FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 32158

FusionGeneSummary for RPS6KB1_VMP1

check button Fusion gene summary
Fusion gene informationFusion gene name: RPS6KB1_VMP1
Fusion gene ID: 32158
HgeneTgene
Gene symbol

RPS6KB1

VMP1

Gene ID

6198

81671

Gene nameribosomal protein S6 kinase B1vacuole membrane protein 1
SynonymsPS6K|S6K|S6K-beta-1|S6K1|STK14A|p70 S6KA|p70(S6K)-alpha|p70-S6K|p70-alphaEPG3|TANGO5|TMEM49
Cytomap

17q23.1

17q23.1

Type of geneprotein-codingprotein-coding
Descriptionribosomal protein S6 kinase beta-1p70 S6 kinase, alpharibosomal protein S6 kinase Iribosomal protein S6 kinase, 70kDa, polypeptide 1serine/threonine kinase 14 alphaserine/threonine-protein kinase 14Avacuole membrane protein 1ectopic P-granules autophagy protein 3 homologtransmembrane protein 49transport and golgi organization 5 homolog
Modification date2018052320180523
UniProtAcc

P23443

Q96GC9

Ensembl transtripts involved in fusion geneENST00000443572, ENST00000406116, 
ENST00000225577, ENST00000393021, 
ENST00000587061, 
ENST00000262291, 
ENST00000537567, ENST00000539763, 
ENST00000536180, ENST00000545362, 
ENST00000588617, 
Fusion gene scores* DoF score8 X 5 X 4=16024 X 11 X 12=3168
# samples 827
** MAII scorelog2(8/160*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(27/3168*10)=-3.55254102302878
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RPS6KB1 [Title/Abstract] AND VMP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRPS6KB1

GO:0031929

TOR signaling

12150926

HgeneRPS6KB1

GO:0071363

cellular response to growth factor stimulus

17936702


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-P3-A6T4-01ARPS6KB1chr17

57990165

+VMP1chr17

57886157

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000443572ENST00000262291RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000443572ENST00000537567RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000443572ENST00000539763RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000443572ENST00000536180RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000443572ENST00000545362RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
5CDS-intronENST00000443572ENST00000588617RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000406116ENST00000262291RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000406116ENST00000537567RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000406116ENST00000539763RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000406116ENST00000536180RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000406116ENST00000545362RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
5CDS-intronENST00000406116ENST00000588617RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000225577ENST00000262291RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000225577ENST00000537567RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000225577ENST00000539763RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000225577ENST00000536180RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000225577ENST00000545362RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
5CDS-intronENST00000225577ENST00000588617RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000393021ENST00000262291RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000393021ENST00000537567RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000393021ENST00000539763RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000393021ENST00000536180RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
In-frameENST00000393021ENST00000545362RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
5CDS-intronENST00000393021ENST00000588617RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-3CDSENST00000587061ENST00000262291RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-3CDSENST00000587061ENST00000537567RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-3CDSENST00000587061ENST00000539763RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-3CDSENST00000587061ENST00000536180RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-3CDSENST00000587061ENST00000545362RPS6KB1chr17

57990165

+VMP1chr17

57886157

+
intron-intronENST00000587061ENST00000588617RPS6KB1chr17

57990165

+VMP1chr17

57886157

+

Top

FusionProtFeatures for RPS6KB1_VMP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RPS6KB1

