCAAGTGGCTATTATGTAATATAAA
TTCAAAGCACATTGTGAATAGAACCTACATGAAAACATACACTTTGTTGCCCACTGACATGTTACCAGAAGTTGTACCATGATGTTGTTT
TGACCCCTGTGAGCTGATGGCCCCGGCCCTGCTCTGTGCACATTTCTGTCCGTGTTCCCCAGCACTCTGGTTGGAGAGAGTCCACATCTT
CAGCTCCGTGTGGACATCTCCCTGTACCTCTGCATCAGCACATGGATTTAAGAGTTATGTAATCGTGAGAGAATGGTGTTTGTGGTTTTT
CCCCCTCTTTGGCTGGTGGAGGATAAAGTTCCTGCTCTTTTACCTCCAAGACGAGGGCCTCATTGATTCACTTCCAGAAGTGCTGCACTT
CTGAAGAACAAGGATGCACTAAAGTTAGCAAGTTTATAATAAAGTTAAATATAAATTATTTTGTTTTAAAATGCCTCAAATTTTTCTTTA
TTCTAAGCAGCAAACATTAAAATAAGAATATTTCCTGCTAAATGTAACCATACACTTTATTCCACAAAATGTTATTTAACAAGACTGAGG
GTTTTTTTTAAGAAAAAATTATTTCCATCCAATATTTAAAGACTTGAATTTTATTTAAACTTGAAAATGACTTTGCCTTAACTTTTGTAT
AAGACAGCTTAGAGTCCATGGAGCCCGGCCCTGGGTTGGCGTGAGTGGGTCAGAGTTACTCAGTTACTGCGTGGATCTCCTGTCGCTAGT
TTTACTGAGTAAGCATACTGTAGTACAAGAGCTAGTAGTAGTTTTTGTAATATACCTTAAAGATCTTCAACAGTTGATCTTTTTTCAGAA
TGTTGGAAAATCCTGTAAATGCAAATAGTCAATACTGTATTAAATACGTGCACTTGGAGTGTGCTTCGCTTGTACAGTTGTAAATAATCA
GAACATATGAAAAAGGTACCCTACAGAGAAAATTCTGATACAGATTATTGATATATTATAAATGTTGCTGTTGAGCGGGATGTAGATAAA
CTAAATGTTGTGGTTTGAATATTATTTTGATTTGTTGAGATTTTCTTTTTTCTCTTACATCGGTGTGTTGAACTGATTCTGCCTCTTTGC
TGCAAAAGGGAATTGGAAAGTCTTATTAAAAGCCTCCAGATGTTTTCATACTCTTTTAAAATGTATGTAAATGCATACTAATCATATCTA
ATGTGAAAGAGTTTTAAAGTATATAGAGAGCAAAAACTGGCAGGATCGTAAGTGAAGGTGACTAGTAATCTAATTTAAATCACCTGCAGC
TAAGCATGATTGACCCTGCCAGAGGAAAACATGCCTATTTGACCATTTCCTTTAAAGCAGTTGCCATTATTCAAATACAGAGAAATAGCC
ACAGGGCTAGTGTTTTTCAAATGCATTTTAAAGAACATGGGGATTTTTTTTTGTAGTTGTCAGTTCACTGACCAAAAAAAAAAAAAAAAT
CAGAAATAATTGATCTGTGAAACCCAAACTCTCAATACTCAGAAAGCTGGGAGGCAACCTCGAGGCCTGGGCCTACGAGCTGCATCTTCG
CTACGGAAGGGCCAGGGCGCCATCAGCCATTCCCAAAACACAAGGCCTGCCCGTCCGCCAGTGAGTCCTTGGTTTTTAATAATGAGAAGT
CCTTTCCCCCAAGGTGTGAGCATTGCAGCGCAGTGTGTGTGTGTGGTTAGAGCCAGCTTAGTCCTTCACTTTGTCGACCGAAGTGGGAGC
TCAACAGCTGCATGAGGAGGGCAGCGCGTGCATTAGCCAGTCGCCACTGGAGGGCTCTGCTGCCCTCCGGTCAATACACTGTAGTTACTG
CCTAGCCAGCAGCAGTCTTCTGCATCAAGAACTGAAACGTTGCTCGGAGGTGATTTTTATAGCATCCTTTTTAATTAAAGGTGAAATACA
GATTGCTATATAATGTCTGAAAAAACCTGATACTACTTCAAGAGTTTCTGCTCAGAAGAAAATGAGAGTTATCATAATAGGAAGCTGTGG
CGGTCCATGCCAACTGTGCTGTGTCACATACAGCGATGAGAGTGGCTTTCATACTTTTTTTTTTTTTAAGTTAACACCCTCCTTTACCCC
CAGCAGTATCTCAGGTTATAGAATCAGAGATGCAGCAGTGACAAATGGCATTTTAACTTGTAAAATCGTGTGATGATGCTTATCATTTTG
AAATAGAAGAATAAAAACCTGGTCCCGTTTCACCAGACATGAATTTCAAGTGGAGTCGTCGTTCTCTGAGAGTGAGTGTCTTGACATTTT
CACCCAGGCCCTCCTGTCATCACATCACCGGCTGTCACTGGCGGGTGGCCGTAAACGTCCTGCGTTGCTATATTAGGATCTCTGCAGTTC
AGGCTTCAAAACCAGTTCAGTGTATCCGGGCGACGGGTAGTGGTGGTGCATGCCTGTCTGTGTGCCCCGCTGGCGAGCTGTAGTTGCGGC
TTGCGTGCCTCGCGGCCCACTACAGGGCTGCAGACAATCGAGGCGAGGGCGCTGGCCGCCAGCAGCTCACAGCGCGGGGGTCATGTGGTC
GCTCCTCGAGGGTTTCGTTTTTGTTCTGCTTCATTAAGACTGGAATCAAGCTTACATGTAAACTATTGGTAATTTAAGTTTCCTTTTGTG


Top

FusionGenePPI for RSU1_LARP4B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RSU1ACP6, ILK, HGS, GSK3B, ELAVL1, LRRK1, APP, VCP, FN1, LRCH3, FAM114A1, PARVA, PPAT, SEC24D, SUGT1, LIMS1, PARVB, PARVG, CBS, HNRNPA3, NDUFA8, NTMT1, PFKP, DAZAP1, DHX15, FLNB, HADH, USP3, TIAL1, TKTLARP4BGNB2L1, ELAVL1, SIRT7, CUL3, COPS5, CDV3, HSP90AA1, MMS19, CDK18, HECW2, LIN28A, FHL3, RBFOX2, NTRK1, IFI16, XPO1, NPM1, RPL10, STRAP, FAM136A, ASB3, IL13RA2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RSU1_LARP4B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RSU1_LARP4B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRSU1C0029456Osteoporosis1CTD_human
HgeneRSU1C0263454Chloracne1CTD_human