FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32210

FusionGeneSummary for RPTOR_RNF213

check button Fusion gene summary
Fusion gene informationFusion gene name: RPTOR_RNF213
Fusion gene ID: 32210
HgeneTgene
Gene symbol

RPTOR

RNF213

Gene ID

57521

57674

Gene nameregulatory associated protein of MTOR complex 1ring finger protein 213
SynonymsKOG1|Mip1ALO17|C17orf27|KIAA1618|MYMY2|MYSTR|NET57
Cytomap

17q25.3

17q25.3

Type of geneprotein-codingprotein-coding
Descriptionregulatory-associated protein of mTORp150 target of rapamycin (TOR)-scaffold protein containing WD-repeatsraptorE3 ubiquitin-protein ligase RNF213ALK lymphoma oligomerization partner on chromosome 17RING-type E3 ubiquitin transferase RNF213mysterin
Modification date2018052320180527
UniProtAcc

Q8N122

Q63HN8

Ensembl transtripts involved in fusion geneENST00000537330, ENST00000570891, 
ENST00000306801, ENST00000544334, 
ENST00000575542, 
ENST00000508628, 
ENST00000456466, ENST00000582970, 
ENST00000319921, ENST00000336301, 
ENST00000427003, 
Fusion gene scores* DoF score12 X 8 X 8=76812 X 13 X 6=936
# samples 1415
** MAII scorelog2(14/768*10)=-2.45567948377619
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/936*10)=-2.64154602908752
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RPTOR [Title/Abstract] AND RNF213 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRPTOR

GO:0031929

TOR signaling

20381137

HgeneRPTOR

GO:0032008

positive regulation of TOR signaling

12150926|18439900

HgeneRPTOR

GO:0071233

cellular response to leucine

22424946

HgeneRPTOR

GO:0071902

positive regulation of protein serine/threonine kinase activity

12150926

TgeneRNF213

GO:0016567

protein ubiquitination

21799892

TgeneRNF213

GO:0051260

protein homooligomerization

24658080|26126547

TgeneRNF213

GO:0051865

protein autoubiquitination

21799892


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-BH-A0DX-01ARPTORchr17

78617610

+RNF213chr17

78341548

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000537330ENST00000508628RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000537330ENST00000456466RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000537330ENST00000582970RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000537330ENST00000319921RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000537330ENST00000336301RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000537330ENST00000427003RPTORchr17

78617610

+RNF213chr17

78341548

+
In-frameENST00000570891ENST00000508628RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000570891ENST00000456466RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000570891ENST00000582970RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000570891ENST00000319921RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000570891ENST00000336301RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000570891ENST00000427003RPTORchr17

78617610

+RNF213chr17

78341548

+
In-frameENST00000306801ENST00000508628RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000306801ENST00000456466RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000306801ENST00000582970RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000306801ENST00000319921RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000306801ENST00000336301RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000306801ENST00000427003RPTORchr17

78617610

+RNF213chr17

78341548

+
In-frameENST00000544334ENST00000508628RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000544334ENST00000456466RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000544334ENST00000582970RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000544334ENST00000319921RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000544334ENST00000336301RPTORchr17

78617610

+RNF213chr17

78341548

+
5CDS-intronENST00000544334ENST00000427003RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-3CDSENST00000575542ENST00000508628RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000575542ENST00000456466RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000575542ENST00000582970RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000575542ENST00000319921RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000575542ENST00000336301RPTORchr17

78617610

+RNF213chr17

78341548

+
intron-intronENST00000575542ENST00000427003RPTORchr17

78617610

+RNF213chr17

78341548

+

Top

FusionProtFeatures for RPTOR_RNF213


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RPTOR

Q8N122

RNF213

Q63HN8

Involved in the control of the mammalian target ofrapamycin complex 1 (mTORC1) activity which regulates cell growthand survival, and autophagy in response to nutrient and hormonalsignals; functions as a scaffold for recruiting mTORC1 substrates.mTORC1 is activated in response to growth factors or amino acids.Growth factor-stimulated mTORC1 activation involves a AKT1-mediated phosphorylation of TSC1-TSC2, which leads to theactivation of the RHEB GTPase that potently activates the proteinkinase activity of mTORC1. Amino acid-signaling to mTORC1 requiresits relocalization to the lysosomes mediated by the Ragulatorcomplex and the Rag GTPases. Activated mTORC1 up-regulates proteinsynthesis by phosphorylating key regulators of mRNA translationand ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 andreleases it from inhibiting the elongation initiation factor 4E(eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-389',which then promotes protein synthesis by phosphorylating PDCD4 andtargeting it for degradation. Involved in ciliogenesis.{ECO:0000269|PubMed:12150925, ECO:0000269|PubMed:12150926,ECO:0000269|PubMed:23727834}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RPTOR_RNF213


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RPTOR_ENST00000570891_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_1367aa
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDP
LSMGPQKALETIGANLQKQYENWQPRCLRENSDVKTHGPFEAVMRTLCECKETASKTLSRFGIQPCSICLGDAKDPVCLPCDHVHCLRCL
RAWFASEQMICPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQRHC
EHTKSLSPFNDVVDKTPVIRSVILKLLLKYSFHDVKDTIQETLTLLKKKAFITEDKTELYMLFINCLEDSILEKTSAYSRNDELNHLEEE
GRFLKATSPASRGREPANEASVEYLQEVARIRLCLDRAADFLSEPEGGPEMAKEKQCYLQQVKQFCIRVENDWHRVYLVRKLSSQRGMEF
VQGLSKPGRPHQWVFPKDVVKQQGLRQDHPGQMDRYLVYGDEYKALRDAVAKAVLECKPLGIKTALKACKTPQSQQSAYFLLTLFREVAI
LYRSHNASLHPTPEQCEAVSKFIGECKILSPPDISRFATSLVDNSVPLLRAGPSDSNLDGTVTEMAIHAAAVLLCGQNELLEPLKNLAFS
PATMAHAFLPTMPEDLLAQARRWKGLERVHWYTCPNGHPCSVGECGRPMEQSICIDCHAPIGGIDHKPRDGFHLVKDKADRTQTGHVLGN
PQRRDVVTCDRGLPPVVFLLIRLLTHLALLLGASQSSQALINIIKPPVRDPKGFLQQHILKDLEQLAKMLGHSADETIGVVHLVLRRLLQ
EQHQLSSRRLLNFDTELSTKEMRNNWEKEIAAVISPELEHLDKTLPTMNNLISQDKRISSNPVAKIITGDPVTFLPHLPRKSVVHCSKIW
SCRKRITVEYLQHIVEQKNGKERVPILWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVQQVEYSSIRGFLSKHSSDGLRQLLHNRITV
FLSTWNKLRRSLETNGEINLPKDYCSTDLDLDTEFEILLPRRRGLGLCATALVSYLIRLHNEIVYAVEKLSKENNSTSVDAAEVTELHVI
STEVERDLTPLILSNCQYQVEEGRETVQEFDLEKIQRQIVSRFLQGKPRLSLKGIPTLVYRHDWNTEHLFMDIKNKMAQDSLPSSVISAI
SGQLQSYSDACEVLSVVEVTLGFLSTAGGDPNMQLNVTTQDILQMGDQTIHVLKALNRCQLKHTIALWQFLSAHKSEQLLRLHKEPFGEI
SSRYKADLSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCV

>In-frame_RPTOR_ENST00000306801_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_1367aa
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDP
LSMGPQKALETIGANLQKQYENWQPRCLRENSDVKTHGPFEAVMRTLCECKETASKTLSRFGIQPCSICLGDAKDPVCLPCDHVHCLRCL
RAWFASEQMICPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQRHC
EHTKSLSPFNDVVDKTPVIRSVILKLLLKYSFHDVKDTIQETLTLLKKKAFITEDKTELYMLFINCLEDSILEKTSAYSRNDELNHLEEE
GRFLKATSPASRGREPANEASVEYLQEVARIRLCLDRAADFLSEPEGGPEMAKEKQCYLQQVKQFCIRVENDWHRVYLVRKLSSQRGMEF
VQGLSKPGRPHQWVFPKDVVKQQGLRQDHPGQMDRYLVYGDEYKALRDAVAKAVLECKPLGIKTALKACKTPQSQQSAYFLLTLFREVAI
LYRSHNASLHPTPEQCEAVSKFIGECKILSPPDISRFATSLVDNSVPLLRAGPSDSNLDGTVTEMAIHAAAVLLCGQNELLEPLKNLAFS
PATMAHAFLPTMPEDLLAQARRWKGLERVHWYTCPNGHPCSVGECGRPMEQSICIDCHAPIGGIDHKPRDGFHLVKDKADRTQTGHVLGN
PQRRDVVTCDRGLPPVVFLLIRLLTHLALLLGASQSSQALINIIKPPVRDPKGFLQQHILKDLEQLAKMLGHSADETIGVVHLVLRRLLQ
EQHQLSSRRLLNFDTELSTKEMRNNWEKEIAAVISPELEHLDKTLPTMNNLISQDKRISSNPVAKIITGDPVTFLPHLPRKSVVHCSKIW
SCRKRITVEYLQHIVEQKNGKERVPILWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVQQVEYSSIRGFLSKHSSDGLRQLLHNRITV
FLSTWNKLRRSLETNGEINLPKDYCSTDLDLDTEFEILLPRRRGLGLCATALVSYLIRLHNEIVYAVEKLSKENNSTSVDAAEVTELHVI
STEVERDLTPLILSNCQYQVEEGRETVQEFDLEKIQRQIVSRFLQGKPRLSLKGIPTLVYRHDWNTEHLFMDIKNKMAQDSLPSSVISAI
SGQLQSYSDACEVLSVVEVTLGFLSTAGGDPNMQLNVTTQDILQMGDQTIHVLKALNRCQLKHTIALWQFLSAHKSEQLLRLHKEPFGEI
SSRYKADLSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCV

>In-frame_RPTOR_ENST00000544334_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_1367aa
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDP
LSMGPQKALETIGANLQKQYENWQPRCLRENSDVKTHGPFEAVMRTLCECKETASKTLSRFGIQPCSICLGDAKDPVCLPCDHVHCLRCL
RAWFASEQMICPYCLTALPDEFSPAVSQAHREAIEKHARFRQMCNSFFVDLVSTICFKDNAPPEKEVIESLLSLLFVQKGRLRDAAQRHC
EHTKSLSPFNDVVDKTPVIRSVILKLLLKYSFHDVKDTIQETLTLLKKKAFITEDKTELYMLFINCLEDSILEKTSAYSRNDELNHLEEE
GRFLKATSPASRGREPANEASVEYLQEVARIRLCLDRAADFLSEPEGGPEMAKEKQCYLQQVKQFCIRVENDWHRVYLVRKLSSQRGMEF
VQGLSKPGRPHQWVFPKDVVKQQGLRQDHPGQMDRYLVYGDEYKALRDAVAKAVLECKPLGIKTALKACKTPQSQQSAYFLLTLFREVAI
LYRSHNASLHPTPEQCEAVSKFIGECKILSPPDISRFATSLVDNSVPLLRAGPSDSNLDGTVTEMAIHAAAVLLCGQNELLEPLKNLAFS
PATMAHAFLPTMPEDLLAQARRWKGLERVHWYTCPNGHPCSVGECGRPMEQSICIDCHAPIGGIDHKPRDGFHLVKDKADRTQTGHVLGN
PQRRDVVTCDRGLPPVVFLLIRLLTHLALLLGASQSSQALINIIKPPVRDPKGFLQQHILKDLEQLAKMLGHSADETIGVVHLVLRRLLQ
EQHQLSSRRLLNFDTELSTKEMRNNWEKEIAAVISPELEHLDKTLPTMNNLISQDKRISSNPVAKIITGDPVTFLPHLPRKSVVHCSKIW
SCRKRITVEYLQHIVEQKNGKERVPILWHFLQKEAELRLVKFLPEILALQRDLVKQFQNVQQVEYSSIRGFLSKHSSDGLRQLLHNRITV
FLSTWNKLRRSLETNGEINLPKDYCSTDLDLDTEFEILLPRRRGLGLCATALVSYLIRLHNEIVYAVEKLSKENNSTSVDAAEVTELHVI
STEVERDLTPLILSNCQYQVEEGRETVQEFDLEKIQRQIVSRFLQGKPRLSLKGIPTLVYRHDWNTEHLFMDIKNKMAQDSLPSSVISAI
SGQLQSYSDACEVLSVVEVTLGFLSTAGGDPNMQLNVTTQDILQMGDQTIHVLKALNRCQLKHTIALWQFLSAHKSEQLLRLHKEPFGEI
SSRYKADLSPENAKLLSTFLNQTGLDAFLLELHEMIILKLKNPQTQTEERFRPQWSLRDTLVSYMQTKESEILPEMASQFPEEILLASCV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RPTOR_ENST00000570891_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_4101nt
ATGGAGTCCGAAATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTTTT
ATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTGTT
GCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATCCT
CTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGTGTCTTCGAGAG
AACTCTGACGTGAAGACGCACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAATGCAAGGAGACAGCCAGCAAGACCCTCAGCAGG
TTTGGGATTCAGCCGTGCTCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTGCCCTGCGACCACGTGCACTGCCTGCGCTGCCTC
AGGGCCTGGTTTGCCTCAGAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCAGACGAATTCTCTCCAGCTGTTTCCCAAGCGCAC
AGGGAAGCCATTGAAAAGCATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTAGACCTGGTGTCCACCATTTGCTTCAAGGACAAC
GCTCCGCCTGAGAAGGAAGTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAGGGGCGCTTAAGAGATGCTGCCCAGAGACACTGT
GAACACACAAAATCTCTCTCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATCCGCTCAGTGATACTGAAACTGCTTTTGAAGTAC
AGCTTTCATGATGTAAAAGATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAAGCATTCATAACTGAAGATAAAACTGAACTGTAC
ATGCTCTTCATCAACTGCCTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCCAGAAATGATGAACTGAACCACCTAGAAGAGGAA
GGTCGTTTCCTTAAGGCATATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAGGCCTCGGTTGAATACCTGCAAGAGGTGGCCCGG
ATCCGCCTCTGCCTCGACAGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCAGAGATGGCCAAGGAGAAGCAGTGCTACCTGCAG
CAAGTCAAGCAGTTCTGTATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTGCGGAAGCTCAGCAGCCAGCGGGGGATGGAGTTC
GTGCAGGGCCTCTCCAAGCCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTTGTCAAGCAGCAGGGGCTGCGGCAGGACCACCCA
GGCCAGATGGATAGGTACCTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCTGTGGCCAAAGCTGTCCTCGAGTGCAAGCCACTG
GGCATTAAGACTGCTCTGAAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTACTTCCTGTTAACACTGTTTAGAGAGGTGGCTATT
TTGTACAGATCCCACAATGCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTGAGCAAATTCATTGGCGAATGCAAGATCCTTTCA
CCTCCTGATATCAGCCGTTTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTGAGGGCGGGGCCTAGTGACAGCAACCTTGATGGA
ACGGTGACAGAAATGGCCATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAACTCTTGGAGCCCCTAAAGAATCTGGCCTTCTCC
CCAGCCACCATGGCGCATGCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAAGCTCGGAGGTGGAAGGGTCTGGAGCGAGTCCAC
TGGTACACTTGTCCCAACGGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATGGAACAGAGCATCTGCATTGACTGCCATGCGCCG
ATTGGAGGCATTGACCACAAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCAGACAGAACGCAGACCGGCCACGTGCTGGGCAAC
CCGCAGCGGAGAGACGTGGTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTCCTTATCCGGCTACTCACTCACTTGGCTCTGCTT
CTGGGAGCGTCCCAGAGTTCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGGGATCCAAAAGGCTTTCTGCAGCAGCACATCCTG
AAGGACCTGGAGCAGTTGGCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGCGTGGTCCACCTCGTCCTGCGCAGGCTTCTCCAA
GAGCAGCACCAGCTCTCTAGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACTAAAGAAATGAGGAACAACTGGGAAAAGGAAATC
GCAGCTGTGATTTCTCCTGAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAATAATCTCATCAGCCAAGATAAGCGTATCAGCTCT
AACCCTGTGGCCAAAATAATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCCCGGAAAAGTGTGGTCCATTGCTCTAAGATTTGG
AGCTGCAGGAAAAGAATTACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAATGGCAAAGAAAGAGTGCCCATCCTCTGGCATTTC
CTGCAGAAGGAAGCAGAGCTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTGCAAAGGGATCTAGTGAAGCAGTTCCAGAACGTC
CAGCAAGTTGAATACAGCTCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGGTTGAGGCAGCTGCTTCACAACAGGATCACAGTC
TTTCTGTCCACATGGAACAAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAACCTACCCAAAGACTACTGCAGCACTGACTTGGAT
CTGGACACTGAGTTTGAGATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCTACCGCTCTCGTCAGCTACTTGATTCGCCTACAC
AATGAAATTGTCTACGCCGTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTGGATGCCGCCGAGGTCACTGAACTGCATGTCATC
AGTTATGAAGTGGAGCGGGACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAGGTGGAGGAGGGCAGAGAGACCGTGCAGGAGTTC
GATCTGGAGAAGATTCAGCGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGGCTGAGCCTCAAGGGAATACCCACTCTGGTGTAC
AGACACGACTGGAACTATGAACATCTCTTTATGGACATCAAGAACAAAATGGCACAGGACTCCCTCCCCAGCTCGGTCATTAGTGCCATC
AGTGGACAGCTGCAGTCCTACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTCACTCTGGGGTTTCTGAGCACAGCTGGTGGGGAT
CCAAACATGCAGCTGAATGTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACGATTCACGTGTTAAAGGCCTTAAACAGATGCCAG
TTAAAACACACCATTGCCCTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTGCTGCGGCTGCACAAAGAGCCATTTGGGGAAATC
AGTTCAAGGTACAAAGCGGATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTCCTAAATCAGACTGGCCTAGACGCCTTCCTGCTA
GAGCTGCACGAAATGATAATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAGCGCTTCCGCCCTCAGTGGAGCCTGAGAGACACT
CTCGTAAGTTACATGCAAACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAGTTCCCAGAAGAGATACTGCTCGCCAGCTGTGTC