P23443

VMP1

Q96GC9

Serine/threonine-protein kinase that acts downstream ofmTOR signaling in response to growth factors and nutrients topromote cell proliferation, cell growth and cell cycleprogression. Regulates protein synthesis through phosphorylationof EIF4B, RPS6 and EEF2K, and contributes to cell survival byrepressing the pro-apoptotic function of BAD. Under conditions ofnutrient depletion, the inactive form associates with the EIF3translation initiation complex. Upon mitogenic stimulation,phosphorylation by the mammalian target of rapamycin complex 1(mTORC1) leads to dissociation from the EIF3 complex andactivation. The active form then phosphorylates and activatesseveral substrates in the pre-initiation complex, including theEIF2B complex and the cap-binding complex component EIF4B. Alsocontrols translation initiation by phosphorylating a negativeregulator of EIF4A, PDCD4, targeting it for ubiquitination andsubsequent proteolysis. Promotes initiation of the pioneer roundof protein synthesis by phosphorylating POLDIP3/SKAR. In responseto IGF1, activates translation elongation by phosphorylating EEF2kinase (EEF2K), which leads to its inhibition and thus activationof EEF2. Also plays a role in feedback regulation of mTORC2 bymTORC1 by phosphorylating RICTOR, resulting in the inhibition ofmTORC2 and AKT1 signaling. Mediates cell survival byphosphorylating the pro-apoptotic protein BAD and suppressing itspro-apoptotic function. Phosphorylates mitochondrial URI1 leadingto dissociation of a URI1-PPP1CC complex. The free mitochondrialPPP1CC can then dephosphorylate RPS6KB1 at Thr-412, which isproposed to be a negative feedback mechanism for the RPS6KB1 anti-apoptotic function. Mediates TNF-alpha-induced insulin resistanceby phosphorylating IRS1 at multiple serine residues, resulting inaccelerated degradation of IRS1. In cells lacking functional TSC1-2 complex, constitutively phosphorylates and inhibits GSK3B. Maybe involved in cytoskeletal rearrangement through binding toneurabin. Phosphorylates and activates the pyrimidine biosynthesisenzyme CAD, downstream of MTOR (PubMed:11500364, PubMed:12801526,PubMed:14673156, PubMed:15071500, PubMed:15341740,PubMed:16286006, PubMed:17052453, PubMed:17053147,PubMed:17936702, PubMed:18952604, PubMed:19085255,PubMed:19720745, PubMed:19935711, PubMed:19995915,PubMed:23429703). Following activation by mTORC1, phosphorylatesEPRS and thereby plays a key role in fatty acid uptake byadipocytes and also most probably in interferon-gamma-inducedtranslation inhibition (PubMed:28178239).{ECO:0000269|PubMed:11500364, ECO:0000269|PubMed:12801526,ECO:0000269|PubMed:14673156, ECO:0000269|PubMed:15071500,ECO:0000269|PubMed:15341740, ECO:0000269|PubMed:16286006,ECO:0000269|PubMed:17052453, ECO:0000269|PubMed:17053147,ECO:0000269|PubMed:17936702, ECO:0000269|PubMed:18952604,ECO:0000269|PubMed:19085255, ECO:0000269|PubMed:19720745,ECO:0000269|PubMed:19935711, ECO:0000269|PubMed:19995915,ECO:0000269|PubMed:23429703, ECO:0000269|PubMed:28178239}. Stress-induced protein that, when overexpressed,promotes formation of intracellular vacuoles followed by celldeath. May be involved in the cytoplasmic vacuolization of acinarcells during the early stage of acute pancreatitis. Plays a rolein the initial stages of the autophagic process through itsinteraction with BECN1 (By similarity). Involved in cell-celladhesion. Plays an essential role in formation of cell junctions.{ECO:0000250, ECO:0000269|PubMed:17724469}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRPS6KB1chr17:57990165chr17:57886157ENST00000225577+31528_32104526MotifNote=TOS motif
HgeneRPS6KB1chr17:57990165chr17:57886157ENST00000225577+31597_105104526Nucleotide bindingATP
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612272_273238407Topological domainCytoplasmic
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612295_305238407Topological domainExtracellular
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612327_363238407Topological domainCytoplasmic
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612385_406238407Topological domainExtracellular
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612251_271238407TransmembraneHelical
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612274_294238407TransmembraneHelical
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612306_326238407TransmembraneHelical
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612364_384238407TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRPS6KB1chr17:57990165chr17:57886157ENST00000225577+315353_423104526DomainNote=AGC-kinase C-terminal
HgeneRPS6KB1chr17:57990165chr17:57886157ENST00000225577+31591_352104526DomainProtein kinase
HgeneRPS6KB1chr17:57990165chr17:57886157ENST00000225577+315424_525104526RegionNote=Autoinhibitory domain
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612131_250238407Topological domainExtracellular
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+6122_43238407Topological domainCytoplasmic
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+61265_77238407Topological domainExtracellular
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+61299_109238407Topological domainCytoplasmic
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+612110_130238407TransmembraneHelical
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+61244_64238407TransmembraneHelical
TgeneVMP1chr17:57990165chr17:57886157ENST00000262291+61278_98238407TransmembraneHelical


Top

FusionGeneSequence for RPS6KB1_VMP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_273aa
MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPEC
FELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSK
HIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSTAKRIQQRLNSEEK

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_220aa
MDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGIT
CGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWM

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_220aa
MDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGIT
CGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWM

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_220aa
MDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGIT
CGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWM

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_220aa
MDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGIT
CGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWM

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_220aa
MDHGGVGPTELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGTGKDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGIT
CGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWM


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_819nt
ATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATA
GACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGA
CCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGT
TTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAA
GTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCT
TTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAG
CACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCT
CAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTC
ATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAA

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_660nt
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_660nt
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_660nt
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_660nt
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_660nt
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_2055nt
CTAAGCAGCCGGTGATGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCC
AGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGA
TGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATT
TGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA
TGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAAT
TCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAA
AGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGC
TGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGG
CACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTC
CATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAA
TTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTT
TTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCAC
CTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGA
TACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTG
TTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTG
CCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACA
GTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTA
TAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCC
TTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAA
CTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCT
CATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCAT
GTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCC

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_1134nt
CTAAGCAGCCGGTGATGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCC
AGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGA
TGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATT
TGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA
TGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAAT
TCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAA
AGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGC
TGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGG
CACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTC
CATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAA
TTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTT
TTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCAC

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_1094nt
CTAAGCAGCCGGTGATGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCC
AGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGA
TGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATT
TGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA
TGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAAT
TCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAA
AGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGC
TGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGG
CACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTC
CATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAA
TTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTT
TTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCAC

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_966nt
CTAAGCAGCCGGTGATGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCC
AGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGA
TGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATT
TGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA
TGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAAT
TCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAA
AGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGC
TGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGG
CACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTC
CATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAA

>In-frame_RPS6KB1_ENST00000443572_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_1126nt
CTAAGCAGCCGGTGATGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCC
AGCCCCGGACTTCCGAGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGA
TGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATT
TGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTA
TGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAAT
TCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAA
AGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGC
TGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGG
CACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTC
CATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAA
TTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTT
TTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCAC

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_2040nt
TGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCG
AGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAAC
TAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGC
CTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATT
TGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAAT
GCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGG
TCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGA
AAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTA
TGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGT
TCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAG
TTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAG
GGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATT
CCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATC
AAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCT
CCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCT
GGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAA
TCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCT
ACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATA
CTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGG
ATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAA
CAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTG

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_1119nt
TGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCG
AGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAAC
TAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGC
CTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATT
TGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAAT
GCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGG
TCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGA
AAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTA
TGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGT
TCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAG
TTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAG

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_1079nt
TGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCG
AGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAAC
TAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGC
CTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATT
TGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAAT
GCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGG
TCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGA
AAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTA
TGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGT
TCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAG

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_951nt
TGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCG
AGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAAC
TAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGC
CTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATT
TGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAAT
GCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGG
TCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGA
AAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTA
TGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGT

>In-frame_RPS6KB1_ENST00000406116_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_1111nt
TGGCGGCAGCGGCTGTGGTGGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCG
AGACAGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGG
GGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAAC
TAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGC
CTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATT
TGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAAT
GCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGG
TCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGA
AAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTA
TGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGT
TCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAG
TTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAG

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_2021nt
GGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGAC
ATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGC
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG
CAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTACTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGT
TCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCTTGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATC
TAGATTGGATAACAGTCTTGCATGTTTATCATGTTACAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGC
CATTTTATGATGCATTGCACACCCTCTGGGGAAATTGATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTG
AGCTGACACCATTTTTTATTCTGTGTATTTAGAATGAAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCC
GTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTTATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAG
CTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGGCATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTG
GGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAAACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTA
CCCATTTCTAAAAAAAAACCACACTCTGTCGTATCTGTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGT
TAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTATTCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTG

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_1100nt
GGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGAC
ATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGC
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_1060nt
GGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGAC
ATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGC
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_932nt
GGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGAC
ATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGC
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG

>In-frame_RPS6KB1_ENST00000225577_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_1092nt
GGCTGCGGCGGGTCCGGGCCCATGAGGCGACGAAGGAGGCGGGACGGCTTTTACCCAGCCCCGGACTTCCGAGACAGGGAAGCTGAGGAC
ATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGGTCAGTTAAATGAAAGC
ATGGACCATGGGGGAGTTGGACCATATGAACTTGGCATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCA
GAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGGGTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCA
GTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGAATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACG
TGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTTGGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTT
GTTATAATAACATTCAGCAAGCACATAGTGGAGCAAATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCA
TTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTTCACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATG
TTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTCATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAG
CGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAGAAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGG
ACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACCTGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCAC
TGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTATCCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000262291_chr17_57886157_+_2075nt
AGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGAA
GCGCTCAGCTGTTAGAAGTGACAGCTGAAAACTTCTGTCGGGAGTAGCACTGCCGCTGCTGTTACAGCCACCAGGAGTTTTATTTCGGGA
GCAAGGGGGCTCTGCTGCATCTTCCAATCTTCCAGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGC
ATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGG
GTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT
CCACCCTCGATGCAATCCACCTTGTGTTTTCTTAGGGTGGAATGTGATGTTCAGCAGCAAACTTGCAACAGACTGGCCTTCTGTTTGTTA
CTTTCAAAAGGCCCACATGATACAATTAGAGAATTCCCACCGCACAAAAAAAGTTCCTAAGTATGTTAAATATGTCAAGCTTTTTAGGCT
TGTCACAAATGATTGCTTTGTTTTCCTAAGTCATCAAAATGTATATAAATTATCTAGATTGGATAACAGTCTTGCATGTTTATCATGTTA
CAATTTAATATTCCATCCTGCCCAACCCTTCCTCTCCCATCCTCAAAAAAGGGCCATTTTATGATGCATTGCACACCCTCTGGGGAAATT
GATCTTTAAATTTTGAGACAGTATAAGGAAAATCTGGTTGGTGTCTTACAAGTGAGCTGACACCATTTTTTATTCTGTGTATTTAGAATG
AAGTCTTGAAAAAAACTTTATAAAGACATCTTTAATCATTCCAAAATTGTGTCCGTTTTCTTGAGCGTTTTGATTTTTTACTTTTAGCTT
ATACCAGCTGAATGGCAGCCTTGCCTAATCCACCTACAACAAGAATTTCTTAAGCTTTCTTTTATTTGCATGAGAGAGCCACTACCAAGG
CATGTTTTGTTATGCTGAAACTGGGCTGCTGCATACTGCTAAATGGCACCTCTGGGATTGGCCTACCTGGGGATTTCTTGGTTTGTGAAA
ACAGGAGAGGAGAAATATCTCATACAAGTGAAAGGATACTGGAGAGAGAAATTACCCATTTCTAAAAAAAAACCACACTCTGTCGTATCT
GTGTTAATGTTTTCTAGCATGTACTCTGGTTTCAACAGACACAAATTTATATGTTAACCCAGTTTTCTTGCCGTTCTGTAAGTGTTTTAT
TCTTAGTGTGATTTTTTTCCATTGGGATGTTTTTGATTGAACTTGTTCATTTTGTTTTGCTTGGGAGGAAAATAAACAATTTTACTTTTT

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000537567_chr17_57886157_+_1154nt
AGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGAA
GCGCTCAGCTGTTAGAAGTGACAGCTGAAAACTTCTGTCGGGAGTAGCACTGCCGCTGCTGTTACAGCCACCAGGAGTTTTATTTCGGGA
GCAAGGGGGCTCTGCTGCATCTTCCAATCTTCCAGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGC
ATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGG
GTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000539763_chr17_57886157_+_1114nt
AGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGAA
GCGCTCAGCTGTTAGAAGTGACAGCTGAAAACTTCTGTCGGGAGTAGCACTGCCGCTGCTGTTACAGCCACCAGGAGTTTTATTTCGGGA
GCAAGGGGGCTCTGCTGCATCTTCCAATCTTCCAGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGC
ATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGG
GTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000536180_chr17_57886157_+_986nt
AGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGAA
GCGCTCAGCTGTTAGAAGTGACAGCTGAAAACTTCTGTCGGGAGTAGCACTGCCGCTGCTGTTACAGCCACCAGGAGTTTTATTTCGGGA
GCAAGGGGGCTCTGCTGCATCTTCCAATCTTCCAGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGC
ATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGG
GTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG

>In-frame_RPS6KB1_ENST00000393021_chr17_57990165_+_VMP1_ENST00000545362_chr17_57886157_+_1146nt
AGGGAAGCTGAGGACATGGCAGGAGTGTTTGACATAGACCTGGACCAGCCAGAGGACGCGGGCTCTGAGGATGAGCTGGAGGAGGGGGAA
GCGCTCAGCTGTTAGAAGTGACAGCTGAAAACTTCTGTCGGGAGTAGCACTGCCGCTGCTGTTACAGCCACCAGGAGTTTTATTTCGGGA
GCAAGGGGGCTCTGCTGCATCTTCCAATCTTCCAGGGGTCAGTTAAATGAAAGCATGGACCATGGGGGAGTTGGACCATATGAACTTGGC
ATGGAACATTGTGAGAAATTTGAAATCTCAGAAACTAGTGTGAACAGAGGGCCAGAAAAAATCAGACCAGAATGTTTTGAGCTACTTCGG
GTACTTGGTAAAGGGGGCTATGGAAAGGACTTTGCCTCCCGGGCCAAACTGGCAGTTCAAAAACTAGTACAGAAAGTTGGATTTTTTGGA
ATTTTGGCCTGTGCTTCAATTCCAAATCCTTTATTTGATCTGGCTGGAATAACGTGTGGACACTTTCTGGTACCTTTTTGGACCTTCTTT
GGTGCAACCCTAATTGGAAAAGCAATAATAAAAATGCATATCCAGAAAATTTTTGTTATAATAACATTCAGCAAGCACATAGTGGAGCAA
ATGGTGGCTTTCATTGGTGCTGTCCCCGGCATAGGTCCATCTCTGCAGAAGCCATTTCAGGAGTACCTGGAGGCTCAACGGCAGAAGCTT
CACCACAAAAGCGAAATGGGCACACCACAGGGAGAAAACTGGTTGTCCTGGATGTTTGAAAAGTTGGTCGTTGTCATGGTGTGTTACTTC
ATCCTATCTATCATTAACTCCATGGCACAAAGTTATGCCAAACGAATCCAGCAGCGGTTGAACTCAGAGGAGAAAACTAAATAAGTAGAG
AAAGTTTTAAACTGCAGAAATTGGAGTGGATGGGTTCTGCCTTAAATTGGGAGGACTCCAAGCCGGGAAGGAAAATTCCCTTTTCCAACC
TGTATCAATTTTTACAACTTTTTTCCTGAAAGCAGTTTAGTCCATACTTTGCACTGACATACTTTTTCCTTCTGTGCTAAGGTAAGGTAT


Top

FusionGenePPI for RPS6KB1_VMP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RPS6KB1TRAF4, AKT1, CSNK2B, MTOR, GDI2P1, PPP2R2A, ACTA1, BTK, CSNK2A1, LYN, PDK1, PRKCZ, SRC, SYK, EIF3B, EIF3C, RPTOR, COASY, POLDIP3, RICTOR, TERT, XPO1, EIF3F, EEF2K, RBX1, MDM2, EP300, KAT2B, NEDD4, DPPA4, CLEC3B, MXD1, ELAVL1, NFATC1, EIF3H, SQSTM1, MAPKAP1, RPS6, PLD2, IRS1, APP, MAPT, HSP90AA1, URI1, STAT1, KIR3DL1, MAPK8, TRIB2, HTT, NCBP1, EIF4E, RHEB, NR1I2, RPS6KB1, PPP5C, STK11, DEPTOR, PIP4K2A, KIT, RRM2, VHL, ABL1, UBL4A, TRIM25VMP1HGS, ELAVL1, TJP1, KLK11, LPAR6, ERGIC3, FAF2, KRAS, TCTN2, TCTN3, TMEM216, DPEP1, CDH13, MAS1, LMNA


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RPS6KB1_VMP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RPS6KB1_VMP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRPS6KB1C0020538Hypertensive disease1CTD_human
HgeneRPS6KB1C0079744Diffuse Large B-Cell Lymphoma1CTD_human
HgeneRPS6KB1C0149721Left Ventricular Hypertrophy1CTD_human
HgeneRPS6KB1C0333641Atrophic1CTD_human
HgeneRPS6KB1C2931673Ceroid lipofuscinosis, neuronal 1, infantile1CTD_human