FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32279

FusionGeneSummary for RSF1_ADAM2

check button Fusion gene summary
Fusion gene informationFusion gene name: RSF1_ADAM2
Fusion gene ID: 32279
HgeneTgene
Gene symbol

RSF1

ADAM2

Gene ID

51773

2515

Gene nameremodeling and spacing factor 1ADAM metallopeptidase domain 2
SynonymsHBXAP|RSF-1|XAP8|p325CRYN1|CRYN2|CT15|FTNB|PH-30b|PH30|PH30-beta
Cytomap

11q14.1

8p11.22

Type of geneprotein-codingprotein-coding
Descriptionremodeling and spacing factor 1HBV pX-associated protein 8hepatitis B virus x-associated proteinp325 subunit of RSF chromatin-remodeling complexdisintegrin and metalloproteinase domain-containing protein 2cancer/testis antigen 15fertilin subunit beta
Modification date2018052320180519
UniProtAcc

Q96T23

Q99965

Ensembl transtripts involved in fusion geneENST00000308488, ENST00000360355, 
ENST00000480887, ENST00000530604, 
ENST00000347580, ENST00000379853, 
ENST00000265708, ENST00000521880, 
ENST00000523181, 
Fusion gene scores* DoF score15 X 8 X 9=10806 X 3 X 3=54
# samples 176
** MAII scorelog2(17/1080*10)=-2.66742466091313
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/54*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RSF1 [Title/Abstract] AND ADAM2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRSF1

GO:0006334

nucleosome assembly

12972596

HgeneRSF1

GO:0006338

chromatin remodeling

9836642

HgeneRSF1

GO:0006352

DNA-templated transcription, initiation

9836642

HgeneRSF1

GO:0016584

nucleosome positioning

9836642

HgeneRSF1

GO:0043392

negative regulation of DNA binding

12972596

HgeneRSF1

GO:0045892

negative regulation of transcription, DNA-templated

11944984

HgeneRSF1

GO:0045893

positive regulation of transcription, DNA-templated

11788598

HgeneRSF1

GO:0050434

positive regulation of viral transcription

11788598


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-XX-A899-01ARSF1chr11

77458081

-ADAM2chr8

39607263

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000308488ENST00000347580RSF1chr11

77458081

-ADAM2chr8

39607263

-
In-frameENST00000308488ENST00000379853RSF1chr11

77458081

-ADAM2chr8

39607263

-
In-frameENST00000308488ENST00000265708RSF1chr11

77458081

-ADAM2chr8

39607263

-
In-frameENST00000308488ENST00000521880RSF1chr11

77458081

-ADAM2chr8

39607263

-
5CDS-intronENST00000308488ENST00000523181RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000360355ENST00000347580RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000360355ENST00000379853RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000360355ENST00000265708RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000360355ENST00000521880RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-intronENST00000360355ENST00000523181RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000480887ENST00000347580RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000480887ENST00000379853RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000480887ENST00000265708RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000480887ENST00000521880RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-intronENST00000480887ENST00000523181RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000530604ENST00000347580RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000530604ENST00000379853RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000530604ENST00000265708RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-3CDSENST00000530604ENST00000521880RSF1chr11

77458081

-ADAM2chr8

39607263

-
intron-intronENST00000530604ENST00000523181RSF1chr11

77458081

-ADAM2chr8

39607263

-

Top

FusionProtFeatures for RSF1_ADAM2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RSF1

