FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32287

FusionGeneSummary for RSF1_NARS2

check button Fusion gene summary
Fusion gene informationFusion gene name: RSF1_NARS2
Fusion gene ID: 32287
HgeneTgene
Gene symbol

RSF1

NARS2

Gene ID

51773

79731

Gene nameremodeling and spacing factor 1asparaginyl-tRNA synthetase 2, mitochondrial
SynonymsHBXAP|RSF-1|XAP8|p325DFNB94|SLM5|asnRS
Cytomap

11q14.1

11q14.1

Type of geneprotein-codingprotein-coding
Descriptionremodeling and spacing factor 1HBV pX-associated protein 8hepatitis B virus x-associated proteinp325 subunit of RSF chromatin-remodeling complexprobable asparagine--tRNA ligase, mitochondrialasparagine tRNA ligase 2, mitochondrial (putative)asparaginyl-tRNA synthetase 2, mitochondrial (putative)deafness, autosomal recessive 94probable asparaginyl-tRNA synthetase, mitochondrial
Modification date2018052320180519
UniProtAcc

Q96T23

Q96I59

Ensembl transtripts involved in fusion geneENST00000308488, ENST00000360355, 
ENST00000480887, ENST00000530604, 
ENST00000281038, ENST00000528850, 
Fusion gene scores* DoF score15 X 8 X 9=108020 X 8 X 9=1440
# samples 1720
** MAII scorelog2(17/1080*10)=-2.66742466091313
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(20/1440*10)=-2.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RSF1 [Title/Abstract] AND NARS2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRSF1

GO:0006334

nucleosome assembly

12972596

HgeneRSF1

GO:0006338

chromatin remodeling

9836642

HgeneRSF1

GO:0006352

DNA-templated transcription, initiation

9836642

HgeneRSF1

GO:0016584

nucleosome positioning

9836642

HgeneRSF1

GO:0043392

negative regulation of DNA binding

12972596

HgeneRSF1

GO:0045892

negative regulation of transcription, DNA-templated

11944984

HgeneRSF1

GO:0045893

positive regulation of transcription, DNA-templated

11788598

HgeneRSF1

GO:0050434

positive regulation of viral transcription

11788598


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSKCMTCGA-YG-AA3P-06ARSF1chr11

77531574

-NARS2chr11

78154804

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308488ENST00000281038RSF1chr11

77531574

-NARS2chr11

78154804

-
In-frameENST00000308488ENST00000528850RSF1chr11

77531574

-NARS2chr11

78154804

-
In-frameENST00000360355ENST00000281038RSF1chr11

77531574

-NARS2chr11

78154804

-
In-frameENST00000360355ENST00000528850RSF1chr11

77531574

-NARS2chr11

78154804

-
intron-3CDSENST00000480887ENST00000281038RSF1chr11

77531574

-NARS2chr11

78154804

-
intron-3CDSENST00000480887ENST00000528850RSF1chr11

77531574

-NARS2chr11

78154804

-
5UTR-3CDSENST00000530604ENST00000281038RSF1chr11

77531574

-NARS2chr11

78154804

-
5UTR-3CDSENST00000530604ENST00000528850RSF1chr11

77531574

-NARS2chr11

78154804

-

Top

FusionProtFeatures for RSF1_NARS2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RSF1

Q96T23

NARS2

Q96I59

Required for assembly of regular nucleosome arrays bythe RSF chromatin-remodeling complex (PubMed:12972596).Facilitates transcription of hepatitis B virus (HBV) genes by thepX transcription activator. In case of infection by HBV, togetherwith pX, it represses TNF-alpha induced NF-kappa-B transcriptionactivation. Represses transcription when artificially recruited tochromatin by fusion to a heterogeneous DNA binding domain(PubMed:11944984, PubMed:11788598). {ECO:0000269|PubMed:11788598,ECO:0000269|PubMed:11944984, ECO:0000269|PubMed:12972596}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-116942_1012621442Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-115942_1012621411Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-111942_1012-3541190Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-1161080_1083621442Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-1161146_1243621442Compositional biasNote=Arg-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-1161286_1292621442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-1161419_1424621442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-116226_372621442Compositional biasNote=Glu-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-116875_884621442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-1151080_1083621411Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-1151146_1243621411Compositional biasNote=Arg-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-1151286_1292621411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-1151419_1424621411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-115226_372621411Compositional biasNote=Glu-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-115875_884621411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-1111080_1083-3541190Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-1111146_1243-3541190Compositional biasNote=Arg-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-1111286_1292-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-1111419_1424-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-111226_372-3541190Compositional biasNote=Glu-rich
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-111875_884-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-11617_84621442DomainNote=DDT
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-11517_84621411DomainNote=DDT
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-11117_84-3541190DomainNote=DDT
HgeneRSF1chr11:77531574chr11:78154804ENST00000308488-116891_941621442Zinc fingerPHD-type
HgeneRSF1chr11:77531574chr11:78154804ENST00000360355-115891_941621411Zinc fingerPHD-type
HgeneRSF1chr11:77531574chr11:78154804ENST00000480887-111891_941-3541190Zinc fingerPHD-type


Top

FusionGeneSequence for RSF1_NARS2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_152aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEGCCC_SSGSWSWGTLWRRPQRRTIPFLR

>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_152aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEGCCC_SSGSWSWGTLWRRPQRRTIPFLR

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_152aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEGCCC_SSGSWSWGTLWRRPQRRTIPFLR

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_152aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEGCCC_SSGSWSWGTLWRRPQRRTIPFLR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_457nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGGCCTCAGAGAAGAACGATACCATTTCTTAGA
GGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCGATTTGGATCTGTGCCACATGGAGGTTTTGG
GATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTATCCCTTTCCCAAGGTTTCCTCATTCATGCCT

>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_457nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGGCCTCAGAGAAGAACGATACCATTTCTTAGA
GGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCGATTTGGATCTGTGCCACATGGAGGTTTTGG
GATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTATCCCTTTCCCAAGGTTTCCTCATTCATGCCT

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_457nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGGCCTCAGAGAAGAACGATACCATTTCTTAGA
GGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCGATTTGGATCTGTGCCACATGGAGGTTTTGG
GATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTATCCCTTTCCCAAGGTTTCCTCATTCATGCCT

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_457nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGGCCTCAGAGAAGAACGATACCATTTCTTAGA
GGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCGATTTGGATCTGTGCCACATGGAGGTTTTGG
GATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTATCCCTTTCCCAAGGTTTCCTCATTCATGCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_1469nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGG
AGGCCTCAGAGAAGAACGATACCATTTCTTAGAGGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCG
TCGATTTGGATCTGTGCCACATGGAGGTTTTGGGATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGT
TATCCCTTTCCCAAGGTTTCCTCATTCATGCCTTTTATAGCTGGAAGATTGGTTAAGGAAAAGCACCCCCCATGGCAGAGACACTGCACA
TGATTGTGCATACAGCAGAATGCATGTTTGGATTTTAGAAATGCAGATTTCAATATGTAATTGTTGTGCCATAAGATATCATAGAAAAAA
TATAAGTGGTTGTGATTTTCTTAGAAAGTTGAGGGTATTTCACGTAAGGATGAGCTCCCGCAAGAAGAGGTACTTATAGCAAGGGGACTC
TCAAATCCATTACCTCAATTAAGAAATGAAGAAATTGAATTAGTCTCAAAGTTTCTTTTAAACTCTAAAACAGAATGAGATAATGTATTT
TACGTTGTCTATAATCATTAAATCACTCCCTGTGTAATTTGTGAGAACCATCTAGTAGCTCGAAATAAAATAATGTTGCATCTTTTCTCC
CTTGCCATATACTTTGTGATAAATCCTTATCTCATTTTCAGTACTTCATTAAACATTGCAGAAAAAAATATTCCTTAAGGTCTTAATTGA
TTTAAAGAAGTAGCTATTCTGAATTGAAATCTCCTTTCATTGAACTGGATGAAAAAATCATGTTTAATAACTGTTGCTTTTCAATTTTCA
AAGCTGTTGAGATATTACATTAAGTATTTCAACTCTTTAATCACTGTTGTTATAATTTGTTTATATTTGATGTTTATAATTTGTCTAATA

>In-frame_RSF1_ENST00000308488_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_1207nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGG
AGGCCTCAGAGAAGAACGATACCATTTCTTAGAGGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCG
TCGATTTGGATCTGTGCCACATGGAGGTTTTGGGATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGT
TATCCCTTTCCCAAGGTTTCCTCATTCATGCCTTTTATAGCTGGAAGATTGGTTAAGGAAAAGCACCCCCCATGGCAGAGACACTGCACA
TGATTGTGCATACAGCAGAATGCATGTTTGGATTTTAGAAATGCAGATTTCAATATGTAATTGTTGTGCCATAAGATATCATAGAAAAAA
TATAAGTGGTTGTGATTTTCTTAGAAAGTTGAGGGTATTTCACGTAAGGATGAGCTCCCGCAAGAAGAGGTACTTATAGCAAGGGGACTC
TCAAATCCATTACCTCAATTAAGAAATGAAGAAATTGAATTAGTCTCAAAGTTTCTTTTAAACTCTAAAACAGAATGAGATAATGTATTT
TACGTTGTCTATAATCATTAAATCACTCCCTGTGTAATTTGTGAGAACCATCTAGTAGCTCGAAATAAAATAATGTTGCATCTTTTCTCC

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000281038_chr11_78154804_-_1286nt
GATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCCCCC
ATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGC
CCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTG
CTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGG
CCTCAGAGAAGAACGATACCATTTCTTAGAGGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCG
ATTTGGATCTGTGCCACATGGAGGTTTTGGGATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTAT
CCCTTTCCCAAGGTTTCCTCATTCATGCCTTTTATAGCTGGAAGATTGGTTAAGGAAAAGCACCCCCCATGGCAGAGACACTGCACATGA
TTGTGCATACAGCAGAATGCATGTTTGGATTTTAGAAATGCAGATTTCAATATGTAATTGTTGTGCCATAAGATATCATAGAAAAAATAT
AAGTGGTTGTGATTTTCTTAGAAAGTTGAGGGTATTTCACGTAAGGATGAGCTCCCGCAAGAAGAGGTACTTATAGCAAGGGGACTCTCA
AATCCATTACCTCAATTAAGAAATGAAGAAATTGAATTAGTCTCAAAGTTTCTTTTAAACTCTAAAACAGAATGAGATAATGTATTTTAC
GTTGTCTATAATCATTAAATCACTCCCTGTGTAATTTGTGAGAACCATCTAGTAGCTCGAAATAAAATAATGTTGCATCTTTTCTCCCTT
GCCATATACTTTGTGATAAATCCTTATCTCATTTTCAGTACTTCATTAAACATTGCAGAAAAAAATATTCCTTAAGGTCTTAATTGATTT
AAAGAAGTAGCTATTCTGAATTGAAATCTCCTTTCATTGAACTGGATGAAAAAATCATGTTTAATAACTGTTGCTTTTCAATTTTCAAAG
CTGTTGAGATATTACATTAAGTATTTCAACTCTTTAATCACTGTTGTTATAATTTGTTTATATTTGATGTTTATAATTTGTCTAATAAAA

>In-frame_RSF1_ENST00000360355_chr11_77531574_-_NARS2_ENST00000528850_chr11_78154804_-_1024nt
GATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCCCCC
ATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGC
CCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTG
CTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGGTTGCTGCTGTTGATCTTCTGGTTCCTGGAGTTGGGGAACTCTTTGGAGGAGG
CCTCAGAGAAGAACGATACCATTTCTTAGAGGAGCGCTTAGCCAGATCGGGACTTACAGAAGTCTACCAATGGTATCTGGACCTTCGTCG
ATTTGGATCTGTGCCACATGGAGGTTTTGGGATGGGATTTGAACGCTACCTGCAGTGCATCTTGGGTGTTGACAATATCAAAGATGTTAT
CCCTTTCCCAAGGTTTCCTCATTCATGCCTTTTATAGCTGGAAGATTGGTTAAGGAAAAGCACCCCCCATGGCAGAGACACTGCACATGA
TTGTGCATACAGCAGAATGCATGTTTGGATTTTAGAAATGCAGATTTCAATATGTAATTGTTGTGCCATAAGATATCATAGAAAAAATAT
AAGTGGTTGTGATTTTCTTAGAAAGTTGAGGGTATTTCACGTAAGGATGAGCTCCCGCAAGAAGAGGTACTTATAGCAAGGGGACTCTCA
AATCCATTACCTCAATTAAGAAATGAAGAAATTGAATTAGTCTCAAAGTTTCTTTTAAACTCTAAAACAGAATGAGATAATGTATTTTAC
GTTGTCTATAATCATTAAATCACTCCCTGTGTAATTTGTGAGAACCATCTAGTAGCTCGAAATAAAATAATGTTGCATCTTTTCTCCCTT


Top

FusionGenePPI for RSF1_NARS2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RSF1NFKB1, SMARCA5, CENPA, SIRT7, SP1, COPS6, CSNK2A1, HIST1H2BG, HIST1H3A, EWSR1, MARK2, ATXN3, KAT6A, MCM2NARS2SLC25A41, OXLD1, DARS2, ADRBK1, CHCHD2, RAB8B, PDK4, LAMP3, NDUFS7, HSPD1, ACSM5, TRNT1, CD70, YBEY, TMEM70, NIT1, GATC, CLEC2D, FOXRED1, OTC, BPNT1, CHRM3


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RSF1_NARS2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RSF1_NARS2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNARS2C0023264Leigh Disease1UNIPROT
TgeneNARS2C4015643COMBINED OXIDATIVE PHOSPHORYLATION DEFICIENCY 241ORPHANET;UNIPROT