>In-frame_RPTOR_ENST00000306801_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_4101nt
ATGGAGTCCGAAATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTTTT
ATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTGTT
GCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATCCT
CTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGTGTCTTCGAGAG
AACTCTGACGTGAAGACGCACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAATGCAAGGAGACAGCCAGCAAGACCCTCAGCAGG
TTTGGGATTCAGCCGTGCTCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTGCCCTGCGACCACGTGCACTGCCTGCGCTGCCTC
AGGGCCTGGTTTGCCTCAGAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCAGACGAATTCTCTCCAGCTGTTTCCCAAGCGCAC
AGGGAAGCCATTGAAAAGCATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTAGACCTGGTGTCCACCATTTGCTTCAAGGACAAC
GCTCCGCCTGAGAAGGAAGTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAGGGGCGCTTAAGAGATGCTGCCCAGAGACACTGT
GAACACACAAAATCTCTCTCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATCCGCTCAGTGATACTGAAACTGCTTTTGAAGTAC
AGCTTTCATGATGTAAAAGATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAAGCATTCATAACTGAAGATAAAACTGAACTGTAC
ATGCTCTTCATCAACTGCCTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCCAGAAATGATGAACTGAACCACCTAGAAGAGGAA
GGTCGTTTCCTTAAGGCATATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAGGCCTCGGTTGAATACCTGCAAGAGGTGGCCCGG
ATCCGCCTCTGCCTCGACAGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCAGAGATGGCCAAGGAGAAGCAGTGCTACCTGCAG
CAAGTCAAGCAGTTCTGTATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTGCGGAAGCTCAGCAGCCAGCGGGGGATGGAGTTC
GTGCAGGGCCTCTCCAAGCCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTTGTCAAGCAGCAGGGGCTGCGGCAGGACCACCCA
GGCCAGATGGATAGGTACCTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCTGTGGCCAAAGCTGTCCTCGAGTGCAAGCCACTG
GGCATTAAGACTGCTCTGAAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTACTTCCTGTTAACACTGTTTAGAGAGGTGGCTATT
TTGTACAGATCCCACAATGCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTGAGCAAATTCATTGGCGAATGCAAGATCCTTTCA
CCTCCTGATATCAGCCGTTTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTGAGGGCGGGGCCTAGTGACAGCAACCTTGATGGA
ACGGTGACAGAAATGGCCATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAACTCTTGGAGCCCCTAAAGAATCTGGCCTTCTCC
CCAGCCACCATGGCGCATGCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAAGCTCGGAGGTGGAAGGGTCTGGAGCGAGTCCAC
TGGTACACTTGTCCCAACGGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATGGAACAGAGCATCTGCATTGACTGCCATGCGCCG
ATTGGAGGCATTGACCACAAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCAGACAGAACGCAGACCGGCCACGTGCTGGGCAAC
CCGCAGCGGAGAGACGTGGTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTCCTTATCCGGCTACTCACTCACTTGGCTCTGCTT
CTGGGAGCGTCCCAGAGTTCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGGGATCCAAAAGGCTTTCTGCAGCAGCACATCCTG
AAGGACCTGGAGCAGTTGGCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGCGTGGTCCACCTCGTCCTGCGCAGGCTTCTCCAA
GAGCAGCACCAGCTCTCTAGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACTAAAGAAATGAGGAACAACTGGGAAAAGGAAATC
GCAGCTGTGATTTCTCCTGAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAATAATCTCATCAGCCAAGATAAGCGTATCAGCTCT
AACCCTGTGGCCAAAATAATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCCCGGAAAAGTGTGGTCCATTGCTCTAAGATTTGG
AGCTGCAGGAAAAGAATTACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAATGGCAAAGAAAGAGTGCCCATCCTCTGGCATTTC
CTGCAGAAGGAAGCAGAGCTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTGCAAAGGGATCTAGTGAAGCAGTTCCAGAACGTC
CAGCAAGTTGAATACAGCTCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGGTTGAGGCAGCTGCTTCACAACAGGATCACAGTC
TTTCTGTCCACATGGAACAAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAACCTACCCAAAGACTACTGCAGCACTGACTTGGAT
CTGGACACTGAGTTTGAGATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCTACCGCTCTCGTCAGCTACTTGATTCGCCTACAC
AATGAAATTGTCTACGCCGTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTGGATGCCGCCGAGGTCACTGAACTGCATGTCATC
AGTTATGAAGTGGAGCGGGACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAGGTGGAGGAGGGCAGAGAGACCGTGCAGGAGTTC
GATCTGGAGAAGATTCAGCGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGGCTGAGCCTCAAGGGAATACCCACTCTGGTGTAC
AGACACGACTGGAACTATGAACATCTCTTTATGGACATCAAGAACAAAATGGCACAGGACTCCCTCCCCAGCTCGGTCATTAGTGCCATC
AGTGGACAGCTGCAGTCCTACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTCACTCTGGGGTTTCTGAGCACAGCTGGTGGGGAT
CCAAACATGCAGCTGAATGTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACGATTCACGTGTTAAAGGCCTTAAACAGATGCCAG
TTAAAACACACCATTGCCCTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTGCTGCGGCTGCACAAAGAGCCATTTGGGGAAATC
AGTTCAAGGTACAAAGCGGATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTCCTAAATCAGACTGGCCTAGACGCCTTCCTGCTA
GAGCTGCACGAAATGATAATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAGCGCTTCCGCCCTCAGTGGAGCCTGAGAGACACT
CTCGTAAGTTACATGCAAACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAGTTCCCAGAAGAGATACTGCTCGCCAGCTGTGTC

>In-frame_RPTOR_ENST00000544334_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_4101nt
ATGGAGTCCGAAATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTTTT
ATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTGTT
GCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATCCT
CTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGTGTCTTCGAGAG
AACTCTGACGTGAAGACGCACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAATGCAAGGAGACAGCCAGCAAGACCCTCAGCAGG
TTTGGGATTCAGCCGTGCTCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTGCCCTGCGACCACGTGCACTGCCTGCGCTGCCTC
AGGGCCTGGTTTGCCTCAGAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCAGACGAATTCTCTCCAGCTGTTTCCCAAGCGCAC
AGGGAAGCCATTGAAAAGCATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTAGACCTGGTGTCCACCATTTGCTTCAAGGACAAC
GCTCCGCCTGAGAAGGAAGTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAGGGGCGCTTAAGAGATGCTGCCCAGAGACACTGT
GAACACACAAAATCTCTCTCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATCCGCTCAGTGATACTGAAACTGCTTTTGAAGTAC
AGCTTTCATGATGTAAAAGATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAAGCATTCATAACTGAAGATAAAACTGAACTGTAC
ATGCTCTTCATCAACTGCCTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCCAGAAATGATGAACTGAACCACCTAGAAGAGGAA
GGTCGTTTCCTTAAGGCATATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAGGCCTCGGTTGAATACCTGCAAGAGGTGGCCCGG
ATCCGCCTCTGCCTCGACAGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCAGAGATGGCCAAGGAGAAGCAGTGCTACCTGCAG
CAAGTCAAGCAGTTCTGTATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTGCGGAAGCTCAGCAGCCAGCGGGGGATGGAGTTC
GTGCAGGGCCTCTCCAAGCCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTTGTCAAGCAGCAGGGGCTGCGGCAGGACCACCCA
GGCCAGATGGATAGGTACCTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCTGTGGCCAAAGCTGTCCTCGAGTGCAAGCCACTG
GGCATTAAGACTGCTCTGAAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTACTTCCTGTTAACACTGTTTAGAGAGGTGGCTATT
TTGTACAGATCCCACAATGCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTGAGCAAATTCATTGGCGAATGCAAGATCCTTTCA
CCTCCTGATATCAGCCGTTTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTGAGGGCGGGGCCTAGTGACAGCAACCTTGATGGA
ACGGTGACAGAAATGGCCATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAACTCTTGGAGCCCCTAAAGAATCTGGCCTTCTCC
CCAGCCACCATGGCGCATGCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAAGCTCGGAGGTGGAAGGGTCTGGAGCGAGTCCAC
TGGTACACTTGTCCCAACGGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATGGAACAGAGCATCTGCATTGACTGCCATGCGCCG
ATTGGAGGCATTGACCACAAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCAGACAGAACGCAGACCGGCCACGTGCTGGGCAAC
CCGCAGCGGAGAGACGTGGTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTCCTTATCCGGCTACTCACTCACTTGGCTCTGCTT
CTGGGAGCGTCCCAGAGTTCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGGGATCCAAAAGGCTTTCTGCAGCAGCACATCCTG
AAGGACCTGGAGCAGTTGGCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGCGTGGTCCACCTCGTCCTGCGCAGGCTTCTCCAA
GAGCAGCACCAGCTCTCTAGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACTAAAGAAATGAGGAACAACTGGGAAAAGGAAATC
GCAGCTGTGATTTCTCCTGAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAATAATCTCATCAGCCAAGATAAGCGTATCAGCTCT
AACCCTGTGGCCAAAATAATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCCCGGAAAAGTGTGGTCCATTGCTCTAAGATTTGG
AGCTGCAGGAAAAGAATTACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAATGGCAAAGAAAGAGTGCCCATCCTCTGGCATTTC
CTGCAGAAGGAAGCAGAGCTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTGCAAAGGGATCTAGTGAAGCAGTTCCAGAACGTC
CAGCAAGTTGAATACAGCTCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGGTTGAGGCAGCTGCTTCACAACAGGATCACAGTC
TTTCTGTCCACATGGAACAAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAACCTACCCAAAGACTACTGCAGCACTGACTTGGAT
CTGGACACTGAGTTTGAGATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCTACCGCTCTCGTCAGCTACTTGATTCGCCTACAC
AATGAAATTGTCTACGCCGTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTGGATGCCGCCGAGGTCACTGAACTGCATGTCATC
AGTTATGAAGTGGAGCGGGACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAGGTGGAGGAGGGCAGAGAGACCGTGCAGGAGTTC
GATCTGGAGAAGATTCAGCGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGGCTGAGCCTCAAGGGAATACCCACTCTGGTGTAC
AGACACGACTGGAACTATGAACATCTCTTTATGGACATCAAGAACAAAATGGCACAGGACTCCCTCCCCAGCTCGGTCATTAGTGCCATC
AGTGGACAGCTGCAGTCCTACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTCACTCTGGGGTTTCTGAGCACAGCTGGTGGGGAT
CCAAACATGCAGCTGAATGTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACGATTCACGTGTTAAAGGCCTTAAACAGATGCCAG
TTAAAACACACCATTGCCCTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTGCTGCGGCTGCACAAAGAGCCATTTGGGGAAATC
AGTTCAAGGTACAAAGCGGATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTCCTAAATCAGACTGGCCTAGACGCCTTCCTGCTA
GAGCTGCACGAAATGATAATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAGCGCTTCCGCCCTCAGTGGAGCCTGAGAGACACT
CTCGTAAGTTACATGCAAACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAGTTCCCAGAAGAGATACTGCTCGCCAGCTGTGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RPTOR_ENST00000570891_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_6668nt
ATGAGTTTCACTGTAGCTCCAAACCAGAGGGCAAAGCTCCCATGACCCAATAAGCCCACATTGTCCCTTTCCTCCGTGGTTCCGTGTCGC
CCGTTTCTCAGGACTCGTTCTCAGGCAGGAGAGAGCCTCGGGGCTGAAGGCCAGGACCAGCCAGGCCGCGCGGACCTGAGGTTGAGGAAC
CGGGTGCAGGCGAGCACGATGGGCCGGTCGTGGCTCTGGTTGCAGCAGCTCAGACGAGTGCGGGACCCGCAGGGCTGAGAGTGGCTGGAG
GAGACCCAGGGCCCTTTGAACCCGATCCCTTGGCCGGAGACCTCAGCCCAGTCGGCCCAGTGGGCGAACCGGCACCAAGAGCGGCCTGCC
TGTCTTCGGAACTGCTGAGGCGGTGGAGGCCGAGAGCAGGGTCATCGTGAGGCCTGAAGTCTCTTACGCTTTTGGCAGCTCCCCTCGCAG
CCCCTCTGGAAACGTACAGCCTCAGGAGCAGCCAGTGGCTTGGGACCTGGGGTGGTGTGTGTCTGCGGAGCTTCTTGGGCTGCCCCATTT
CCTAGCGGCCCCCACCTCCCCACTTCCCGCTCAGAGTTAGAGATAAGGATCTCAGACTTTTGCCTGAGTAAGGGTCTCCGCACTCTTTAT
CCATTTGGTTTTCGATTTCCCGTTTTTGTTTCTTATTTCACCAATTCTGGTACACGCTAGTTTTTAAGGCTGGAGGTTCTCGAGCGCTTG
CTGCCAAGGACTCCCCCACCCCCTCCCCCACTGATGGAGTCCGAAATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCT
GATCTTACAGACTGGAACCTACCTTTGGCTTTTATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGG
AGGATGAAGGATCGGATGAAGACAGTCAGTGTTGCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACG
CCCTGTGCACGCTTGGAATGCTGGATCGATCCTCTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAG
TACGAGAACTGGCAGCCAAGGTGTCTTCGAGAGAACTCTGACGTGAAGACGCACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAA
TGCAAGGAGACAGCCAGCAAGACCCTCAGCAGGTTTGGGATTCAGCCGTGCTCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTG
CCCTGCGACCACGTGCACTGCCTGCGCTGCCTCAGGGCCTGGTTTGCCTCAGAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCA
GACGAATTCTCTCCAGCTGTTTCCCAAGCGCACAGGGAAGCCATTGAAAAGCATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTA
GACCTGGTGTCCACCATTTGCTTCAAGGACAACGCTCCGCCTGAGAAGGAAGTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAG
GGGCGCTTAAGAGATGCTGCCCAGAGACACTGTGAACACACAAAATCTCTCTCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATC
CGCTCAGTGATACTGAAACTGCTTTTGAAGTACAGCTTTCATGATGTAAAAGATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAA
GCATTCATAACTGAAGATAAAACTGAACTGTACATGCTCTTCATCAACTGCCTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCC
AGAAATGATGAACTGAACCACCTAGAAGAGGAAGGTCGTTTCCTTAAGGCATATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAG
GCCTCGGTTGAATACCTGCAAGAGGTGGCCCGGATCCGCCTCTGCCTCGACAGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCA
GAGATGGCCAAGGAGAAGCAGTGCTACCTGCAGCAAGTCAAGCAGTTCTGTATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTG
CGGAAGCTCAGCAGCCAGCGGGGGATGGAGTTCGTGCAGGGCCTCTCCAAGCCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTT
GTCAAGCAGCAGGGGCTGCGGCAGGACCACCCAGGCCAGATGGATAGGTACCTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCT
GTGGCCAAAGCTGTCCTCGAGTGCAAGCCACTGGGCATTAAGACTGCTCTGAAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTAC
TTCCTGTTAACACTGTTTAGAGAGGTGGCTATTTTGTACAGATCCCACAATGCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTG
AGCAAATTCATTGGCGAATGCAAGATCCTTTCACCTCCTGATATCAGCCGTTTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTG
AGGGCGGGGCCTAGTGACAGCAACCTTGATGGAACGGTGACAGAAATGGCCATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAA
CTCTTGGAGCCCCTAAAGAATCTGGCCTTCTCCCCAGCCACCATGGCGCATGCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAA
GCTCGGAGGTGGAAGGGTCTGGAGCGAGTCCACTGGTACACTTGTCCCAACGGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATG
GAACAGAGCATCTGCATTGACTGCCATGCGCCGATTGGAGGCATTGACCACAAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCA
GACAGAACGCAGACCGGCCACGTGCTGGGCAACCCGCAGCGGAGAGACGTGGTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTC
CTTATCCGGCTACTCACTCACTTGGCTCTGCTTCTGGGAGCGTCCCAGAGTTCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGG
GATCCAAAAGGCTTTCTGCAGCAGCACATCCTGAAGGACCTGGAGCAGTTGGCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGC
GTGGTCCACCTCGTCCTGCGCAGGCTTCTCCAAGAGCAGCACCAGCTCTCTAGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACT
AAAGAAATGAGGAACAACTGGGAAAAGGAAATCGCAGCTGTGATTTCTCCTGAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAAT
AATCTCATCAGCCAAGATAAGCGTATCAGCTCTAACCCTGTGGCCAAAATAATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCC
CGGAAAAGTGTGGTCCATTGCTCTAAGATTTGGAGCTGCAGGAAAAGAATTACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAAT
GGCAAAGAAAGAGTGCCCATCCTCTGGCATTTCCTGCAGAAGGAAGCAGAGCTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTG
CAAAGGGATCTAGTGAAGCAGTTCCAGAACGTCCAGCAAGTTGAATACAGCTCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGG
TTGAGGCAGCTGCTTCACAACAGGATCACAGTCTTTCTGTCCACATGGAACAAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAAC
CTACCCAAAGACTACTGCAGCACTGACTTGGATCTGGACACTGAGTTTGAGATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCT
ACCGCTCTCGTCAGCTACTTGATTCGCCTACACAATGAAATTGTCTACGCCGTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTG
GATGCCGCCGAGGTCACTGAACTGCATGTCATCAGTTATGAAGTGGAGCGGGACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAG
GTGGAGGAGGGCAGAGAGACCGTGCAGGAGTTCGATCTGGAGAAGATTCAGCGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGG
CTGAGCCTCAAGGGAATACCCACTCTGGTGTACAGACACGACTGGAACTATGAACATCTCTTTATGGACATCAAGAACAAAATGGCACAG
GACTCCCTCCCCAGCTCGGTCATTAGTGCCATCAGTGGACAGCTGCAGTCCTACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTC
ACTCTGGGGTTTCTGAGCACAGCTGGTGGGGATCCAAACATGCAGCTGAATGTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACG
ATTCACGTGTTAAAGGCCTTAAACAGATGCCAGTTAAAACACACCATTGCCCTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTG
CTGCGGCTGCACAAAGAGCCATTTGGGGAAATCAGTTCAAGGTACAAAGCGGATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTC
CTAAATCAGACTGGCCTAGACGCCTTCCTGCTAGAGCTGCACGAAATGATAATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAG
CGCTTCCGCCCTCAGTGGAGCCTGAGAGACACTCTCGTAAGTTACATGCAAACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAG
TTCCCAGAAGAGATACTGCTCGCCAGCTGTGTCTCAGTGTGGAAAACAGCTGCTGTGCTGAAATGGAATCGAGAAATGAGATAGAATTAT
TTCCTCAGCTATCTTTGGATGACTTTGGAGAGAAGACTCCTCTCTCCTCGTCTGCGGCGTGGACTTGATCATGGACTGGTGCCTTTGCAT
TCAGAAGGAGAGCTGTCAGCGTAGCACCGAATTCAAGACCAAGGCGTGCTACCTGAGCTGACAGCTTTTTGAAAGCCGAGCTGTTTCTGA
ACCATGTACATACATGTTCTGAAACTTTCTCATCATTTTATGAGTACTGTTCATTGAGAGATGACAATGAAGATTAGATGAAATTGGAAA
TAAACCAACATTGTTTACATTCCAGGAGACTTGTAGCTCAGCCACACACGCAGTAATGACCTGTGCCCGTTCGCCTCTGGCACTGCCCAC
CCCTCTTTTTTTTTTTCTTCTAATTCTGTACTCACAAAAGAGAATCTCATTTTCTTCTTTCTTCCATTCCCTTAAATTCTGAGTACTGTA
CATATATTTCTGGGTTCCCACGATGATGTGAAAAACTACCAGACTGTTTTTTGTCTTCTCACAAAGACAAGAAAAATCAGGGCATTTTGT
GAGTGCCTTAAGATCAAACTAACAAGATCTGACCCTCTCCCCTCACAGTGAGCCACTGCCCCACTTCAGAGGGTAAGAGCCAAAAGCCTC
ATTGTGAAAGGCACTGGACTTGGACCAGGGACACCATCAGGGCCTTGGTTTTCTCACGCATAAAATGGAGAGTGGATTAATCGCCAAAGA
TTCTTCTGATCTGACATTTTGAAATTGTGAGAGAAACTAGATGACTGTAAACTTGGTCACAGGCCTGGTTCTGGCAGTTCTTTGCGGACT
TTTTTCTAGCATTATGCCAAATAAACATGCAGTCTCAGTGTGCTCTCGCATGTATGAATATCTAGTCCTTTCTGTGGTTCTCAGCCAAGA
CATAAAAACTAGGACTCAGAGCACATACAAAACCAGTTATGTTTCGGAAAGAGGGAAAAGAGTCCCCGAGCCCGGATCTTGTGCTGCTTT
TCTCACTGACGTGTTGCCTTTTTTCTTTACAAAATCTGCTTTGATACTTAGGACCTCTCTGGACTAATTTCTCTTCCTAGACAGCTCAGC
ACAGCTATTGATATGTTAGAGGCAGTATCCTTAATATTCATTCTAAATGAGTTAACGACTTAACTTGAAATTGGGCCTAAGGAGTGAGAA
CTACAAAAATACAAAATGCTTGTCCAGGACTCAGCCATGCACACCTTGAGCAGCGCCGGCAGGAGGCACGGAAGGAACTGTGCTCCGTTC
TCCTCACTGTCATGGTGCCACCAGTGTCTGATGAAGGGCAGAGTGACCCAGACTGCAGGCAGTAACTGACTTCACACAGTCCCTGGCATT
TAGTCATCTGTGATTGTTTTATCACTCTGGACTGTGCAGAGCCACCTGCCACCGAGATCTGCATTCCGACTGCCTATGAACGGGTGTGGG
GGCCGGGGGCTGGCTTGCTGAAGTCTTCAACTTGCACTCGGAGCTCCTTTGATACCTCAGAGCTGGCTGTCAGGTGGCAGCTCACACCCA
GACTCACTGGCCACACCTCAGCAGGGGGGGAGTCGAGTGTCAGTCTCTTTCTGTGAAGGCTTTTTTTTTCCTTTGGCCTGGGAATTTTTC
CCATTTTTATGAAGGGGTTTTAAATTGTTTCATTTTGTGTGCTGTGCTTCAAAGCCTTAACTGTCAAATCTTGCATTATCTTGTTTGTAC
AGAAATATACTGGCCTAGCAGAGGCAAAAAAAAAAAAAATGAATTTTATTTTACTTGTCACACCTGTCTTAATAAACTGGAGTTTTGCTG

>In-frame_RPTOR_ENST00000306801_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_6277nt
GAGAGCAGGGTCATCGTGAGGCCTGAAGTCTCTTACGCTTTTGGCAGCTCCCCTCGCAGCCCCTCTGGAAACGTACAGCCTCAGGAGCAG
CCAGTGGCTTGGGACCTGGGGTGGTGTGTGTCTGCGGAGCTTCTTGGGCTGCCCCATTTCCTAGCGGCCCCCACCTCCCCACTTCCCGCT
CAGAGTTAGAGATAAGGATCTCAGACTTTTGCCTGAGTAAGGGTCTCCGCACTCTTTATCCATTTGGTTTTCGATTTCCCGTTTTTGTTT
CTTATTTCACCAATTCTGGTACACGCTAGTTTTTAAGGCTGGAGGTTCTCGAGCGCTTGCTGCCAAGGACTCCCCCACCCCCTCCCCCAC
TGATGGAGTCCGAAATGCTGCAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTT
TTATGAAAAAGAGGCACTGTGAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTG
TTGCCTTAGTTTTGTGCCTGAATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATC
CTCTGTCGATGGGTCCTCAGAAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGTGTCTTCGAG
AGAACTCTGACGTGAAGACGCACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAATGCAAGGAGACAGCCAGCAAGACCCTCAGCA
GGTTTGGGATTCAGCCGTGCTCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTGCCCTGCGACCACGTGCACTGCCTGCGCTGCC
TCAGGGCCTGGTTTGCCTCAGAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCAGACGAATTCTCTCCAGCTGTTTCCCAAGCGC
ACAGGGAAGCCATTGAAAAGCATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTAGACCTGGTGTCCACCATTTGCTTCAAGGACA
ACGCTCCGCCTGAGAAGGAAGTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAGGGGCGCTTAAGAGATGCTGCCCAGAGACACT
GTGAACACACAAAATCTCTCTCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATCCGCTCAGTGATACTGAAACTGCTTTTGAAGT
ACAGCTTTCATGATGTAAAAGATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAAGCATTCATAACTGAAGATAAAACTGAACTGT
ACATGCTCTTCATCAACTGCCTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCCAGAAATGATGAACTGAACCACCTAGAAGAGG
AAGGTCGTTTCCTTAAGGCATATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAGGCCTCGGTTGAATACCTGCAAGAGGTGGCCC
GGATCCGCCTCTGCCTCGACAGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCAGAGATGGCCAAGGAGAAGCAGTGCTACCTGC
AGCAAGTCAAGCAGTTCTGTATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTGCGGAAGCTCAGCAGCCAGCGGGGGATGGAGT
TCGTGCAGGGCCTCTCCAAGCCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTTGTCAAGCAGCAGGGGCTGCGGCAGGACCACC
CAGGCCAGATGGATAGGTACCTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCTGTGGCCAAAGCTGTCCTCGAGTGCAAGCCAC
TGGGCATTAAGACTGCTCTGAAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTACTTCCTGTTAACACTGTTTAGAGAGGTGGCTA
TTTTGTACAGATCCCACAATGCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTGAGCAAATTCATTGGCGAATGCAAGATCCTTT
CACCTCCTGATATCAGCCGTTTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTGAGGGCGGGGCCTAGTGACAGCAACCTTGATG
GAACGGTGACAGAAATGGCCATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAACTCTTGGAGCCCCTAAAGAATCTGGCCTTCT
CCCCAGCCACCATGGCGCATGCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAAGCTCGGAGGTGGAAGGGTCTGGAGCGAGTCC
ACTGGTACACTTGTCCCAACGGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATGGAACAGAGCATCTGCATTGACTGCCATGCGC
CGATTGGAGGCATTGACCACAAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCAGACAGAACGCAGACCGGCCACGTGCTGGGCA
ACCCGCAGCGGAGAGACGTGGTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTCCTTATCCGGCTACTCACTCACTTGGCTCTGC
TTCTGGGAGCGTCCCAGAGTTCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGGGATCCAAAAGGCTTTCTGCAGCAGCACATCC
TGAAGGACCTGGAGCAGTTGGCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGCGTGGTCCACCTCGTCCTGCGCAGGCTTCTCC
AAGAGCAGCACCAGCTCTCTAGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACTAAAGAAATGAGGAACAACTGGGAAAAGGAAA
TCGCAGCTGTGATTTCTCCTGAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAATAATCTCATCAGCCAAGATAAGCGTATCAGCT
CTAACCCTGTGGCCAAAATAATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCCCGGAAAAGTGTGGTCCATTGCTCTAAGATTT
GGAGCTGCAGGAAAAGAATTACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAATGGCAAAGAAAGAGTGCCCATCCTCTGGCATT
TCCTGCAGAAGGAAGCAGAGCTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTGCAAAGGGATCTAGTGAAGCAGTTCCAGAACG
TCCAGCAAGTTGAATACAGCTCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGGTTGAGGCAGCTGCTTCACAACAGGATCACAG
TCTTTCTGTCCACATGGAACAAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAACCTACCCAAAGACTACTGCAGCACTGACTTGG
ATCTGGACACTGAGTTTGAGATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCTACCGCTCTCGTCAGCTACTTGATTCGCCTAC
ACAATGAAATTGTCTACGCCGTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTGGATGCCGCCGAGGTCACTGAACTGCATGTCA
TCAGTTATGAAGTGGAGCGGGACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAGGTGGAGGAGGGCAGAGAGACCGTGCAGGAGT
TCGATCTGGAGAAGATTCAGCGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGGCTGAGCCTCAAGGGAATACCCACTCTGGTGT
ACAGACACGACTGGAACTATGAACATCTCTTTATGGACATCAAGAACAAAATGGCACAGGACTCCCTCCCCAGCTCGGTCATTAGTGCCA
TCAGTGGACAGCTGCAGTCCTACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTCACTCTGGGGTTTCTGAGCACAGCTGGTGGGG
ATCCAAACATGCAGCTGAATGTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACGATTCACGTGTTAAAGGCCTTAAACAGATGCC
AGTTAAAACACACCATTGCCCTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTGCTGCGGCTGCACAAAGAGCCATTTGGGGAAA
TCAGTTCAAGGTACAAAGCGGATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTCCTAAATCAGACTGGCCTAGACGCCTTCCTGC
TAGAGCTGCACGAAATGATAATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAGCGCTTCCGCCCTCAGTGGAGCCTGAGAGACA
CTCTCGTAAGTTACATGCAAACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAGTTCCCAGAAGAGATACTGCTCGCCAGCTGTG
TCTCAGTGTGGAAAACAGCTGCTGTGCTGAAATGGAATCGAGAAATGAGATAGAATTATTTCCTCAGCTATCTTTGGATGACTTTGGAGA
GAAGACTCCTCTCTCCTCGTCTGCGGCGTGGACTTGATCATGGACTGGTGCCTTTGCATTCAGAAGGAGAGCTGTCAGCGTAGCACCGAA
TTCAAGACCAAGGCGTGCTACCTGAGCTGACAGCTTTTTGAAAGCCGAGCTGTTTCTGAACCATGTACATACATGTTCTGAAACTTTCTC
ATCATTTTATGAGTACTGTTCATTGAGAGATGACAATGAAGATTAGATGAAATTGGAAATAAACCAACATTGTTTACATTCCAGGAGACT
TGTAGCTCAGCCACACACGCAGTAATGACCTGTGCCCGTTCGCCTCTGGCACTGCCCACCCCTCTTTTTTTTTTTCTTCTAATTCTGTAC
TCACAAAAGAGAATCTCATTTTCTTCTTTCTTCCATTCCCTTAAATTCTGAGTACTGTACATATATTTCTGGGTTCCCACGATGATGTGA
AAAACTACCAGACTGTTTTTTGTCTTCTCACAAAGACAAGAAAAATCAGGGCATTTTGTGAGTGCCTTAAGATCAAACTAACAAGATCTG
ACCCTCTCCCCTCACAGTGAGCCACTGCCCCACTTCAGAGGGTAAGAGCCAAAAGCCTCATTGTGAAAGGCACTGGACTTGGACCAGGGA
CACCATCAGGGCCTTGGTTTTCTCACGCATAAAATGGAGAGTGGATTAATCGCCAAAGATTCTTCTGATCTGACATTTTGAAATTGTGAG
AGAAACTAGATGACTGTAAACTTGGTCACAGGCCTGGTTCTGGCAGTTCTTTGCGGACTTTTTTCTAGCATTATGCCAAATAAACATGCA
GTCTCAGTGTGCTCTCGCATGTATGAATATCTAGTCCTTTCTGTGGTTCTCAGCCAAGACATAAAAACTAGGACTCAGAGCACATACAAA
ACCAGTTATGTTTCGGAAAGAGGGAAAAGAGTCCCCGAGCCCGGATCTTGTGCTGCTTTTCTCACTGACGTGTTGCCTTTTTTCTTTACA
AAATCTGCTTTGATACTTAGGACCTCTCTGGACTAATTTCTCTTCCTAGACAGCTCAGCACAGCTATTGATATGTTAGAGGCAGTATCCT
TAATATTCATTCTAAATGAGTTAACGACTTAACTTGAAATTGGGCCTAAGGAGTGAGAACTACAAAAATACAAAATGCTTGTCCAGGACT
CAGCCATGCACACCTTGAGCAGCGCCGGCAGGAGGCACGGAAGGAACTGTGCTCCGTTCTCCTCACTGTCATGGTGCCACCAGTGTCTGA
TGAAGGGCAGAGTGACCCAGACTGCAGGCAGTAACTGACTTCACACAGTCCCTGGCATTTAGTCATCTGTGATTGTTTTATCACTCTGGA
CTGTGCAGAGCCACCTGCCACCGAGATCTGCATTCCGACTGCCTATGAACGGGTGTGGGGGCCGGGGGCTGGCTTGCTGAAGTCTTCAAC
TTGCACTCGGAGCTCCTTTGATACCTCAGAGCTGGCTGTCAGGTGGCAGCTCACACCCAGACTCACTGGCCACACCTCAGCAGGGGGGGA
GTCGAGTGTCAGTCTCTTTCTGTGAAGGCTTTTTTTTTCCTTTGGCCTGGGAATTTTTCCCATTTTTATGAAGGGGTTTTAAATTGTTTC
ATTTTGTGTGCTGTGCTTCAAAGCCTTAACTGTCAAATCTTGCATTATCTTGTTTGTACAGAAATATACTGGCCTAGCAGAGGCAAAAAA

>In-frame_RPTOR_ENST00000544334_chr17_78617610_+_RNF213_ENST00000508628_chr17_78341548_+_6077nt
TCAGACTTTTGCCTGAGTAAGGGTCTCCGCACTCTTTATCCATTTGGTTTTCGATTTCCCGTTTTTGTTTCTTATTTCACCAATTCTGGT
ACACGCTAGTTTTTAAGGCTGGAGGTTCTCGAGCGCTTGCTGCCAAGGACTCCCCCACCCCCTCCCCCACTGATGGAGTCCGAAATGCTG
CAATCGCCTCTTCTGGGCCTGGGGGAGGAAGATGAGGCTGATCTTACAGACTGGAACCTACCTTTGGCTTTTATGAAAAAGAGGCACTGT
GAGAAAATTGAAGGCTCCAAATCCTTAGCTCAGAGCTGGAGGATGAAGGATCGGATGAAGACAGTCAGTGTTGCCTTAGTTTTGTGCCTG
AATGTTGGTGTGGACCCTCCCGATGTGGTGAAGACCACGCCCTGTGCACGCTTGGAATGCTGGATCGATCCTCTGTCGATGGGTCCTCAG
AAAGCTCTGGAAACCATCGGTGCAAATTTACAGAAGCAGTACGAGAACTGGCAGCCAAGGTGTCTTCGAGAGAACTCTGACGTGAAGACG
CACGGGCCTTTTGAGGCCGTGATGCGCACTCTCTGTGAATGCAAGGAGACAGCCAGCAAGACCCTCAGCAGGTTTGGGATTCAGCCGTGC
TCCATCTGCCTGGGAGATGCAAAGGACCCCGTCTGTCTGCCCTGCGACCACGTGCACTGCCTGCGCTGCCTCAGGGCCTGGTTTGCCTCA
GAGCAGATGATATGCCCCTACTGTTTAACTGCCTTGCCAGACGAATTCTCTCCAGCTGTTTCCCAAGCGCACAGGGAAGCCATTGAAAAG
CATGCCCGCTTCCGGCAGATGTGCAACAGTTTCTTCGTAGACCTGGTGTCCACCATTTGCTTCAAGGACAACGCTCCGCCTGAGAAGGAA
GTGATTGAGAGCCTGCTCTCTCTCCTCTTCGTCCAAAAGGGGCGCTTAAGAGATGCTGCCCAGAGACACTGTGAACACACAAAATCTCTC
TCTCCATTCAATGATGTTGTGGATAAGACTCCTGTCATCCGCTCAGTGATACTGAAACTGCTTTTGAAGTACAGCTTTCATGATGTAAAA
GATTATATTCAGGAATATTTGACCCTGTTAAAAAAGAAAGCATTCATAACTGAAGATAAAACTGAACTGTACATGCTCTTCATCAACTGC
CTGGAGGATTCAATACTTGAGAAGACCAGTGCTTACTCCAGAAATGATGAACTGAACCACCTAGAAGAGGAAGGTCGTTTCCTTAAGGCA
TATTCTCCAGCAAGCCGGGGCCGAGAGCCTGCCAACGAGGCCTCGGTTGAATACCTGCAAGAGGTGGCCCGGATCCGCCTCTGCCTCGAC
AGAGCTGCAGATTTCCTCTCGGAGCCTGAGGGAGGCCCAGAGATGGCCAAGGAGAAGCAGTGCTACCTGCAGCAAGTCAAGCAGTTCTGT
ATCCGGGTGGAGAACGACTGGCACCGGGTGTACCTGGTGCGGAAGCTCAGCAGCCAGCGGGGGATGGAGTTCGTGCAGGGCCTCTCCAAG
CCCGGCCGCCCGCACCAGTGGGTGTTTCCCAAGGACGTTGTCAAGCAGCAGGGGCTGCGGCAGGACCACCCAGGCCAGATGGATAGGTAC
CTGGTGTACGGCGATGAATACAAGGCTCTCCGTGATGCTGTGGCCAAAGCTGTCCTCGAGTGCAAGCCACTGGGCATTAAGACTGCTCTG
AAGGCCTGCAAGACCCCCCAAAGCCAGCAGTCAGCCTACTTCCTGTTAACACTGTTTAGAGAGGTGGCTATTTTGTACAGATCCCACAAT
GCAAGCCTCCACCCCACGCCAGAGCAATGTGAAGCTGTGAGCAAATTCATTGGCGAATGCAAGATCCTTTCACCTCCTGATATCAGCCGT
TTTGCAACATCGCTCGTGGACAATTCTGTGCCATTGTTGAGGGCGGGGCCTAGTGACAGCAACCTTGATGGAACGGTGACAGAAATGGCC
ATTCATGCTGCAGCCGTCCTTCTGTGTGGACAGAATGAACTCTTGGAGCCCCTAAAGAATCTGGCCTTCTCCCCAGCCACCATGGCGCAT
GCTTTTCTTCCAACCATGCCTGAAGACTTGCTGGCTCAAGCTCGGAGGTGGAAGGGTCTGGAGCGAGTCCACTGGTACACTTGTCCCAAC
GGCCATCCTTGCTCCGTGGGAGAGTGTGGCAGGCCGATGGAACAGAGCATCTGCATTGACTGCCATGCGCCGATTGGAGGCATTGACCAC
AAACCTCGGGACGGCTTTCATCTGGTCAAAGACAAGGCAGACAGAACGCAGACCGGCCACGTGCTGGGCAACCCGCAGCGGAGAGACGTG
GTGACATGTGACCGAGGGCTGCCCCCAGTGGTCTTCCTCCTTATCCGGCTACTCACTCACTTGGCTCTGCTTCTGGGAGCGTCCCAGAGT
TCCCAGGCTCTGATAAACATCATTAAGCCTCCAGTGAGGGATCCAAAAGGCTTTCTGCAGCAGCACATCCTGAAGGACCTGGAGCAGTTG
GCCAAGATGCTGGGACACAGTGCCGACGAGACCATCGGCGTGGTCCACCTCGTCCTGCGCAGGCTTCTCCAAGAGCAGCACCAGCTCTCT
AGCAGAAGGCTTTTAAATTTTGACACAGAATTGTCAACTAAAGAAATGAGGAACAACTGGGAAAAGGAAATCGCAGCTGTGATTTCTCCT
GAACTGGAGCATCTAGATAAAACCCTTCCCACCATGAATAATCTCATCAGCCAAGATAAGCGTATCAGCTCTAACCCTGTGGCCAAAATA
ATATATGGTGACCCAGTGACCTTCCTGCCCCACCTGCCCCGGAAAAGTGTGGTCCATTGCTCTAAGATTTGGAGCTGCAGGAAAAGAATT
ACAGTTGAGTACCTCCAGCACATTGTGGAACAGAAAAATGGCAAAGAAAGAGTGCCCATCCTCTGGCATTTCCTGCAGAAGGAAGCAGAG
CTGAGGCTGGTAAAGTTCCTGCCTGAGATTTTGGCCTTGCAAAGGGATCTAGTGAAGCAGTTCCAGAACGTCCAGCAAGTTGAATACAGC
TCCATCAGAGGCTTCCTCAGCAAGCACAGCTCAGATGGGTTGAGGCAGCTGCTTCACAACAGGATCACAGTCTTTCTGTCCACATGGAAC
AAACTGAGGAGATCGCTTGAGACGAACGGTGAGATCAACCTACCCAAAGACTACTGCAGCACTGACTTGGATCTGGACACTGAGTTTGAG
ATCCTCTTGCCACGCCGACGGGGCCTGGGCCTCTGTGCTACCGCTCTCGTCAGCTACTTGATTCGCCTACACAATGAAATTGTCTACGCC
GTGGAAAAACTCTCCAAGGAAAACAACAGCTATTCCGTGGATGCCGCCGAGGTCACTGAACTGCATGTCATCAGTTATGAAGTGGAGCGG
GACCTGACTCCACTGATTCTCTCCAACTGCCAGTACCAGGTGGAGGAGGGCAGAGAGACCGTGCAGGAGTTCGATCTGGAGAAGATTCAG
CGGCAGATCGTCAGCCGCTTCCTCCAGGGCAAGCCCCGGCTGAGCCTCAAGGGAATACCCACTCTGGTGTACAGACACGACTGGAACTAT
GAACATCTCTTTATGGACATCAAGAACAAAATGGCACAGGACTCCCTCCCCAGCTCGGTCATTAGTGCCATCAGTGGACAGCTGCAGTCC
TACAGCGATGCCTGTGAAGTGCTGTCTGTCGTAGAAGTCACTCTGGGGTTTCTGAGCACAGCTGGTGGGGATCCAAACATGCAGCTGAAT
GTGTATACTCAAGACATCCTGCAAATGGGTGATCAGACGATTCACGTGTTAAAGGCCTTAAACAGATGCCAGTTAAAACACACCATTGCC
CTCTGGCAGTTCCTGTCTGCTCATAAGTCTGAACAGCTGCTGCGGCTGCACAAAGAGCCATTTGGGGAAATCAGTTCAAGGTACAAAGCG
GATCTGAGCCCGGAAAATGCTAAGCTCCTCAGCACATTCCTAAATCAGACTGGCCTAGACGCCTTCCTGCTAGAGCTGCACGAAATGATA
ATCTTGAAACTAAAGAACCCCCAAACCCAAACCGAGGAGCGCTTCCGCCCTCAGTGGAGCCTGAGAGACACTCTCGTAAGTTACATGCAA
ACTAAAGAAAGTGAAATTCTTCCTGAAATGGCATCTCAGTTCCCAGAAGAGATACTGCTCGCCAGCTGTGTCTCAGTGTGGAAAACAGCT
GCTGTGCTGAAATGGAATCGAGAAATGAGATAGAATTATTTCCTCAGCTATCTTTGGATGACTTTGGAGAGAAGACTCCTCTCTCCTCGT
CTGCGGCGTGGACTTGATCATGGACTGGTGCCTTTGCATTCAGAAGGAGAGCTGTCAGCGTAGCACCGAATTCAAGACCAAGGCGTGCTA
CCTGAGCTGACAGCTTTTTGAAAGCCGAGCTGTTTCTGAACCATGTACATACATGTTCTGAAACTTTCTCATCATTTTATGAGTACTGTT
CATTGAGAGATGACAATGAAGATTAGATGAAATTGGAAATAAACCAACATTGTTTACATTCCAGGAGACTTGTAGCTCAGCCACACACGC
AGTAATGACCTGTGCCCGTTCGCCTCTGGCACTGCCCACCCCTCTTTTTTTTTTTCTTCTAATTCTGTACTCACAAAAGAGAATCTCATT
TTCTTCTTTCTTCCATTCCCTTAAATTCTGAGTACTGTACATATATTTCTGGGTTCCCACGATGATGTGAAAAACTACCAGACTGTTTTT
TGTCTTCTCACAAAGACAAGAAAAATCAGGGCATTTTGTGAGTGCCTTAAGATCAAACTAACAAGATCTGACCCTCTCCCCTCACAGTGA
GCCACTGCCCCACTTCAGAGGGTAAGAGCCAAAAGCCTCATTGTGAAAGGCACTGGACTTGGACCAGGGACACCATCAGGGCCTTGGTTT
TCTCACGCATAAAATGGAGAGTGGATTAATCGCCAAAGATTCTTCTGATCTGACATTTTGAAATTGTGAGAGAAACTAGATGACTGTAAA
CTTGGTCACAGGCCTGGTTCTGGCAGTTCTTTGCGGACTTTTTTCTAGCATTATGCCAAATAAACATGCAGTCTCAGTGTGCTCTCGCAT
GTATGAATATCTAGTCCTTTCTGTGGTTCTCAGCCAAGACATAAAAACTAGGACTCAGAGCACATACAAAACCAGTTATGTTTCGGAAAG
AGGGAAAAGAGTCCCCGAGCCCGGATCTTGTGCTGCTTTTCTCACTGACGTGTTGCCTTTTTTCTTTACAAAATCTGCTTTGATACTTAG
GACCTCTCTGGACTAATTTCTCTTCCTAGACAGCTCAGCACAGCTATTGATATGTTAGAGGCAGTATCCTTAATATTCATTCTAAATGAG
TTAACGACTTAACTTGAAATTGGGCCTAAGGAGTGAGAACTACAAAAATACAAAATGCTTGTCCAGGACTCAGCCATGCACACCTTGAGC
AGCGCCGGCAGGAGGCACGGAAGGAACTGTGCTCCGTTCTCCTCACTGTCATGGTGCCACCAGTGTCTGATGAAGGGCAGAGTGACCCAG
ACTGCAGGCAGTAACTGACTTCACACAGTCCCTGGCATTTAGTCATCTGTGATTGTTTTATCACTCTGGACTGTGCAGAGCCACCTGCCA
CCGAGATCTGCATTCCGACTGCCTATGAACGGGTGTGGGGGCCGGGGGCTGGCTTGCTGAAGTCTTCAACTTGCACTCGGAGCTCCTTTG
ATACCTCAGAGCTGGCTGTCAGGTGGCAGCTCACACCCAGACTCACTGGCCACACCTCAGCAGGGGGGGAGTCGAGTGTCAGTCTCTTTC
TGTGAAGGCTTTTTTTTTCCTTTGGCCTGGGAATTTTTCCCATTTTTATGAAGGGGTTTTAAATTGTTTCATTTTGTGTGCTGTGCTTCA
AAGCCTTAACTGTCAAATCTTGCATTATCTTGTTTGTACAGAAATATACTGGCCTAGCAGAGGCAAAAAAAAAAAAAATGAATTTTATTT


Top

FusionGenePPI for RPTOR_RNF213


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RPTORMTOR, FKBP1A, EIF4EBP1, GDI2P1, PLD2, RPS6KB1, PDK1, RHEB, EIF3B, EIF3C, MLST8, RRAGA, RRAGC, RPS6, TIRAP, IQGAP1, USP9X, PRKAA1, PRKAA2, YWHAQ, SQSTM1, RRAGB, MAPK8, ICK, CCNB1, AKT1S1, DEPTOR, IRS1, EIF4E, MAPK3, MAPK1, HSPA4, ULK1, RICTOR, RPS6KA1, IRS2, RRAGD, HIF1A, CUL4A, CUL4B, DDB1, UCHL1, SIRT1, PREX1, LARS, RPTOR, AKT1, PDIA3, MARK4, AMBRA1, TRAF6, FKBP8, GNB1, GNG2, RAP1B, CHUK, IKBKB, IKBKG, SGK1, MOV10, NXF1, LAMTOR2, GTF3C1, TXNDC15, NT5E, BAG3, FAF2, HTR6, EIF4EBP2, SCAP, NTRK1, XPO1, RAB1A, PARK2, BRAT1, MTMR3, NFATC1, NFATC2, ZNRF2, INTU, IQCF1, CD79B, TPP1, CCT7, DKKL1, IL13RA2, PDCD1, TRIB2, PMEL, BRAF, NTRK3, CT55, CCDC6, KCTD3, KIF13B, ZBTB21, KSR1, GIGYF1, LRFN1, CGN, DENND1A, SH3PXD2A, SRGAP2, RTKN, MAST3, DENND4C, EIF4E2, SIPA1L1, PPM1H, LIMA1, MAGI1, TESK2, DCLK1, ZNF638, LPIN3, CBY1, INPP5E, ESR1, TRIM25, BRCA1, EP300RNF213UBC, CBX2, CBX4, CBX6, EGFR, PLAC9, RNF213, TRIM23, GOLGA2, REL, TRIM27, TRIP6, UBXN11, KRT40, CD244, SCN2B, IFI16, PTPN1, MRPL50, RNASEH2B, GAN, MCM2, ATOH1, DLK2, SIGLECL1, SDC2, LAMP3, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RPTOR_RNF213


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RPTOR_RNF213


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRPTORC0040336Tobacco Use Disorder1CTD_human
TgeneRNF213C1846689MOYAMOYA DISEASE 23UNIPROT