Q96T23

ADAM2

Q99965

Required for assembly of regular nucleosome arrays bythe RSF chromatin-remodeling complex (PubMed:12972596).Facilitates transcription of hepatitis B virus (HBV) genes by thepX transcription activator. In case of infection by HBV, togetherwith pX, it represses TNF-alpha induced NF-kappa-B transcriptionactivation. Represses transcription when artificially recruited tochromatin by fusion to a heterogeneous DNA binding domain(PubMed:11944984, PubMed:11788598). {ECO:0000269|PubMed:11788598,ECO:0000269|PubMed:11944984, ECO:0000269|PubMed:12972596}. Sperm surface membrane protein that may be involved insperm-egg plasma membrane adhesion and fusion duringfertilization. Could have a direct role in sperm-zona binding ormigration of sperm from the uterus into the oviduct. Interactionswith egg membrane could be mediated via binding between itsdisintegrin-like domain to one or more integrins receptors on theegg. This is a non catalytic metalloprotease-like protein.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-31617_841241442DomainNote=DDT
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521612_645599788DomainNote=EGF-like
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420612_645580796DomainNote=EGF-like
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521708_735599788Topological domainCytoplasmic
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420708_735580796Topological domainCytoplasmic
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521687_707599788TransmembraneHelical
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420687_707580796TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-316942_10121241442Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-115942_1012-401411Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-111942_1012-3541190Coiled coilOntology_term=ECO:0000255
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-3161080_10831241442Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-3161146_12431241442Compositional biasNote=Arg-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-3161286_12921241442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-3161419_14241241442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-316226_3721241442Compositional biasNote=Glu-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-316875_8841241442Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-1151080_1083-401411Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-1151146_1243-401411Compositional biasNote=Arg-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-1151286_1292-401411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-1151419_1424-401411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-115226_372-401411Compositional biasNote=Glu-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-115875_884-401411Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-1111080_1083-3541190Compositional biasNote=Poly-Ala
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-1111146_1243-3541190Compositional biasNote=Arg-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-1111286_1292-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-1111419_1424-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-111226_372-3541190Compositional biasNote=Glu-rich
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-111875_884-3541190Compositional biasNote=Poly-Glu
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-11517_84-401411DomainNote=DDT
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-11117_84-3541190DomainNote=DDT
HgeneRSF1chr11:77458081chr8:39607263ENST00000308488-316891_9411241442Zinc fingerPHD-type
HgeneRSF1chr11:77458081chr8:39607263ENST00000360355-115891_941-401411Zinc fingerPHD-type
HgeneRSF1chr11:77458081chr8:39607263ENST00000480887-111891_941-3541190Zinc fingerPHD-type
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521477_606599788Compositional biasNote=Cys-rich
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420477_606580796Compositional biasNote=Cys-rich
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521178_375599788DomainPeptidase M12B
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521384_473599788DomainDisintegrin
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420178_375580796DomainPeptidase M12B
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420384_473580796DomainDisintegrin
TgeneADAM2chr11:77458081chr8:39607263ENST00000265708-1521175_686599788Topological domainExtracellular
TgeneADAM2chr11:77458081chr8:39607263ENST00000347580-1420175_686580796Topological domainExtracellular


Top

FusionGeneSequence for RSF1_ADAM2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000347580_chr8_39607263_-_261aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKVCRNQRCVSSSYLGTDCTTDKCNDRGVCNNKKHCHCSASTLPPDCSVQSDLWPGGS

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000379853_chr8_39607263_-_261aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKVCRNQRCVSSSYLGTDCTTDKCNDRGVCNNKKHCHCSASTLPPDCSVQSDLWPGGS

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000265708_chr8_39607263_-_261aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKVCRNQRCVSSSYLGTDCTTDKCNDRGVCNNKKHCHCSASTLPPDCSVQSDLWPGGS

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000521880_chr8_39607263_-_261aa
MATAAAAAAVMAPPGCPGSCPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGNGEVPKELVELHLKLMRKIGKSVTADRWEKT
LIKICQEFNSTWAWEMEKKGTLEMSVECKLALLKVCRNQRCVSSSYLGTDCTTDKCNDRGVCNNKKHCHCSASTLPPDCSVQSDLWPGGS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000347580_chr8_39607263_-_783nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTATGATTGTACTACTGACAAATGCAATGATAGAGGT
GTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGCTCAGTTCAATCAGATCTATGGCCTGGTGGGAGT
ATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGCTACATTGAGAACATTTACCATTCCAAACCAATG
AGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCTATAATGGTGAAAGTTAATTTCCAAAGGAAAAAA

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000379853_chr8_39607263_-_783nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTATGATTGTACTACTGACAAATGCAATGATAGAGGT
GTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGCTCAGTTCAATCAGATCTATGGCCTGGTGGGAGT
ATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGCTACATTGAGAACATTTACCATTCCAAACCAATG
AGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCTATAATGGTGAAAGTTAATTTCCAAAGGAAAAAA

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000265708_chr8_39607263_-_783nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTATGATTGTACTACTGACAAATGCAATGATAGAGGT
GTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGCTCAGTTCAATCAGATCTATGGCCTGGTGGGAGT
ATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGCTACATTGAGAACATTTACCATTCCAAACCAATG
AGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCTATAATGGTGAAAGTTAATTTCCAAAGGAAAAAA

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000521880_chr8_39607263_-_783nt
ATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCGTGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTG
GAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGGGTGCTGCAGGCGCCGCCGCCGGACGTCGGCAAC
GGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGCAAATCTGTTACTGCAGACAGATGGGAAAAATAT
TTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAGGGCTATCTTGAAATGAGTGTTGAATGCAAACTA
GCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTATGATTGTACTACTGACAAATGCAATGATAGAGGT
GTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGCTCAGTTCAATCAGATCTATGGCCTGGTGGGAGT
ATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGCTACATTGAGAACATTTACCATTCCAAACCAATG
AGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCTATAATGGTGAAAGTTAATTTCCAAAGGAAAAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000347580_chr8_39607263_-_1446nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTAT
GATTGTACTACTGACAAATGCAATGATAGAGGTGTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGC
TCAGTTCAATCAGATCTATGGCCTGGTGGGAGTATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGC
TACATTGAGAACATTTACCATTCCAAACCAATGAGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCT
ATAATGGTGAAAGTTAATTTCCAAAGGAAAAAATGGAGAACTGAGGACTATTCAAGCGATGAGCAACCTGAAAGTGAGAGTGAACCTAAA
GGGTAGTCTGGACAACAGAGATGCCATGATATCACTTCTTCTAGAGTAATTATCTGTGATGGATGGACACAAAAAAATGGAAAGAAAAGA
ATGTACATTACCTGGTTTCCTGGGATTCAAACCTGCATATTGTGATTTTAATTTGACCAGAAAATATGATATATATGTATAATTTCACAG
ATAATTTACTTATTTAAAAATGCATGATAATGAGTTTTACATTACAAATTTCTGTTTTTTTAAAGTTATCTTACGCTATTTCTGTTGGTT
AGTAGACACTAATTCTGTCAGTAGGGGCATGGTATAAGGAAATATCATAATGTAATGAGGTGGTACTATGATTAAAAGCCACTGTTACAT

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000379853_chr8_39607263_-_1446nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTAT
GATTGTACTACTGACAAATGCAATGATAGAGGTGTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGC
TCAGTTCAATCAGATCTATGGCCTGGTGGGAGTATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGC
TACATTGAGAACATTTACCATTCCAAACCAATGAGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCT
ATAATGGTGAAAGTTAATTTCCAAAGGAAAAAATGGAGAACTGAGGACTATTCAAGCGATGAGCAACCTGAAAGTGAGAGTGAACCTAAA
GGGTAGTCTGGACAACAGAGATGCCATGATATCACTTCTTCTAGAGTAATTATCTGTGATGGATGGACACAAAAAAATGGAAAGAAAAGA
ATGTACATTACCTGGTTTCCTGGGATTCAAACCTGCATATTGTGATTTTAATTTGACCAGAAAATATGATATATATGTATAATTTCACAG
ATAATTTACTTATTTAAAAATGCATGATAATGAGTTTTACATTACAAATTTCTGTTTTTTTAAAGTTATCTTACGCTATTTCTGTTGGTT
AGTAGACACTAATTCTGTCAGTAGGGGCATGGTATAAGGAAATATCATAATGTAATGAGGTGGTACTATGATTAAAAGCCACTGTTACAT

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000265708_chr8_39607263_-_1446nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTAT
GATTGTACTACTGACAAATGCAATGATAGAGGTGTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGC
TCAGTTCAATCAGATCTATGGCCTGGTGGGAGTATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGC
TACATTGAGAACATTTACCATTCCAAACCAATGAGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCT
ATAATGGTGAAAGTTAATTTCCAAAGGAAAAAATGGAGAACTGAGGACTATTCAAGCGATGAGCAACCTGAAAGTGAGAGTGAACCTAAA
GGGTAGTCTGGACAACAGAGATGCCATGATATCACTTCTTCTAGAGTAATTATCTGTGATGGATGGACACAAAAAAATGGAAAGAAAAGA
ATGTACATTACCTGGTTTCCTGGGATTCAAACCTGCATATTGTGATTTTAATTTGACCAGAAAATATGATATATATGTATAATTTCACAG
ATAATTTACTTATTTAAAAATGCATGATAATGAGTTTTACATTACAAATTTCTGTTTTTTTAAAGTTATCTTACGCTATTTCTGTTGGTT
AGTAGACACTAATTCTGTCAGTAGGGGCATGGTATAAGGAAATATCATAATGTAATGAGGTGGTACTATGATTAAAAGCCACTGTTACAT

>In-frame_RSF1_ENST00000308488_chr11_77458081_-_ADAM2_ENST00000521880_chr8_39607263_-_1150nt
TTGTTTTCATTCCCCCTGTCACACGAGGCAGTGGCAAGCCCGAAGGGGAGGAGAGAAGGGGGCGGAAAGAGGGCGGAAAGTGAAAGGCGC
CGAGGGCCGCTCTGTCTCCCGTCTGACTCGGTTCTCGACTGCTCCGGGCCGCCGATGTATTGTGGGATCGCGGAGCCGTCCCTGAGACGC
TGGGATCCGCAGAGGAGCCCACTTGAGAGCGCCTCCTGTCGTCTGTAAGGTTGCCTTGCCATCCCTCGGCACCACAACTTCCCCCGCCCC
CCCATCGCCTCCTCCTCCATCCTCCAGTTCAAAATGGCGACGGCGGCGGCAGCGGCGGCGGTGATGGCTCCTCCGGGCTGCCCGGGTTCG
TGCCCCAACTTCGCCGTAGTCTGCTCCTTCTTGGAGCGCTACGGGCCGCTGCTAGACCTGCCTGAGTTGCCGTTCCCTGAGCTGGAGCGG
GTGCTGCAGGCGCCGCCGCCGGACGTCGGCAACGGAGAAGTACCAAAAGAATTGGTGGAGCTCCATTTGAAGCTGATGAGGAAAATTGGC
AAATCTGTTACTGCAGACAGATGGGAAAAATATTTGATCAAGATATGCCAAGAGTTTAACAGTACCTGGGCATGGGAGATGGAGAAGAAG
GGCTATCTTGAAATGAGTGTTGAATGCAAACTAGCACTCTTAAAGGTTTGCAGGAATCAAAGATGTGTGAGTTCTTCATACTTGGGTTAT
GATTGTACTACTGACAAATGCAATGATAGAGGTGTATGCAATAACAAAAAGCACTGTCACTGTAGTGCTTCATATTTACCTCCAGATTGC
TCAGTTCAATCAGATCTATGGCCTGGTGGGAGTATTGACAGTGGCAATTTTCCACCTGTAGCTATACCAGCCAGACTCCCTGAAAGGCGC
TACATTGAGAACATTTACCATTCCAAACCAATGAGATGGCCATTTTTCTTATTCATTCCTTTCTTTATTATTTTCTGTGTACTGATTGCT
ATAATGGTGAAAGTTAATTTCCAAAGGAAAAAATGGAGAACTGAGGACTATTCAAGCGATGAGCAACCTGAAAGTGAGAGTGAACCTAAA


Top

FusionGenePPI for RSF1_ADAM2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RSF1NFKB1, SMARCA5, CENPA, SIRT7, SP1, COPS6, CSNK2A1, HIST1H2BG, HIST1H3A, EWSR1, MARK2, ATXN3, KAT6A, MCM2ADAM2CLGN, CRYAB, DNM1, ASPHD2, C6orf120, ADAMTS2, LRRC3, TTN, LCLAT1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RSF1_ADAM2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RSF1_ADAM2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource