FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32291

FusionGeneSummary for RSF1_PRRC2C

check button Fusion gene summary
Fusion gene informationFusion gene name: RSF1_PRRC2C
Fusion gene ID: 32291
HgeneTgene
Gene symbol

RSF1

PRRC2C

Gene ID

51773

23215

Gene nameremodeling and spacing factor 1proline rich coiled-coil 2C
SynonymsHBXAP|RSF-1|XAP8|p325BAT2-iso|BAT2D1|BAT2L2|XTP2
Cytomap

11q14.1

1q24.3

Type of geneprotein-codingprotein-coding
Descriptionremodeling and spacing factor 1HBV pX-associated protein 8hepatitis B virus x-associated proteinp325 subunit of RSF chromatin-remodeling complexprotein PRRC2CBAT2 domain containing 1BAT2 domain-containing protein 1HBV X-transactivated gene 2 proteinHBV XAg-transactivated protein 2HBxAg transactivated protein 2HLA-B-associated transcript 2-like 2proline-rich and coiled-coil-containing prote
Modification date2018052320180523
UniProtAcc

Q96T23

Q9Y520

Ensembl transtripts involved in fusion geneENST00000308488, ENST00000360355, 
ENST00000480887, ENST00000530604, 
ENST00000426496, ENST00000392078, 
ENST00000476522, ENST00000367742, 
ENST00000338920, 
Fusion gene scores* DoF score15 X 8 X 9=108011 X 13 X 4=572
# samples 1716
** MAII scorelog2(17/1080*10)=-2.66742466091313
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(16/572*10)=-1.83794324189103
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RSF1 [Title/Abstract] AND PRRC2C [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRSF1

GO:0006334

nucleosome assembly

12972596

HgeneRSF1

GO:0006338

chromatin remodeling

9836642

HgeneRSF1

GO:0006352

DNA-templated transcription, initiation

9836642

HgeneRSF1

GO:0016584

nucleosome positioning

9836642

HgeneRSF1

GO:0043392

negative regulation of DNA binding

12972596

HgeneRSF1

GO:0045892

negative regulation of transcription, DNA-templated

11944984

HgeneRSF1

GO:0045893

positive regulation of transcription, DNA-templated

11788598

HgeneRSF1

GO:0050434

positive regulation of viral transcription

11788598


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A3U5-01ARSF1chr11

77396150

-PRRC2Cchr1

171535372

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308488ENST00000426496RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
In-frameENST00000308488ENST00000392078RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000308488ENST00000476522RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000308488ENST00000367742RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000308488ENST00000338920RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
In-frameENST00000360355ENST00000426496RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
In-frameENST00000360355ENST00000392078RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000360355ENST00000476522RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000360355ENST00000367742RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000360355ENST00000338920RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
In-frameENST00000480887ENST00000426496RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
In-frameENST00000480887ENST00000392078RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000480887ENST00000476522RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000480887ENST00000367742RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
5CDS-intronENST00000480887ENST00000338920RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
intron-3CDSENST00000530604ENST00000426496RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
intron-3CDSENST00000530604ENST00000392078RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
intron-intronENST00000530604ENST00000476522RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
intron-intronENST00000530604ENST00000367742RSF1chr11

77396150

-PRRC2Cchr1

171535372

+
intron-intronENST00000530604ENST00000338920RSF1chr11

77396150

-PRRC2Cchr1

171535372

+

Top

FusionProtFeatures for RSF1_PRRC2C


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RSF1

Q96T23

PRRC2C

Q9Y520

Required for assembly of regular nucleosome arrays bythe RSF chromatin-remodeling complex (PubMed:12972596).Facilitates transcription of hepatitis B virus (HBV) genes by thepX transcription activator. In case of infection by HBV, togetherwith pX, it represses TNF-alpha induced NF-kappa-B transcriptionactivation. Represses transcription when artificially recruited tochromatin by fusion to a heterogeneous DNA binding domain(PubMed:11944984, PubMed:11788598). {ECO:0000269|PubMed:11788598,ECO:0000269|PubMed:11944984, ECO:0000269|PubMed:12972596}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-1016226_3729851442Compositional biasNote=Glu-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-1016875_8849851442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-915226_3729541411Compositional biasNote=Glu-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-915875_8849541411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-511226_3727331190Compositional biasNote=Glu-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-101617_849851442DomainNote=DDT
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-91517_849541411DomainNote=DDT
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-51117_847331190DomainNote=DDT
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-1016891_9419851442Zinc fingerPHD-type
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-915891_9419541411Zinc fingerPHD-type
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19342345_263420372818Compositional biasNote=Gln-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19352345_263420392899Compositional biasNote=Gln-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19322345_263420372753Compositional biasNote=Gln-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-1016942_10129851442Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-915942_10129541411Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-511942_10127331190Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-10161080_10839851442Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-10161146_12439851442Compositional biasNote=Arg-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-10161286_12929851442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000308488-10161419_14249851442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-9151080_10839541411Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-9151146_12439541411Compositional biasNote=Arg-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-9151286_12929541411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000360355-9151419_14249541411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-5111080_10837331190Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-5111146_12437331190Compositional biasNote=Arg-rich
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-5111286_12927331190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-5111419_14247331190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-511875_8847331190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77396150chr1:171535372ENST00000480887-511891_9417331190Zinc fingerPHD-type
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19341020_104620372818Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19341682_171720372818Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19351020_104620392899Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19351682_171720392899Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19321020_104620372753Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19321682_171720372753Coiled coilOntology_term=ECO:0000255
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19341059_108220372818Compositional biasNote=Pro-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19341341_144320372818Compositional biasNote=Arg-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+19341760_193420372818Compositional biasNote=Ala-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+1934407_41020372818Compositional biasNote=Poly-Pro
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+1934467_65020372818Compositional biasNote=Glu-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+1934666_70320372818Compositional biasNote=Gln-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000338920+1934697_76920372818Compositional biasNote=Pro-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19351059_108220392899Compositional biasNote=Pro-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19351341_144320392899Compositional biasNote=Arg-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+19351760_193420392899Compositional biasNote=Ala-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+1935407_41020392899Compositional biasNote=Poly-Pro
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+1935467_65020392899Compositional biasNote=Glu-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+1935666_70320392899Compositional biasNote=Gln-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000392078+1935697_76920392899Compositional biasNote=Pro-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19321059_108220372753Compositional biasNote=Pro-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19321341_144320372753Compositional biasNote=Arg-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+19321760_193420372753Compositional biasNote=Ala-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+1932407_41020372753Compositional biasNote=Poly-Pro
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+1932467_65020372753Compositional biasNote=Glu-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+1932666_70320372753Compositional biasNote=Gln-rich
TgenePRRC2Cchr11:77396150chr1:171535372ENST00000426496+1932697_76920372753Compositional biasNote=Pro-rich


Top

FusionGeneSequence for RSF1_PRRC2C


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_1701aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANV
LEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDER
VAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSP
PSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEE
STALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQGAKNG
QESGLEIGTDTIQFGAPASNGNENEVVPVLSEKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKPGPIGKERSLKNRKVKDAQ
QVEPEGQEKPSPATVRSTDPVTTKETKAVSEMSTEIGTMISVSSAETGTNAKMESARKAWENSPNVREKGSPVTSTAPPIATGVSSSASG
PSTANYNSFSSASMPQIPVASVTPTASLSGAGTYTTSSLSTKSTTTSDPPNICKVKPQQLQTSSLPSASHFSQLSCMPSLIAQQQQNPQV
TVSQSAAAQIPAFTMDTSHLFNTQHARLAPPSLAQQQGFQPGLSQPTSVQQIPIPITAPLQGQHQAQLSLGAGPAVSQAQELFSSSLQPT
RSQPAFMQSSLSQPSVVLSGTAIHNFPTVQHQELAKAQSGLAFQQTSNTQPIPILTEHQLGQASGLGGSQLIDTHLLQARANLTQASNLT
SGQVQQPGQTNFTNTAQSPSALQQVTVPLPASQLSLPNFGSTGQPLIALPQTLQPPLQHTTPQAQAQSLSRPAQVSQPFRGLIPAGTQHS
MIATTGKMSEMELKAFGSGIDIKPGTPPIAGRSTTPTSSPFRATSTSPNSQSSKMNSIVYQKQFQSAPATVRMTQPFPTQFAPQAKQRAE

>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_1845aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQ
DDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANV
LEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSS
HEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDER
VAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETS
LDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSP
PSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASE
NTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEE
STALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLP
NHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQGAKNG
QESGLEIGTDTIQFGAPASNGNENEVVPVLSEKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKPGPIGKERSLKNRKVKDAQ
QVEPEGQEKPSPATVRSTDPVTTKETKAVSEMSTEIGTMISVSSAETGTNAKESVTDTTTPSSSLPNTVATNNTKMEDTLVNNVPLPNTL
PLPKRETIQQSSSLTSVPPTTFSLTFKMESARKAWENSPNVREKGSPVTSTAPPIATGVSSSASGPSTANYNSFSSASMPQIPVASVTPT
ASLSGAGTYTTSSLSTKSTTTSDPPNICKVKPQQLQTSSLPSASHFSQLSCMPSLIAQQQQNPQVTVSQSAAAQIPAFTMDTSHLFNTQH
ARLAPPSLAQQQGFQPGLSQPTSVQQIPIPITAPLQGQHQAQLSLGAGPAVSQAQELFSSSLQPTRSQPAFMQSSLSQPSVVLSGTAIHN
FPTVQHQELAKAQSGLAFQQTSNTQPIPILTEHQLGQASGLGGSQLIDTHLLQARANLTQASNLTSGQVQQPGQTNFTNTAQSPSALQQV
TVPLPASQLSLPNFGSTGQPLIALPQTLQPPLQHTTPQAQAQSLSRPAQVSQPFRGLIPAGTQHSMIATTGKMSEMELKAFGSGIDIKPG
TPPIAGRSTTPTSSPFRATSTSPNSQSSKMNSIVYQKQFQSAPATVRMTQPFPTQFAPQILSQPNLVPPLVRAPHTNTFPAPVQRPPMAL
ASQMPPPLTTGLMSHARLPHVARGPCGSLSGVRGNQAQAALKAEQDMKAKQRAEVLQSTQRFFSEQQQSKQIGGGKAQKVDSDSSKPPET

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_1670aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDP
VLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLPE
NEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSSHEITEKSTEETEKLKNDQQAKIPLKKREIKL
SDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFTETKEESTSPSKDRNII
TEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTESCTMKGEEKSP
KTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQSV
KKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPPK
VLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPKG
KVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLPNHPELILLCDSCDSGYHTACLRPPLMIIPDG
EWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQGAKNGQESGLEIGTDTIQFGAPASNGNENEVVPVLS
EKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKPGPIGKERSLKNRKVKDAQQVEPEGQEKPSPATVRSTDPVTTKETKAVSE
MSTEIGTMISVSSAETGTNAKMESARKAWENSPNVREKGSPVTSTAPPIATGVSSSASGPSTANYNSFSSASMPQIPVASVTPTASLSGA
GTYTTSSLSTKSTTTSDPPNICKVKPQQLQTSSLPSASHFSQLSCMPSLIAQQQQNPQVTVSQSAAAQIPAFTMDTSHLFNTQHARLAPP
SLAQQQGFQPGLSQPTSVQQIPIPITAPLQGQHQAQLSLGAGPAVSQAQELFSSSLQPTRSQPAFMQSSLSQPSVVLSGTAIHNFPTVQH
QELAKAQSGLAFQQTSNTQPIPILTEHQLGQASGLGGSQLIDTHLLQARANLTQASNLTSGQVQQPGQTNFTNTAQSPSALQQVTVPLPA
SQLSLPNFGSTGQPLIALPQTLQPPLQHTTPQAQAQSLSRPAQVSQPFRGLIPAGTQHSMIATTGKMSEMELKAFGSGIDIKPGTPPIAG
RSTTPTSSPFRATSTSPNSQSSKMNSIVYQKQFQSAPATVRMTQPFPTQFAPQAKQRAEVLQSTQRFFSEQQQSKQIGGGKAQKVDSDSS

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_1814aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDP
VLLKNSSQQDNSSRESPSLEDEETKKEEETPKQEEQKESEKMKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLPE
NEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEKPVAQEPERIEFGGNIKSSHEITEKSTEETEKLKNDQQAKIPLKKREIKL
SDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTITALGHEGKQLVNGEVSDERVAPNFKTEPIETKFTETKEESTSPSKDRNII
TEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEIHSQKAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTESCTMKGEEKSP
KTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPKSTLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQSV
KKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQKSKFKTKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPPK
VLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIRDQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPKG
KVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKESEEAILADDDEPCKKCGLPNHPELILLCDSCDSGYHTACLRPPLMIIPDG
EWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLVTVGISIENIIPPQGAKNGQESGLEIGTDTIQFGAPASNGNENEVVPVLS
EKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKPGPIGKERSLKNRKVKDAQQVEPEGQEKPSPATVRSTDPVTTKETKAVSE
MSTEIGTMISVSSAETGTNAKESVTDTTTPSSSLPNTVATNNTKMEDTLVNNVPLPNTLPLPKRETIQQSSSLTSVPPTTFSLTFKMESA
RKAWENSPNVREKGSPVTSTAPPIATGVSSSASGPSTANYNSFSSASMPQIPVASVTPTASLSGAGTYTTSSLSTKSTTTSDPPNICKVK
PQQLQTSSLPSASHFSQLSCMPSLIAQQQQNPQVTVSQSAAAQIPAFTMDTSHLFNTQHARLAPPSLAQQQGFQPGLSQPTSVQQIPIPI
TAPLQGQHQAQLSLGAGPAVSQAQELFSSSLQPTRSQPAFMQSSLSQPSVVLSGTAIHNFPTVQHQELAKAQSGLAFQQTSNTQPIPILT
EHQLGQASGLGGSQLIDTHLLQARANLTQASNLTSGQVQQPGQTNFTNTAQSPSALQQVTVPLPASQLSLPNFGSTGQPLIALPQTLQPP
LQHTTPQAQAQSLSRPAQVSQPFRGLIPAGTQHSMIATTGKMSEMELKAFGSGIDIKPGTPPIAGRSTTPTSSPFRATSTSPNSQSSKMN
SIVYQKQFQSAPATVRMTQPFPTQFAPQILSQPNLVPPLVRAPHTNTFPAPVQRPPMALASQMPPPLTTGLMSHARLPHVARGPCGSLSG
VRGNQAQAALKAEQDMKAKQRAEVLQSTQRFFSEQQQSKQIGGGKAQKVDSDSSKPPETLTDPPGVCQEKVEEKPPPAPSIATKPVRTGP

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_1449aa
MKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEK
PVAQEPERIEFGGNIKSSHEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTIT
ALGHEGKQLVNGEVSDERVAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEI
HSQKAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPK
STLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQ
KSKFKTKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIR
DQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKES
EEAILADDDEPCKKCGLPNHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLV
TVGISIENIIPPQGAKNGQESGLEIGTDTIQFGAPASNGNENEVVPVLSEKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKP
GPIGKERSLKNRKVKDAQQVEPEGQEKPSPATVRSTDPVTTKETKAVSEMSTEIGTMISVSSAETGTNAKMESARKAWENSPNVREKGSP
VTSTAPPIATGVSSSASGPSTANYNSFSSASMPQIPVASVTPTASLSGAGTYTTSSLSTKSTTTSDPPNICKVKPQQLQTSSLPSASHFS
QLSCMPSLIAQQQQNPQVTVSQSAAAQIPAFTMDTSHLFNTQHARLAPPSLAQQQGFQPGLSQPTSVQQIPIPITAPLQGQHQAQLSLGA
GPAVSQAQELFSSSLQPTRSQPAFMQSSLSQPSVVLSGTAIHNFPTVQHQELAKAQSGLAFQQTSNTQPIPILTEHQLGQASGLGGSQLI
DTHLLQARANLTQASNLTSGQVQQPGQTNFTNTAQSPSALQQVTVPLPASQLSLPNFGSTGQPLIALPQTLQPPLQHTTPQAQAQSLSRP
AQVSQPFRGLIPAGTQHSMIATTGKMSEMELKAFGSGIDIKPGTPPIAGRSTTPTSSPFRATSTSPNSQSSKMNSIVYQKQFQSAPATVR
MTQPFPTQFAPQAKQRAEVLQSTQRFFSEQQQSKQIGGGKAQKVDSDSSKPPETLTDPPGVCQEKVEEKPPPAPSIATKPVRTGPIKPQA

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_1593aa
MKSEEQPMDLENRSTANVLEETTVKKEKEDEKELVKLPVIVKLEKPLPENEEKKIIKEESDSFKENVKPIKVEVKECRADPKDTKSSMEK
PVAQEPERIEFGGNIKSSHEITEKSTEETEKLKNDQQAKIPLKKREIKLSDDFDSPVKGPLCKSVTPTKEFLKDEIKQEEETCKRISTIT
ALGHEGKQLVNGEVSDERVAPNFKTEPIETKFTETKEESTSPSKDRNIITEGNGTESLNSVITSMKTGELEKETAPLRKDADSSISVLEI
HSQKAQIEEPDPPEMETSLDSSEMAKDLSSKTALSSTESCTMKGEEKSPKTKKDKRPPILECLEKLEKSKKTFLDKDAQRLSPIPEEVPK
STLESEKPGSPEAAETSPPSNIIDHCEKLASEKEVVECQSTSTVGGQSVKKVDLETLKEDSEFTKVEMDNLDNAQTSGIEEPSETKGSMQ
KSKFKTKLVPEEETTASENTEITSERQKEGIKLTIRISSRKKKPDSPPKVLEPENKQEKTEKEEEKTNVGRTLRRSPRISRPTAKVAEIR
DQKADKKRGEGEDEVEEESTALQKTDKKEILKKSEKDTNSKVSKVKPKGKVRWTGSRTRGRWKTSSNDESEGSGSEKSSAASEEEEEKES
EEAILADDDEPCKKCGLPNHPELILLCDSCDSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLV
TVGISIENIIPPQGAKNGQESGLEIGTDTIQFGAPASNGNENEVVPVLSEKSADKIPEPKEQRQKQPRAGPIKAQKLPDLSPVENKEHKP
GPIGKERSLKNRKVKDAQQVEPEGQEKPSPATVRSTDPVTTKETKAVSEMSTEIGTMISVSSAETGTNAKESVTDTTTPSSSLPNTVATN
NTKMEDTLVNNVPLPNTLPLPKRETIQQSSSLTSVPPTTFSLTFKMESARKAWENSPNVREKGSPVTSTAPPIATGVSSSASGPSTANYN
SFSSASMPQIPVASVTPTASLSGAGTYTTSSLSTKSTTTSDPPNICKVKPQQLQTSSLPSASHFSQLSCMPSLIAQQQQNPQVTVSQSAA
AQIPAFTMDTSHLFNTQHARLAPPSLAQQQGFQPGLSQPTSVQQIPIPITAPLQGQHQAQLSLGAGPAVSQAQELFSSSLQPTRSQPAFM
QSSLSQPSVVLSGTAIHNFPTVQHQELAKAQSGLAFQQTSNTQPIPILTEHQLGQASGLGGSQLIDTHLLQARANLTQASNLTSGQVQQP
GQTNFTNTAQSPSALQQVTVPLPASQLSLPNFGSTGQPLIALPQTLQPPLQHTTPQAQAQSLSRPAQVSQPFRGLIPAGTQHSMIATTGK
MSEMELKAFGSGIDIKPGTPPIAGRSTTPTSSPFRATSTSPNSQSSKMNSIVYQKQFQSAPATVRMTQPFPTQFAPQILSQPNLVPPLVR
APHTNTFPAPVQRPPMALASQMPPPLTTGLMSHARLPHVARGPCGSLSGVRGNQAQAALKAEQDMKAKQRAEVLQSTQRFFSEQQQSKQI


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_5103nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGT
CTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAA
GATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGAT
CCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAA
ACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTT
CTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCA
GAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGA
GCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCT
CACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAA
CTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAA
GAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGG
GTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATC
ATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGG
AAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCT
CTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCT
CCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCA
CAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCA
CCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCT
GTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGC
ATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAA
AATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCC
AAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGA
ATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAG
TCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAA
GGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCA
TCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCA
AACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGAT
GGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAG
AAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGT
CAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTT
TCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCA
GATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAA
CAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCA
GAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCAAAGATGGAGTCTGCACGCAAAGCATGG
GAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGA
CCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGA
GCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTA
CAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTT
TATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCG
CCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTG
CAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATAT
AGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAA
CACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTG
GGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTAT
TCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCA
GCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACC
ACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGC
ATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCT
GGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTAC
CAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTTGCACCCCAGGCAAAGCAGAGAGCAGAG
GTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCA
AGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACC

>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_5535nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGT
CTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAA
GATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGAT
CCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAA
ACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTT
CTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCA
GAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGA
GCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCT
CACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAA
CTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAA
GAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGG
GTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATC
ATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGG
AAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCT
CTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCT
CCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCA
CAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCA
CCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCT
GTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGC
ATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAA
AATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCC
AAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGA
ATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAG
TCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAA
GGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCA
TCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCA
AACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGAT
GGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAG
AAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGT
CAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTT
TCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCA
GATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAA
CAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCA
GAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCAAAGGAGTCTGTAACAGACTATACTACA
CCCTCTTCTTCTTTGCCTAACACCGTGGCTACTAATAATACAAAGATGGAGGATACTTTGGTTAATAATGTGCCCCTGCCCAACACCCTT
CCCCTCCCTAAGAGGGAGACTATACAACAGAGCTCCAGCCTAACTTCAGTTCCTCCCACTACTTTCAGCCTCACCTTCAAGATGGAGTCT
GCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGC
AGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACA
GCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTG
AAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAA
CAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTCAATACCCAACAT
GCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCT
ATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCC
TCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAAC
TTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTG
TATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAG
GCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTT
ACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCC
CCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCT
GGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGC
ACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATG
AACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTTGCACCCCAGATT
CTCTCCCAGCCTAACCTGGTCCCTCCATTGGTAAGAGCCCCACATACTAACACCTTCCCAGCGCCTGTTCAGAGGCCACCAATGGCACTG
GCCAGTCAGATGCCTCCTCCGCTGACCACAGGCCTCATGAGCCATGCTCGTTTGCCACATGTAGCCAGGGGTCCTTGTGGATCACTATCT
GGAGTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAGGCTGAACAAGACATGAAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAA
CGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACA
CTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGA

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_5010nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGTCTC
CAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAAGAT
GATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGATCCT
GTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACA
CCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTA
GAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAA
AATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCA
GATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCAC
GAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTG
AGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAG
GAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTA
GCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATC
ACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAA
GATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTT
GATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCC
AAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAA
AGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCA
TCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTG
AAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATA
GAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAAT
ACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAA
GTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATA
TCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCA
ACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGC
AAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCT
GCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAAC
CATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGA
GAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAA
GAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAA
GAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCG
GAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGAT
TTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAG
GTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAA
ATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCAAAGATGGAGTCTGCACGCAAAGCATGGGAG
AATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCA
AGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCT
GGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAG
ACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTAT
GTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCA
TCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAA
GGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGA
TCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACAC
CAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGG
CAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCT
GGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCA
TCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACT
CCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATG
ATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGT
AGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAG
AAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTTGCACCCCAGGCAAAGCAGAGAGCAGAGGTT
CTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGT
AAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAA

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_5442nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATTAATGAGGAGGATGCCGATACTATGCGTCTC
CAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCACAATGTCAGAATGTACATAGAAGAACAAGAT
GATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACTCTTGCACTCCTGAAAGCACAAATTGATCCT
GTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACA
CCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTA
GAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAA
AATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCA
GATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCAC
GAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTG
AGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAG
GAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTA
GCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATC
ACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAA
GATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTT
GATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCC
AAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAA
AGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCA
TCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTG
AAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATA
GAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAAT
ACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAA
GTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATA
TCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCA
ACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGC
AAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCT
GCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAAC
CATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGA
GAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAA
GAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAA
GAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCG
GAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGAT
TTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAG
GTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAA
ATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCAAAGGAGTCTGTAACAGACTATACTACACCC
TCTTCTTCTTTGCCTAACACCGTGGCTACTAATAATACAAAGATGGAGGATACTTTGGTTAATAATGTGCCCCTGCCCAACACCCTTCCC
CTCCCTAAGAGGGAGACTATACAACAGAGCTCCAGCCTAACTTCAGTTCCTCCCACTACTTTCAGCCTCACCTTCAAGATGGAGTCTGCA
CGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGT
AGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCA
TCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAA
CCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAG
AATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTCAATACCCAACATGCA
CGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATT
TATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCA
CTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTT
CCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTGTAT
GAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCC
TCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACA
GTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCA
TTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGA
ACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACA
CCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAAC
AGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTTGCACCCCAGATTCTC
TCCCAGCCTAACCTGGTCCCTCCATTGGTAAGAGCCCCACATACTAACACCTTCCCAGCGCCTGTTCAGAGGCCACCAATGGCACTGGCC
AGTCAGATGCCTCCTCCGCTGACCACAGGCCTCATGAGCCATGCTCGTTTGCCACATGTAGCCAGGGGTCCTTGTGGATCACTATCTGGA
GTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAGGCTGAACAAGACATGAAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGG
TTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTG
ACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCA

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_4347nt
ATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGAT
GAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGT
GATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAG
CCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAG
AAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCT
TTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACT
GCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACA
AAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCT
GTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATC
CATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCA
AAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTA
GAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAG
AGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCC
TCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGAT
TCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAA
AAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGC
ATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACA
GAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGA
GATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATT
TTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGC
AGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGT
GAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGC
GATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTG
CTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTG
TATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATT
CAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAA
GAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCT
GGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCA
GCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTA
TCATCTGCAGAATATGGTACTAATGCAAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCA
GTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCA
TCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAA
TCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCA
CAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCC
TTCTATATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGT
CTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCT
GGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCC
CAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCC
TTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATT
GACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTT
TATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACA
GGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCT
GCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAA
CTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGG
GCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGA
ATGACACAACCATTTCCTACACAGTTTGCACCCCAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAG
CAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGG
GTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCAATCAAACCTCAGGCG

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_4779nt
ATGAAAAGTGAGGAGCAGCCTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGAT
GAAAAGGAACTTGTGAAACTGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGT
GATTCCTTCAAGGAAAATGTCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAG
CCAGTGGCACAGGAGCCTGAAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAG
AAACTTAAAAATGACCAGCAGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCT
TTGTGTAAATCAGTTACTCCAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACT
GCTTTGGGTCATGAAGGGAAACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACA
AAGTTTTATGAGACAAAGGAAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCT
GTCATAACAAGTATGAAAACAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATC
CATAGTCAAAAAGCACAAATAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCA
AAAACTGCTTTATCTTCCACCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTA
GAATGTCTTGAAAAGTTAGAGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAG
AGTACTCTAGAGTCAGAAAAGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCC
TCAGAAAAAGAAGTGGTAGAATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGAT
TCTGAGTTCACAAAGGTAGAAATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAA
AAAAGCAAATTCAAATATAAGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGC
ATCAAATTAACAATCAGGATATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACA
GAAAAGGAAGAGGAGAAAACAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGA
GATCAGAAAGCTGATAAAAAAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATT
TTGAAAAAATCAGAGAAAGATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGC
AGATGGAAATATTCCAGCAATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGT
GAAGAAGCCATCCTAGCAGATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGC
GATAGTGGATACCATACTGCCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTG
CTCTGTGAAAAATTAGAGGAACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTG
TATGTTGGTATCAGTATTGAAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATT
CAGTTTGGTGCTCCAGCCTCAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAA
GAACAGCGGCAGAAGCAGCCACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCT
GGTCCCATTGGAAAGGAACGTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCA
GCTACAGTCAGAAGCACAGATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTA
TCATCTGCAGAATATGGTACTAATGCAAAGGAGTCTGTAACAGACTATACTACACCCTCTTCTTCTTTGCCTAACACCGTGGCTACTAAT
AATACAAAGATGGAGGATACTTTGGTTAATAATGTGCCCCTGCCCAACACCCTTCCCCTCCCTAAGAGGGAGACTATACAACAGAGCTCC
AGCCTAACTTCAGTTCCTCCCACTACTTTCAGCCTCACCTTCAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGG
GAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAAT
TCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCT
TCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCT
GCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCA
GCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAG
GGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAA
CTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATG
CAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCA
CAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGA
GGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCT
GGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCT
AATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAG
AGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAA
ATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACA
TCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCC
CCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTTGCACCCCAGATTCTCTCCCAGCCTAACCTGGTCCCTCCATTGGTAAGA
GCCCCACATACTAACACCTTCCCAGCGCCTGTTCAGAGGCCACCAATGGCACTGGCCAGTCAGATGCCTCCTCCGCTGACCACAGGCCTC
ATGAGCCATGCTCGTTTGCCACATGTAGCCAGGGGTCCTTGTGGATCACTATCTGGAGTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAG
GCTGAACAAGACATGAAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATA
GGAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTA
GAAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCAATCAAACCTCAGGCGATCAAAACCGAAGAAACA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_5406nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAAT
ATTATTAATGAGGAGGATGCCGATACTATGCGTCTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAA
GATCACAATGTCAGAATGTACATAGAAGAACAAGATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCT
GAGACTCTTGCACTCCTGAAAGCACAAATTGATCCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGC
TTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCT
ATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTG
CCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTC
AAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAA
AGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAG
GCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCA
ACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAA
CAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAA
GAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACA
GGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATA
GAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACC
GAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAG
AAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAG
CCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAA
TGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAA
ATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAG
TTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATA
TCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACA
AATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAA
AGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGAT
ACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAAT
GATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGAT
GATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCC
TGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAA
CAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAA
AACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCA
AATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCA
CGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGT
TCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGAT
CCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACT
AATGCAAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCA
ATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTT
GCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCT
CCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCC
CTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCAT
TTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTT
CAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCT
CAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCT
GGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACT
CAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCC
AGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCA
AGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTG
CCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTC
AGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGC
ATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAAC
AGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACA
CAGTTTGCACCCCAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGA
GGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAA
GAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCAATCAAACCTCAGGCGATCAAAACCGAAGAAACAAAA

>In-frame_RSF1_ENST00000308488_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_5838nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAAT
ATTATTAATGAGGAGGATGCCGATACTATGCGTCTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAA
GATCACAATGTCAGAATGTACATAGAAGAACAAGATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCT
GAGACTCTTGCACTCCTGAAAGCACAAATTGATCCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGC
TTAGAGGATGAGGAGACTAAAAAAGAGGAAGAAACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCT
ATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTG
CCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTC
AAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAA
AGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAG
GCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCA
ACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAA
CAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAA
GAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACA
GGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATA
GAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACC
GAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAG
AAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAG
CCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAA
TGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAA
ATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAG
TTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATA
TCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACA
AATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAA
AGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGAT
ACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAAT
GATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGAT
GATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCC
TGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAA
CAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAA
AACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCA
AATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCA
CGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGT
TCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGAT
CCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACT
AATGCAAAGGAGTCTGTAACAGACTATACTACACCCTCTTCTTCTTTGCCTAACACCGTGGCTACTAATAATACAAAGATGGAGGATACT
TTGGTTAATAATGTGCCCCTGCCCAACACCCTTCCCCTCCCTAAGAGGGAGACTATACAACAGAGCTCCAGCCTAACTTCAGTTCCTCCC
ACTACTTTCAGCCTCACCTTCAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACT
TCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATG
CCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACA
ACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTA
AGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTAT
ATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCT
CAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCT
GCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCA
TCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAG
CAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACA
CATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAAC
ACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAA
CCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAA
GTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAA
GCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACT
TCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACA
CAACCATTTCCTACACAGTTTGCACCCCAGATTCTCTCCCAGCCTAACCTGGTCCCTCCATTGGTAAGAGCCCCACATACTAACACCTTC
CCAGCGCCTGTTCAGAGGCCACCAATGGCACTGGCCAGTCAGATGCCTCCTCCGCTGACCACAGGCCTCATGAGCCATGCTCGTTTGCCA
CATGTAGCCAGGGGTCCTTGTGGATCACTATCTGGAGTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAGGCTGAACAAGACATGAAGGCA
AAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAA
GTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCA

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_5130nt
GATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCCCCC
ATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGC
CCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTG
CTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAA
TCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATT
AATGAGGAGGATGCCGATACTATGCGTCTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCAC
AATGTCAGAATGTACATAGAAGAACAAGATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACT
CTTGCACTCCTGAAAGCACAAATTGATCCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAG
GATGAGGAGACTAAAAAAGAGGAAGAAACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGAT
TTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTC
ATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCC
ATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATC
GAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAG
ATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAA
GAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTG
GTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGC
TATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAG
CTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAA
CCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCG
TGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCC
AAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGC
TCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAG
AGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGAT
AATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTT
CCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGT
CGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTG
GGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGG
GAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAAT
TCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAA
AGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGAT
GAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTT
CGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTG
CAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATC
ATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGA
AATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCA
GGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTA
AAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTC
ACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCA
AAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTCCAATTGCA
ACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTGTTGCTTCA
GTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACCCTCCAAAT
ATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTTCCCTTATT
GCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTCATTTATTC
AATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAGTTCAGCAG
ATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGGCTCAGGAA
TTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTTCTGGTACT
GCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATACTCAGCCC
ATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGGCCAGAGCA
AATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCACCAAGTGCT
CTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTTTGCCTCAG
ACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTTTCAGAGGA
TTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTGGCATTGAT
ATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGAACAGCCAG
TCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTACACAGTTT
GCACCCCAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGC
AAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAG
CCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCAATCAAACCTCAGGCGATCAAAACCGAAGAAACAAAATCTTAA

>In-frame_RSF1_ENST00000360355_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_5562nt
GATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCCCCC
ATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGC
CCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTG
CTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAA
TCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGTACCTCTGTGAGTGTCAGTTTGATGACAATCTCAAATTCAAGAATATTATT
AATGAGGAGGATGCCGATACTATGCGTCTCCAGCCAATTGGTCGAGACAAAGATGGCCTCATGTACTGGTACCAATTGGATCAAGATCAC
AATGTCAGAATGTACATAGAAGAACAAGATGATCAAGATGGCTCTTCATGGAAATGCATTGTCAGAAATCGAAACGAGTTGGCTGAGACT
CTTGCACTCCTGAAAGCACAAATTGATCCTGTACTATTGAAAAACTCTAGCCAACAAGACAACTCTTCTCGGGAAAGTCCCAGCTTAGAG
GATGAGGAGACTAAAAAAGAGGAAGAAACACCTAAACAAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGCCTATGGAT
TTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAACTGCCAGTC
ATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATGTCAAACCC
ATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTGAAAGGATC
GAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGCAGGCCAAG
ATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTCCAACAAAA
GAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGAAACAGCTG
GTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGGAAGAGAGC
TATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAACAGGTGAG
CTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAATAGAGGAA
CCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCACCGAGTCG
TGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAGAGAAGTCC
AAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAAAGCCTGGC
TCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAGAATGCCAG
AGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAGAAATGGAT
AATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATAAGTTGGTT
CCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGATATCAAGT
CGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAACAAATGTG
GGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAAAAAGAGGG
GAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAGATACAAAT
TCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCAATGATGAA
AGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAGATGATGAT
GAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTGCCTGCCTT
CGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGGAACAGTTG
CAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTGAAAACATC
ATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCTCAAATGGA
AATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGCCACGAGCA
GGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAACGTTCATTA
AAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAGATCCTGTC
ACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTACTAATGCA
AAGGAGTCTGTAACAGACTATACTACACCCTCTTCTTCTTTGCCTAACACCGTGGCTACTAATAATACAAAGATGGAGGATACTTTGGTT
AATAATGTGCCCCTGCCCAACACCCTTCCCCTCCCTAAGAGGGAGACTATACAACAGAGCTCCAGCCTAACTTCAGTTCCTCCCACTACT
TTCAGCCTCACCTTCAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACA
GCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAG
ATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACA
TCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGT
ATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGAC
ACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCA
ACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTT
TCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTG
GTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACA
TCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTT
CTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCC
CAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTA
ATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGC
CAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTT
GGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACA
AGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCA
TTTCCTACACAGTTTGCACCCCAGATTCTCTCCCAGCCTAACCTGGTCCCTCCATTGGTAAGAGCCCCACATACTAACACCTTCCCAGCG
CCTGTTCAGAGGCCACCAATGGCACTGGCCAGTCAGATGCCTCCTCCGCTGACCACAGGCCTCATGAGCCATGCTCGTTTGCCACATGTA
GCCAGGGGTCCTTGTGGATCACTATCTGGAGTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAGGCTGAACAAGACATGAAGGCAAAGCAG
AGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGAAAGTGGAC
AGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTGCACCCTCC

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000426496_chr1_171535372_+_5408nt
CTGGTTTATCAACTTGACGAGAATCATTTCAAAATTTTAGGAAAAAAATTTATGTCTCAGTAAAACTTTGTTTAGAATTAGGTTTTTCAG
TAGCAAGGATAAGGTGAAGGGATTAAAAATGTACGTAAAATTAGTAGTCAATGAATTCTGGAATGCAGTCTGTATAATCCTATTCAGAGA
TTATGCTATTTACTGAATATAGCTTTGGTTGTGTTTAAATCTGCACTAGTATTAGGTGCTCCTTAAAAGTTGAAAATATATAGCCAATAA
GGTATAAAGAAGAATTGACAGATAAATCTAAACAGTTTCTTTGTATAGTACTAACTTCTGAAATGTTCAGTGGTGGCATTTGATAAAGTA
AGTTGTAATATGATCACATTGAGGAATGTTATATAATTATTAAACTCAATTTTTATAAAAGGCATCATTTTATAAAAGTATCATAAGAAA
GTGCCAATGTTTCAATGAATAAATTGAGGCAACATGATACCAACTTAGTGAAAAATATACAAGACCAGAAGGAAGTAACCTAAAATATTA
CTAGTGATTGCCTCTGGGTAATAGGATATGGGCTTTTTGTCTTTCTATATTTTTCATTTTCCCACTGCCGTGTTCCTGGTACCTCAGTGA
AATGAAGTGCTCAGTTCTTTTAACAGTTGTCAGTTTTTAAAACAAATATAGTCTTCTGGAAATGTTTTAGGTAGCATTTTCAATTTTATG
TTTTTAAGCCATCTCTTGAATTTGAATAAATTATTTGAACTGCATAAATATTTGCAATCCATTGAGAACACCAAAACAAAAAGTAAAAAG
CAGAAACCTAAATTTTTCTAAATTTTTTTTAATATCTAGAAGTTGTATCTCAAAGTTTTTGTAATTTTCTTCATTGTCAGATTTTATTTT
TTACTGTCAAATATCCAATGACAGAGGCCACCTCTTTTAAAATAGAAACTTTAAATGGAAATATACATTATACTAAGTCTTATATTTTAT
AGCCTTGAAAGTTTCTATTCATGTAATTAAGCTTTTTCTGATTTTTAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGC
CTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAAC
TGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATG
TCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTG
AAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGC
AGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTC
CAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGA
AACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGG
AAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAA
CAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAA
TAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCA
CCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAG
AGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAA
AGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAG
AATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAG
AAATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATA
AGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGA
TATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAA
CAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAA
AAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAG
ATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCA
ATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAG
ATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTG
CCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGG
AACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTG
AAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCT
CAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGC
CACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAAC
GTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAG
ATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTA
CTAATGCAAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAACTTCCACAGCACCTC
CAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCATGCCCCAGATTCCTG
TTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTACAACCACATCGGACC
CTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGTTAAGCTGTATGCCTT
CCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCTATATGGACACAAGTC
ATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCTCTCAGCCAACTTCAG
TTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCCCTGCTGTTTCCCAGG
CTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGCCATCTGTGGTCCTTT
CTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTCAGCAAACATCAAATA
CTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACACACATCTTCTCCAGG
CCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATAACACTGCCCAGTCAC
CAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGCAACCTCTAATTGCTT
TGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCACAAGTAAGCCAGCCTT
TCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAAAAGCCTTTGGAAGTG
GCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTACTTCTACAAGTCCGA
ACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGACACAACCATTTCCTA
CACAGTTTGCACCCCAGGCAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAG
GAGGAGGCAAAGCCCAGAAAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAG
AAGAAAAGCCACCCCCTGCACCCTCCATAGCCACCAAACCTGTTAGAACTGGACCAATCAAACCTCAGGCGATCAAAACCGAAGAAACAA

>In-frame_RSF1_ENST00000480887_chr11_77396150_-_PRRC2C_ENST00000392078_chr1_171535372_+_5840nt
CTGGTTTATCAACTTGACGAGAATCATTTCAAAATTTTAGGAAAAAAATTTATGTCTCAGTAAAACTTTGTTTAGAATTAGGTTTTTCAG
TAGCAAGGATAAGGTGAAGGGATTAAAAATGTACGTAAAATTAGTAGTCAATGAATTCTGGAATGCAGTCTGTATAATCCTATTCAGAGA
TTATGCTATTTACTGAATATAGCTTTGGTTGTGTTTAAATCTGCACTAGTATTAGGTGCTCCTTAAAAGTTGAAAATATATAGCCAATAA
GGTATAAAGAAGAATTGACAGATAAATCTAAACAGTTTCTTTGTATAGTACTAACTTCTGAAATGTTCAGTGGTGGCATTTGATAAAGTA
AGTTGTAATATGATCACATTGAGGAATGTTATATAATTATTAAACTCAATTTTTATAAAAGGCATCATTTTATAAAAGTATCATAAGAAA
GTGCCAATGTTTCAATGAATAAATTGAGGCAACATGATACCAACTTAGTGAAAAATATACAAGACCAGAAGGAAGTAACCTAAAATATTA
CTAGTGATTGCCTCTGGGTAATAGGATATGGGCTTTTTGTCTTTCTATATTTTTCATTTTCCCACTGCCGTGTTCCTGGTACCTCAGTGA
AATGAAGTGCTCAGTTCTTTTAACAGTTGTCAGTTTTTAAAACAAATATAGTCTTCTGGAAATGTTTTAGGTAGCATTTTCAATTTTATG
TTTTTAAGCCATCTCTTGAATTTGAATAAATTATTTGAACTGCATAAATATTTGCAATCCATTGAGAACACCAAAACAAAAAGTAAAAAG
CAGAAACCTAAATTTTTCTAAATTTTTTTTAATATCTAGAAGTTGTATCTCAAAGTTTTTGTAATTTTCTTCATTGTCAGATTTTATTTT
TTACTGTCAAATATCCAATGACAGAGGCCACCTCTTTTAAAATAGAAACTTTAAATGGAAATATACATTATACTAAGTCTTATATTTTAT
AGCCTTGAAAGTTTCTATTCATGTAATTAAGCTTTTTCTGATTTTTAGAGGAACAGAAAGAAAGTGAAAAGATGAAAAGTGAGGAGCAGC
CTATGGATTTAGAAAACCGTTCTACAGCCAATGTTCTAGAAGAGACTACTGTGAAAAAAGAAAAAGAAGATGAAAAGGAACTTGTGAAAC
TGCCAGTCATAGTGAAGCTAGAAAAACCTTTGCCAGAAAATGAAGAAAAAAAGATTATCAAAGAAGAAAGTGATTCCTTCAAGGAAAATG
TCAAACCCATTAAAGTTGAGGTGAAGGAATGTAGAGCAGATCCTAAAGATACCAAAAGTAGCATGGAGAAGCCAGTGGCACAGGAGCCTG
AAAGGATCGAATTTGGTGGCAATATTAAATCTTCTCACGAAATTACTGAGAAATCTACTGAAGAAACTGAGAAACTTAAAAATGACCAGC
AGGCCAAGATACCACTAAAAAAACGAGAAATTAAACTGAGTGATGATTTTGACAGTCCAGTCAAGGGACCTTTGTGTAAATCAGTTACTC
CAACAAAAGAGTTTTTGAAAGATGAAATAAAACAAGAGGAAGAGACTTGTAAAAGGATCTCTACAATCACTGCTTTGGGTCATGAAGGGA
AACAGCTGGTAAATGGAGAAGTTAGTGATGAAAGGGTAGCTCCAAATTTTAAGACAGAACCAATAGAGACAAAGTTTTATGAGACAAAGG
AAGAGAGCTATAGCCCCTCTAAGGACAGAAATATCATCACGGAGGGAAATGGAACAGAGTCCTTAAATTCTGTCATAACAAGTATGAAAA
CAGGTGAGCTTGAGAAAGAAACAGCCCCTTTGAGGAAAGATGCAGATAGTTCAATATCAGTCTTAGAGATCCATAGTCAAAAAGCACAAA
TAGAGGAACCCGATCCTCCAGAAATGGAAACTTCTCTTGATTCTTCTGAGATGGCAAAAGATCTCTCTTCAAAAACTGCTTTATCTTCCA
CCGAGTCGTGTACCATGAAAGGTGAAGAGAAGTCTCCCAAAACTAAGAAGGATAAGCGCCCACCAATCCTAGAATGTCTTGAAAAGTTAG
AGAAGTCCAAAAAGACTTTTCTTGATAAGGACGCACAAAGATTGAGTCCAATACCAGAAGAAGTTCCAAAGAGTACTCTAGAGTCAGAAA
AGCCTGGCTCTCCTGAGGCAGCTGAAACTTCTCCACCATCTAATATCATTGACCACTGTGAGAAACTAGCCTCAGAAAAAGAAGTGGTAG
AATGCCAGAGTACAAGTACTGTTGGTGGCCAGTCTGTGAAAAAAGTAGACCTAGAAACCCTAAAAGAGGATTCTGAGTTCACAAAGGTAG
AAATGGATAATCTGGACAATGCCCAGACCTCTGGCATAGAGGAGCCTTCTGAGACAAAGGGTTCTATGCAAAAAAGCAAATTCAAATATA
AGTTGGTTCCTGAAGAAGAAACCACTGCCTCAGAAAATACAGAGATAACCTCTGAAAGGCAGAAAGAGGGCATCAAATTAACAATCAGGA
TATCAAGTCGGAAAAAGAAGCCCGATTCTCCCCCCAAAGTTCTAGAACCAGAAAACAAGCAAGAGAAGACAGAAAAGGAAGAGGAGAAAA
CAAATGTGGGTCGTACTTTAAGAAGATCTCCAAGAATATCTAGACCCACTGCAAAAGTGGCTGAGATCAGAGATCAGAAAGCTGATAAAA
AAAGAGGGGAAGGAGAAGATGAGGTGGAAGAAGAGTCAACAGCTTTGCAAAAAACTGACAAAAAGGAAATTTTGAAAAAATCAGAGAAAG
ATACAAATTCTAAAGTAAGCAAGGTAAAACCCAAAGGCAAAGTTCGATGGACTGGTTCTCGGACACGTGGCAGATGGAAATATTCCAGCA
ATGATGAAAGTGAAGGGTCTGGCAGTGAAAAATCATCTGCAGCTTCAGAAGAGGAGGAAGAAAAGGAAAGTGAAGAAGCCATCCTAGCAG
ATGATGATGAACCATGCAAAAAATGTGGCCTTCCAAACCATCCTGAGCTAATTCTTCTGTGTGACTCTTGCGATAGTGGATACCATACTG
CCTGCCTTCGCCCTCCTCTGATGATCATCCCAGATGGAGAATGGTTCTGCCCACCTTGCCAACATAAACTGCTCTGTGAAAAATTAGAGG
AACAGTTGCAGGATTTGGATGTTGCCTTAAAGAAGAAAGAGCGTGCCGAACGAAGAAAAGAACGCTTGGTGTATGTTGGTATCAGTATTG
AAAACATCATTCCTCCACAAGGAGCGAAGAATGGTCAAGAAAGTGGACTCGAAATTGGAACTGACACAATTCAGTTTGGTGCTCCAGCCT
CAAATGGAAATGAAAATGAAGTTGTTCCTGTGCTTTCGGAAAAATCTGCTGACAAAATACCTGAACCTAAAGAACAGCGGCAGAAGCAGC
CACGAGCAGGACCTATCAAAGCCCAGAAGCTTCCAGATTTGAGTCCAGTAGAAAACAAAGAACACAAACCTGGTCCCATTGGAAAGGAAC
GTTCATTAAAAAATAGAAAAGTAAAAGATGCCCAACAGGTGGAGCCAGAAGGACAAGAGAAACCAAGCCCAGCTACAGTCAGAAGCACAG
ATCCTGTCACGACAAAGGAGACTAAAGCAGTCTCAGAAATGTCTACTGAAATAGGAACAATGATCTCGGTATCATCTGCAGAATATGGTA
CTAATGCAAAGGAGTCTGTAACAGACTATACTACACCCTCTTCTTCTTTGCCTAACACCGTGGCTACTAATAATACAAAGATGGAGGATA
CTTTGGTTAATAATGTGCCCCTGCCCAACACCCTTCCCCTCCCTAAGAGGGAGACTATACAACAGAGCTCCAGCCTAACTTCAGTTCCTC
CCACTACTTTCAGCCTCACCTTCAAGATGGAGTCTGCACGCAAAGCATGGGAGAATTCTCCAAATGTAAGGGAAAAGGGGTCTCCAGTAA
CTTCCACAGCACCTCCAATTGCAACTGGAGTCAGCAGTAGTGCCAGTGGACCAAGCACTGCTAATTACAATTCGTTCTCAAGTGCATCCA
TGCCCCAGATTCCTGTTGCTTCAGTCACTCCTACAGCATCACTATCAGGAGCTGGTACATACACTACCTCTTCTTTGAGCACAAAATCTA
CAACCACATCGGACCCTCCAAATATTTGTAAAGTGAAACCTCAGCAGTTACAGACAAGCAGCCTGCCTTCTGCAAGTCATTTTTCACAGT
TAAGCTGTATGCCTTCCCTTATTGCCCAGCAGCAACAGAATCCGCAAGTTTATGTGTCTCAGTCTGCAGCAGCTCAAATCCCAGCCTTCT
ATATGGACACAAGTCATTTATTCAATACCCAACATGCACGATTGGCTCCGCCATCCTTGGCTCAACAACAGGGTTTCCAACCAGGTCTCT
CTCAGCCAACTTCAGTTCAGCAGATTCCAATCCCTATTTATGCACCACTGCAAGGGCAGCATCAAGCCCAACTGAGTTTGGGGGCTGGCC
CTGCTGTTTCCCAGGCTCAGGAATTGTTCAGCTCCTCACTTCAACCATATAGATCTCAGCCAGCTTTTATGCAAAGCAGTTTATCCCAGC
CATCTGTGGTCCTTTCTGGTACTGCTATTCACAACTTTCCAACTGTCCAACACCAAGAACTTGCCAAGGCACAATCCGGTCTTGCCTTTC
AGCAAACATCAAATACTCAGCCCATTCCTATATTGTATGAACATCAACTGGGGCAGGCATCAGGACTAGGAGGTTCCCAGCTGATTGACA
CACATCTTCTCCAGGCCAGAGCAAATCTTACCCAGGCCTCAAATCTTTATTCTGGACAAGTACAACAGCCTGGTCAGACAAATTTTTATA
ACACTGCCCAGTCACCAAGTGCTCTCCAGCAGGTTACAGTACCTTTACCAGCATCGCAGCTTTCCTTGCCTAATTTTGGATCTACAGGGC
AACCTCTAATTGCTTTGCCTCAGACTCTTCAGCCCCCATTACAGCATACCACTCCCCAAGCACAGGCTCAGAGTCTGAGTCGTCCTGCAC
AAGTAAGCCAGCCTTTCAGAGGATTAATTCCTGCTGGAACACAGCATAGCATGATTGCAACCACAGGAAAAATGTCTGAAATGGAACTAA
AAGCCTTTGGAAGTGGCATTGATATAAAACCAGGCACACCTCCAATCGCTGGTAGAAGCACCACACCAACATCTAGTCCCTTCCGGGCTA
CTTCTACAAGTCCGAACAGCCAGTCCAGCAAAATGAACAGCATTGTCTACCAGAAGCAGTTCCAGTCAGCCCCTGCCACTGTGAGAATGA
CACAACCATTTCCTACACAGTTTGCACCCCAGATTCTCTCCCAGCCTAACCTGGTCCCTCCATTGGTAAGAGCCCCACATACTAACACCT
TCCCAGCGCCTGTTCAGAGGCCACCAATGGCACTGGCCAGTCAGATGCCTCCTCCGCTGACCACAGGCCTCATGAGCCATGCTCGTTTGC
CACATGTAGCCAGGGGTCCTTGTGGATCACTATCTGGAGTCAGAGGTAATCAGGCCCAGGCTGCGTTGAAGGCTGAACAAGACATGAAGG
CAAAGCAGAGAGCAGAGGTTCTTCAGTCCACGCAACGGTTCTTCTCTGAACAGCAACAGAGCAAACAGATAGGAGGAGGCAAAGCCCAGA
AAGTGGACAGTGATTCAAGTAAACCTCCTGAAACACTGACCGACCCTCCTGGGGTCTGTCAGGAAAAAGTAGAAGAAAAGCCACCCCCTG


Top

FusionGenePPI for RSF1_PRRC2C


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RSF1NFKB1, SMARCA5, CENPA, SIRT7, SP1, COPS6, CSNK2A1, HIST1H2BG, HIST1H3A, EWSR1, MARK2, ATXN3, KAT6A, MCM2PRRC2CELAVL1, SIRT7, HINFP, ITGA4, TARDBP, PARK2, LGR4, CSNK2A2, SHFM1, AURKA, AURKB, CEP57, HAUS2, CEP76, LGALS3BP, TP53, QPRT, FBL, RABGGTB, PRMT8, ZFP41, NTRK1, SRPK2, RPL10, C10orf12, FOXK2, ATOH1, JPH4, SNRNP70, CHCHD10, TRPC4AP, SFPQ, CYLD, TRIM25, G3BP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RSF1_PRRC2C


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RSF1_PRRC2C


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource