FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31571

FusionGeneSummary for RNF2_PTPRR

check button Fusion gene summary
Fusion gene informationFusion gene name: RNF2_PTPRR
Fusion gene ID: 31571
HgeneTgene
Gene symbol

RNF2

PTPRR

Gene ID

6045

5801

Gene namering finger protein 2protein tyrosine phosphatase, receptor type R
SynonymsBAP-1|BAP1|DING|HIPI3|RING1B|RING2EC-PTP|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Cytomap

1q25.3

12q15

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase RING2HIP2-interacting protein 3RING finger protein 1BRING finger protein BAP-1RING-type E3 ubiquitin transferase RING2huntingtin-interacting protein 2-interacting protein 3protein DinGreceptor-type tyrosine-protein phosphatase RCh-1 PTPaseNC-PTPCOM1R-PTP-Rch-1PTPaseprotein tyrosine phosphatase Cr1PTPaseprotein-tyrosine phosphatase NC-PTPCOM1protein-tyrosine phosphatase PCPTP1
Modification date2018051920180519
UniProtAcc

Q99496

Q15256

Ensembl transtripts involved in fusion geneENST00000367510, ENST00000367509, 
ENST00000283228, ENST00000440835, 
ENST00000537619, ENST00000378778, 
ENST00000342084, ENST00000549308, 
Fusion gene scores* DoF score4 X 4 X 3=4833 X 13 X 10=4290
# samples 331
** MAII scorelog2(3/48*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(31/4290*10)=-3.79063752711267
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RNF2 [Title/Abstract] AND PTPRR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRNF2

GO:0035518

histone H2A monoubiquitination

16943429


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-DX-A48N-01ARNF2chr1

185069094

+PTPRRchr12

71056385

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000367510ENST00000283228RNF2chr1

185069094

+PTPRRchr12

71056385

-
In-frameENST00000367510ENST00000440835RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367510ENST00000537619RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367510ENST00000378778RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367510ENST00000342084RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367510ENST00000549308RNF2chr1

185069094

+PTPRRchr12

71056385

-
In-frameENST00000367509ENST00000283228RNF2chr1

185069094

+PTPRRchr12

71056385

-
In-frameENST00000367509ENST00000440835RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367509ENST00000537619RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367509ENST00000378778RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367509ENST00000342084RNF2chr1

185069094

+PTPRRchr12

71056385

-
5CDS-5UTRENST00000367509ENST00000549308RNF2chr1

185069094

+PTPRRchr12

71056385

-

Top

FusionProtFeatures for RNF2_PTPRR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNF2

Q99496

PTPRR

Q15256

E3 ubiquitin-protein ligase that mediatesmonoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub),thereby playing a central role in histone code and gene regulation(PubMed:15386022, PubMed:16359901, PubMed:25519132,PubMed:21772249, PubMed:25355358, PubMed:26151332). H2AK119Ubgives a specific tag for epigenetic transcriptional repression andparticipates in X chromosome inactivation of female mammals. Maybe involved in the initiation of both imprinted and random Xinactivation (By similarity). Essential component of a Polycombgroup (PcG) multiprotein PRC1-like complex, a complex classrequired to maintain the transcriptionally repressive state ofmany genes, including Hox genes, throughout development(PubMed:16359901, PubMed:26151332). PcG PRC1 complex acts viachromatin remodeling and modification of histones, renderingchromatin heritably changed in its expressibility(PubMed:26151332). E3 ubiquitin-protein ligase activity isenhanced by BMI1/PCGF4 (PubMed:21772249). Acts as the main E3ubiquitin ligase on histone H2A of the PRC1 complex, while RING1may rather act as a modulator of RNF2/RING2 activity (Probable).Association with the chromosomal DNA is cell-cycle dependent. Inresting B- and T-lymphocytes, interaction with AURKB leads toblock its activity, thereby maintaining transcription in restinglymphocytes (By similarity). {ECO:0000250|UniProtKB:Q9CQJ4,ECO:0000269|PubMed:11513855, ECO:0000269|PubMed:15386022,ECO:0000269|PubMed:16359901, ECO:0000269|PubMed:16714294,ECO:0000269|PubMed:20696397, ECO:0000269|PubMed:21772249,ECO:0000269|PubMed:25355358, ECO:0000269|PubMed:25519132,ECO:0000269|PubMed:26151332, ECO:0000305}. Sequesters mitogen-activated protein kinases (MAPKs)such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactiveform. The MAPKs bind to a dephosphorylated kinase interactingmotif, phosphorylation of which by the protein kinase A complexreleases the MAPKs for activation and translocation into thenucleus (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF2chr1:185069094chr12:71056385ENST00000367510+6751_91303337Zinc fingerRING-type
TgenePTPRRchr1:185069094chr12:71056385ENST00000342084-813393_647387546DomainTyrosine-protein phosphatase
TgenePTPRRchr1:185069094chr12:71056385ENST00000378778-611393_647293452DomainTyrosine-protein phosphatase
TgenePTPRRchr1:185069094chr12:71056385ENST00000440835-510393_647254413DomainTyrosine-protein phosphatase
TgenePTPRRchr1:185069094chr12:71056385ENST00000549308-611393_647254413DomainTyrosine-protein phosphatase
TgenePTPRRchr1:185069094chr12:71056385ENST00000283228-914588_594499658RegionSubstrate binding
TgenePTPRRchr1:185069094chr12:71056385ENST00000342084-813588_594387546RegionSubstrate binding
TgenePTPRRchr1:185069094chr12:71056385ENST00000378778-611588_594293452RegionSubstrate binding
TgenePTPRRchr1:185069094chr12:71056385ENST00000440835-510588_594254413RegionSubstrate binding
TgenePTPRRchr1:185069094chr12:71056385ENST00000549308-611588_594254413RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePTPRRchr1:185069094chr12:71056385ENST00000283228-914393_647499658DomainTyrosine-protein phosphatase
TgenePTPRRchr1:185069094chr12:71056385ENST00000283228-91422_227499658Topological domainExtracellular
TgenePTPRRchr1:185069094chr12:71056385ENST00000283228-914249_657499658Topological domainCytoplasmic
TgenePTPRRchr1:185069094chr12:71056385ENST00000342084-81322_227387546Topological domainExtracellular
TgenePTPRRchr1:185069094chr12:71056385ENST00000342084-813249_657387546Topological domainCytoplasmic
TgenePTPRRchr1:185069094chr12:71056385ENST00000378778-61122_227293452Topological domainExtracellular
TgenePTPRRchr1:185069094chr12:71056385ENST00000378778-611249_657293452Topological domainCytoplasmic
TgenePTPRRchr1:185069094chr12:71056385ENST00000440835-51022_227254413Topological domainExtracellular
TgenePTPRRchr1:185069094chr12:71056385ENST00000440835-510249_657254413Topological domainCytoplasmic
TgenePTPRRchr1:185069094chr12:71056385ENST00000549308-61122_227254413Topological domainExtracellular
TgenePTPRRchr1:185069094chr12:71056385ENST00000549308-611249_657254413Topological domainCytoplasmic
TgenePTPRRchr1:185069094chr12:71056385ENST00000283228-914228_248499658TransmembraneHelical
TgenePTPRRchr1:185069094chr12:71056385ENST00000342084-813228_248387546TransmembraneHelical
TgenePTPRRchr1:185069094chr12:71056385ENST00000378778-611228_248293452TransmembraneHelical
TgenePTPRRchr1:185069094chr12:71056385ENST00000440835-510228_248254413TransmembraneHelical
TgenePTPRRchr1:185069094chr12:71056385ENST00000549308-611228_248254413TransmembraneHelical


Top

FusionGeneSequence for RNF2_PTPRR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_462aa
MSQAVQTNGTQPLSKTWELSLTELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTC
RKKLVSKRSLRPDPNFDALISKITPSRDETEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKTLAVRLALE
ELRSKGESNQMNLDTASEKQTTITIATASGQFTKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHK
TPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQTEFVHHALCL

>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_462aa
MSQAVQTNGTQPLSKTWELSLTELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTC
RKKLVSKRSLRPDPNFDALISKITPSRDETEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCS
NASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKTLAVRLALE
ELRSKGESNQMNLDTASEKQTTITIATASGQFTKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHK
TPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQTEFVHHALCL

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_390aa
MSQAVQTNGTQPLSKTWELSLTELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGLQRGKKQ
QIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSG
NATVDHLSKTLAVRLALEELRSKGESNQMNLDTASEKQTTITIATASGQFTKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQG
SHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRG

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_390aa
MSQAVQTNGTQPLSKTWELSLTELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGLQRGKKQ
QIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSG
NATVDHLSKTLAVRLALEELRSKGESNQMNLDTASEKQTTITIATASGQFTKCVLYWPEKRGITGKVEVLVISVNECDNYTIRNLVLKQG
SHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_1386nt
ATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTACAACGAACACCTCAGGAG
GCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGTTTGGATATGTTGAAGAAC
ACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGCAACAAAGAATGTCCTACCTGT
CGGAAAAAACTAGTTTCCAAAAGATCACTAAGGCCAGACCCAAACTTTGATGCACTCATCAGCAAAATTTATCCAAGTCGTGATGAGTAT
GAAGCTCATCAAGAGAGAGTATTAGCCAGGATCAACAAGCACAATAATCAGCAAGCACTCAGTCACAGCATTGAGGAAGGACTGAAGATA
CAGGCCATGAACAGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGT
AATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAAC
AATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGAT
GACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAA
GAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGC
CAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG

>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_1386nt
ATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTACAACGAACACCTCAGGAG
GCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGTTTGGATATGTTGAAGAAC
ACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGCAACAAAGAATGTCCTACCTGT
CGGAAAAAACTAGTTTCCAAAAGATCACTAAGGCCAGACCCAAACTTTGATGCACTCATCAGCAAAATTTATCCAAGTCGTGATGAGTAT
GAAGCTCATCAAGAGAGAGTATTAGCCAGGATCAACAAGCACAATAATCAGCAAGCACTCAGTCACAGCATTGAGGAAGGACTGAAGATA
CAGGCCATGAACAGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGT
AATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAAC
AATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGAT
GACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAA
GAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGC
CAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_1170nt
ATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTACAACGAACACCTCAGGAG
GCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGTTTGGATATGTTGAAGAAC
ACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGACTGCAGCGAGGCAAGAAACAA
CAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGTAATGCATCCACACATAGCAATCAGGAAGCAGGCCCT
AGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAACAATGCAGCAATGGCAATTGATCCAGTAATGGATGGT
GCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGATGACAGTGCACAGACGAGATACATAAAGACTTCTGGT
AACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAAGAACTTCGAAGCAAAGGTGAATCAAACCAGATGAAC
CTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGCCAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAG
AGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGA
AGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATG
CTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTT
ATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGT
GGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGA

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_1170nt
ATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTACAACGAACACCTCAGGAG
GCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGTTTGGATATGTTGAAGAAC
ACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGACTGCAGCGAGGCAAGAAACAA
CAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGTAATGCATCCACACATAGCAATCAGGAAGCAGGCCCT
AGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAACAATGCAGCAATGGCAATTGATCCAGTAATGGATGGT
GCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGATGACAGTGCACAGACGAGATACATAAAGACTTCTGGT
AACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAAGAACTTCGAAGCAAAGGTGAATCAAACCAGATGAAC
CTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGCCAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAG
AGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGA
AGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATG
CTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTT
ATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGT
GGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_2776nt
CGGCGCACCCTCCCTCGCGCCGCGGGCCTCCCCGCGCCGTGCACGTCCTCGTCCCGCGCCTCCGCCCCTCGCTCGCTCGCTCCTTCCCGC
CCTCCCCGCAGCGCCGGCCGAGCCGGCTTCCCCTCAGTCTCTCATGAATATTGAGCGGCCCCTGTTGTATTTCCCGAGCTCCATTGCGGA
AGCTGAGGCTCGCCATATTGTGCGGCGGCGCCGGCGTCCGCGGCAGCTGATACCAGAGTCTTGCTCCGGCCGCGGCCAGCGGAGCCCTGG
GCTGGGGCAGGAGCCGCAATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTA
CAACGAACACCTCAGGAGGCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGT
TTGGATATGTTGAAGAACACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGCAAC
AAAGAATGTCCTACCTGTCGGAAAAAACTAGTTTCCAAAAGATCACTAAGGCCAGACCCAAACTTTGATGCACTCATCAGCAAAATTTAT
CCAAGTCGTGATGAGTATGAAGCTCATCAAGAGAGAGTATTAGCCAGGATCAACAAGCACAATAATCAGCAAGCACTCAGTCACAGCATT
GAGGAAGGACTGAAGATACAGGCCATGAACAGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGT
GACAGTTCACACTGCAGTAATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGG
CTAGAGCTTGATAATAACAATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCC
ACACTTATGGAAAAAGATGACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCT
GTGAGGTTAGCTTTAGAAGAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTAT
ATAGCAACAGCCAGTGGCCAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATC
AGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACC
TCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGC
CGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAA
GAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTG
CACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGG
GTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGG
ATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGT
TTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGT
ATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGT
TTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGC
TGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATA
TGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGG
TATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTT
ACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGA
ATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAA
GGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTA

>In-frame_RNF2_ENST00000367510_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_2785nt
CGGCGCACCCTCCCTCGCGCCGCGGGCCTCCCCGCGCCGTGCACGTCCTCGTCCCGCGCCTCCGCCCCTCGCTCGCTCGCTCCTTCCCGC
CCTCCCCGCAGCGCCGGCCGAGCCGGCTTCCCCTCAGTCTCTCATGAATATTGAGCGGCCCCTGTTGTATTTCCCGAGCTCCATTGCGGA
AGCTGAGGCTCGCCATATTGTGCGGCGGCGCCGGCGTCCGCGGCAGCTGATACCAGAGTCTTGCTCCGGCCGCGGCCAGCGGAGCCCTGG
GCTGGGGCAGGAGCCGCAATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAACTCAGTTTATATGAGTTA
CAACGAACACCTCAGGAGGCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAATTAATGTGCCCAATTTGT
TTGGATATGTTGAAGAACACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACAGCCCTTAGAAGTGGCAAC
AAAGAATGTCCTACCTGTCGGAAAAAACTAGTTTCCAAAAGATCACTAAGGCCAGACCCAAACTTTGATGCACTCATCAGCAAAATTTAT
CCAAGTCGTGATGAGTATGAAGCTCATCAAGAGAGAGTATTAGCCAGGATCAACAAGCACAATAATCAGCAAGCACTCAGTCACAGCATT
GAGGAAGGACTGAAGATACAGGCCATGAACAGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGT
GACAGTTCACACTGCAGTAATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGG
CTAGAGCTTGATAATAACAATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCC
ACACTTATGGAAAAAGATGACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCT
GTGAGGTTAGCTTTAGAAGAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTAT
ATAGCAACAGCCAGTGGCCAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATC
AGTGTAAATGAATGTGATAACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACC
TCATGGCCTGATCACAAGACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGC
CGAGGGCCTGTGGTTGTCCACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAA
GAAGGAGTTGTGGATGCACTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTG
CACCATGCTCTGTGCCTGTATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGG
GTGATTAATCAAATTACCCACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGG
ATTGTGGAAGACTGGGCAACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGT
TTTTTGATGATGGAGGTATGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGT
ATGTATGTAATATTCAGTAATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGT
TTGCAAAATCTGTCTTGTGAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGC
TGCTAAAGTTGCAAGTGATTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATA
TGGAAATGTGTCTTGATAATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGG
TATATATGTATTTACTCTCTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTT
ACTTTAAAAGGGAAAAACAAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGA
ATATGCTATCTACCTGGAATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAA
GGACATTTCCATGTATGTCCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTA

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000283228_chr12_71056385_-_2398nt
CCCGAGCTCCATTGCGGAAGCTGAGGCTCGCCATATTGTGCGGCGGCGCCGGCGTCCGCGGCAGCTGATACCAGAGTCTTGCTCCGGCCG
CGGCCAGCGGAGCCCTGGGCTGGGGCAGGAGCCGCAATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAA
CTCAGTTTATATGAGTTACAACGAACACCTCAGGAGGCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAA
TTAATGTGCCCAATTTGTTTGGATATGTTGAAGAACACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACA
GCCCTTAGAAGTGGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGT
AATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAAC
AATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGAT
GACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAA
GAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGC
CAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG
TATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACC
CACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCA
ACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTA
TGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGT
AATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGT
GAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGA
TTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATA
ATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCT
CTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAAC
AAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGA
ATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGT
CCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATAT

>In-frame_RNF2_ENST00000367509_chr1_185069094_+_PTPRR_ENST00000440835_chr12_71056385_-_2407nt
CCCGAGCTCCATTGCGGAAGCTGAGGCTCGCCATATTGTGCGGCGGCGCCGGCGTCCGCGGCAGCTGATACCAGAGTCTTGCTCCGGCCG
CGGCCAGCGGAGCCCTGGGCTGGGGCAGGAGCCGCAATGTCTCAGGCTGTGCAGACAAACGGAACTCAACCATTAAGCAAAACATGGGAA
CTCAGTTTATATGAGTTACAACGAACACCTCAGGAGGCAATAACAGATGGCTTAGAAATTGTGGTTTCACCTCGAAGTCTACACAGTGAA
TTAATGTGCCCAATTTGTTTGGATATGTTGAAGAACACCATGACTACAAAGGAGTGTTTACATCGTTTTTGTGCAGACTGCATCATCACA
GCCCTTAGAAGTGGACTGCAGCGAGGCAAGAAACAACAGATTGAAAATGGTAGTGGAGCAGAAGATAATGGTGACAGTTCACACTGCAGT
AATGCATCCACACATAGCAATCAGGAAGCAGGCCCTAGTAACAAACGGACCAAAACATCTGATGATTCTGGGCTAGAGCTTGATAATAAC
AATGCAGCAATGGCAATTGATCCAGTAATGGATGGTGCTAGTGAAATTGAATTAGTATTCAGGCCTCATCCCACACTTATGGAAAAAGAT
GACAGTGCACAGACGAGATACATAAAGACTTCTGGTAACGCCACTGTTGATCACTTATCCAAGTATCTGGCTGTGAGGTTAGCTTTAGAA
GAACTTCGAAGCAAAGGTGAATCAAACCAGATGAACCTTGATACAGCCAGTGAGAAGCAGTATACCATTTATATAGCAACAGCCAGTGGC
CAGTTCACTAAATGTGTGCTATACTGGCCGGAAAAGAGAGGGATATATGGAAAAGTTGAGGTTCTGGTTATCAGTGTAAATGAATGTGAT
AACTACACCATTCGAAACCTTGTCTTAAAGCAAGGAAGCCACACCCAACATGTGAAGCATTACTGGTACACCTCATGGCCTGATCACAAG
ACTCCAGACAGTGCCCAGCCCCTCCTACAGCTCATGCTGGATGTAGAAGAAGACAGACTTGCTTCCCAGGGCCGAGGGCCTGTGGTTGTC
CACTGCAGTGCAGGAATAGGTAGAACAGGGTGTTTTATTGCTACATCCATTGGCTGTCAACAGCTGAAAGAAGAAGGAGTTGTGGATGCA
CTAAGCATTGTCTGCCAGCTTCGTATGGATAGAGGTGGAATGGTGCAAACCAGTGAGCAGTATGAATTTGTGCACCATGCTCTGTGCCTG
TATGAGAGCAGACTTTCAGCAGAGACTGTCCAGTGAGTCATTGAAGACTTGTCAGACCATCAATCTCTTGGGGTGATTAATCAAATTACC
CACCCAAGGCTTCTAGAAGGAGCTTCCTGCAATGGAAGGAAGGAGAAGCTCTGAAGCCCATGTATGGCATGGATTGTGGAAGACTGGGCA
ACATATTTAAGATTTCCAGCTCCTTGTGTATATGAATGCATTTGTAAGCATCCCCCAAATTATTCTGAAGGTTTTTTGATGATGGAGGTA
TGATAGGTTTATCACACAGCCTAAGGCAGATTTTGTTTTGTCTGTACTGACTCTATCTGCCACACAGAATGTATGTATGTAATATTCAGT
AATAAATGTCATCAGGTGATGACTGGATGAGCTGCTGAAGACATTCGTATTATGTGTTAGATGCTTTAATGTTTGCAAAATCTGTCTTGT
GAATGGACTGTCAGCTGTTAAACTGTTCCTGTTTTGAAGTGCTATTACCTTTCTCAGTTACCAGAATCTTGCTGCTAAAGTTGCAAGTGA
TTGATAATGGATTTTTAACAGAGAAGTCTTTGTTTTTGAAAAACAAAAATCAAAAACAGTAACTATTTTATATGGAAATGTGTCTTGATA
ATATTACCTATTAAATGTGTATTTATAGTCCCTCCTATCAAACAATTACAGAGCACAATGATTGTCATTGGGTATATATGTATTTACTCT
CTATTATTGGGCATAAAGGTGGCTTCTGCTCCAGAACTCTATCCACTGTATTTCCACATCGTGAGTCATTTTACTTTAAAAGGGAAAAAC
AAATTTGTAGCAACTCTGAAGTATCAAGAGTTTTAACTACTTGTCTCTCTTTTGCTAAGAAGGGATTTTTGAATATGCTATCTACCTGGA
ATCTCTCTCTCAACAAAAGGTATATGCCTTCAGGAATGATATAATCTGTCCCATTTTCGAGGCTCCTTATAAGGACATTTCCATGTATGT
CCTTACATTTCTGAAAGCTTTCAATCTTCAAGAGACAAAAAAAATTAAAATAACTACCCTCAGCAAACACTAGCTGTTCTGCTCATATAT


Top

FusionGenePPI for RNF2_PTPRR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNF2CBX4, UBE2K, UBE2D2, UBE2D1, TFCP2, BMI1, RING1, KDM5C, REST, PCGF2, MBD1, SSX2, BCOR, PCGF1, RYBP, UBE2J1, UBE2U, UBE2D3, UBE2D4, UBE2E1, UBE2E3, UBE2E2, UBE2H, UBE2V1, UBE2V2, UBE2W, CBX7, PSMC4, KMT2A, KAT8, POU5F1, HIST2H2AC, CENPA, PHB, CASP3, CASP9, UBE3A, RNF2, USP7, USP11, TERF1, MLLT3, DNAJC2, HIST2H2AA3, L3MBTL2, HIST3H3, HIST4H4, PCGF6, ZFP42, YY2, PCGF3, PCGF5, YAF2, PHC1, PHC2, PHC3, CBX2, CBX6, CBX8, SCMH1, SCML1, SCML2, CBX3, E2F6, TFDP1, WDR5, MGA, HDAC1, SKP1, BCORL1, KDM2B, AUTS2, FBRS, FBRSL1, CSNK2A1, CSNK2A2, CSNK2B, CLAM, H2AFX, PPARGC1A, PGP, CDKN2A, MAPKAPK3, UBC, SIAH1, PHB2, UBE2L3, TP53, NOTCH1, MDM2, OTUD6A, VCP, YY1, PEG10, USP19, HECW2, RRM1, TARDBP, SNAI1, AMBRA1, WASH1, PIK3C3, BECN1, ATG14, HIST1H2AB, SUZ12, EED, NCL, NUMA1, HNRNPU, ACTG1, DYNC1H1, TRIM28, LIMA1, RPL4, RPL6, SON, DDX5, SYNCRIP, RPS3A, HNRNPC, RPS2, HNRNPL, ATP2A2, TPM3, CHD4, RPL10, HNRNPA1, NOP58, HNRNPR, DHX9, RPS8, RPL7, AIFM1, GCN1L1, HNRNPUL1, MYBBP1A, AR, RPL7A, ACACA, ILF3, TUBB4B, RPS11, HSPA1B, HNRNPUL2, RPL17, SNRNP200, SUPT16H, RPS24, RPL18A, RPL10A, PDE4DIP, ATP5B, YBX1, TRIM25, RPL13A, RPL28, SF3B1, SF3B2, RPS15A, PDLIM5, THRAP3, RPL14, SEC16A, CSRP1, H1F0, LUC7L2, TUFM, RPL9, DDX18, CLTCL1, SMC1A, DDX39B, RPL27A, HP1BP3, CHTOP, ATAD3A, HNRNPA0, GNB2L1, ALYREF, RANBP2, RPL21, RPL3, RPL31, RPS13, RPL26, DDX3X, COPA, ADNP, RBM39, RBMX, NOP2, MRTO4, FBL, RPL34, DKC1, CALM1, TAF15, LMNB2, SMARCA4, ZC3HAV1, RPL24, RPL32, RPL15, RPL27, LAS1L, RBM14, U2AF1, PRPF8, EIF3A, YBX3, HIST3H2A, TFRC, PABPC4, LAD1, SLC25A11, SRSF1, SLC25A10, GTPBP4, ADAR, DHX30, RPL36, RPS26, KIAA1462, THOC2, POLR2B, SMARCA5, EPRS, EEF2, WDR43, TBL1XR1, PTBP1, FUBP3, DDX56, RPL29, MCM7, SSB, SF3B3, ZFR, ZC3H4, BMS1, SMC3, MYEF2, RPL19, DCAF7, SNRPD2, DDX52, EWSR1, PDCD11, XRCC5, RPS6KA4, ZFP91, HNRNPDL, RSL1D1, AKAP9, RBM47, RPN1, PGAM5, BCLAF1, EEF1D, PES1, SAMHD1, FYTTD1, BAZ1B, FLNB, REPIN1, HDAC2, RAD21, SSRP1, KRR1, EIF3B, AKAP8, AKAP8L, SFXN1, RRP1, H2AFY, RPL23A, PYCR1, RBM8A, RPLP1, SPRR1A, SPECC1, POGZ, PDS5B, IQGAP1, CALR, RRP1B, COPG1, UPF1, CCT3, TEX10, SNRNP70, NUP93, VGF, HNRNPA3, EIF2S3, RUVBL2, RAN, ERH, RPS10, RPS17, HIST3H2BB, CBX1, EIF2S1, ZNF326, SYNE1, GTF2I, DDX27, BOP1, PHGDH, TIMM50, EPHX1, KHDRBS1, AFG3L2, HEATR1, G3BP1, RBM28, WDR46, TTN, RRP12, LRPPRC, NUP205, SART3, RBM5, CPT1A, LARP1, MCCC1, C17orf85, UTP6, CANX, SMARCD2, DDX50, ABCE1, FAM60A, STRBP, UTP15, EIF3D, HSD17B12, RPS7, HIST2H2AB, THEM6, ELAVL1, MRPL11, GTF3C1, PWP2, GATAD2B, NAT10, COPB1, NOL6, NDUFS1, RCC1, NOL9, NOL11, SNRPN, DNAJA2, LDHB, G3BP2, ZNF512, POLR2H, SLC25A22, SPRR2A, EIF4A3, C7orf50, ATP5C1, CDK1, EIF3I, RBBP4, AQR, TIAM2, ATP5J2-PTCD1, UBTF, SMARCC1, LMO7, TRIM24, ABCF1, CEBPZ, WDR12, WIZ, ATP5F1, TRIM26, KIAA0020, CIRH1A, SRSF9, U2AF2, RRP7A, TRAF2, RUVBL1, LYAR, THOC6, ATP5I, EMD, MYL6B, NHP2, MRPS26, RPS19, ADAMTS6, ANK3, CNBP, CHCHD3, POLR1A, HNRNPH3, KLK2, NFXL1, NUDT16L1, SRSF3, RELA, PELP1, ZNF638, UACA, PLAA, FAM208A, EIF2S2, RFC4, CAPRIN1, LARP7, DDX31, CTPS2, TECR, PWP1, YTHDF1, RANGAP1, EIF3L, KHSRP, H1FX, RNF222, YTHDF2, ATL3, TDRKH, KIAA1244, IGLL5, RPF2, MSI2, SUGP2, PNO1, PPP6C, OCIAD2, RALY, IK, PFKL, ARPC4, ARCN1, LPP, MTA1, PARP12, OTUB1, MCM5, SMCHD1, POLD1, ZMYM3, HYOU1, EFTUD2, ATP2C1, TRIM56, SMC4, CCT5, FTSJ3, FIP1L1, SART1, DPF2, NUP88, EHMT2, GLUD2, PLG, MOV10, ZNF614, DDX51, C15orf52, MTA2, POLDIP3, UTP18, EIF3F, VIM, APP, ARAF, FXR2, SEC11A, ATP5O, POLR2E, PHF5A, RCN1, SFXN2, HNRNPAB, MAGOH, MAGED2, SNRPD1, ITM2A, APOOL, RPL38, TUBB2A, CIRBP, XPO1, XPOT, GPATCH4, HOXB13, NHP2L1, SEC22B, RICTOR, WDR36, NOP14, NUP133, SMARCC2, NCAPH, CDH1, ESRP1, DYNC1I2, MAGT1, KAT7, UHRF1, NOLC1, SUPT5H, TBL2, ACIN1, CENPB, COPB2, CD3EAP, NCBP1, NOC2L, MPHOSPH10, CLPX, SNW1, LAP3, XAB2, NAPA, POLR1E, SEC13, SNRPB2, BYSL, C1QBP, NOB1, CLINT1, RPL22, PRPF19, ARL1, MAD2L1, NSA2, VDAC3, SRSF10, MRPS22, NIFK, TRIM14, CISD1, PURB, KCTD10, RPL7L1, COMT, RPS4Y1, NDUFA4, RPS12, TUBA1B, CHD3, QARS, GNAI2, IPO7, PHIP, PPAN-P2RY11, DHX33, PDXDC1, ZBTB7B, ABCB6, EEA1, ZCCHC8, DDX24, ESF1, EFR3A, SARM1, ADD3, MARS, RARS, PPP6R3, FAM120A, SRP72, ZNF687, MTHFD1, CSE1L, ZFY, GNL3, THOC1, PPP1R9B, NOM1, TRIM41, PBXIP1, AARS2, P4HB, PKP2, PTCD3, ACOT8, LRCH1, ABCF3, CALCOCO2, ABCD3, ADAM9, SMARCE1, GLE1, FKBP11, COLGALT1, SRP68, CUL5, DNAJC21, LDHA, MFAP1, SF3A3, SESN3, NDUFA10, NSF, GLYR1, RRP8, RNF114, CLN6, SLC27A3, ZC3H15, ZC3HAV1L, IMP3, ZNF346, SMN1, SAP18, SNRPD3, CSRP2, TPI1, TRA2A, RPS19BP1, MRPS7, GAR1, MRPS17, AGK, CDK13, RAD50, CBLL1, EIF6, GTF3C4, HIST1H1E, IPO4, IQSEC1, LUC7L3, BCAS2, RER1, RDX, RNPS1, ZC3H14, TDRD1, OGFR, GLG1, SENP3, DMAP1, KDM1A, PSMC2, TOP1, SF3B4, ZNF787, CRNKL1, TARS, KIF20A, MMS19, TMX3, RPA1, PTDSS1, FAF2, THOC5, ZNF740, LRRFIP1, RCHY1, NUDT21, POLR2G, DAZAP1, NGDN, PDHB, MTDH, TUBAL3, TMED10, MRPL48, NOL7, RHOT2, USMG5, HIST1H1C, HIST1H1D, H3F3A, SF3A1, CXXC1, ZFP64, NOC3L, PSMD12, TIMMDC1, QPCTL, ATP2B1, MTCH2, PSMA6, RPSA, BRI3BP, NUBPL, RCL1, LCLAT1, SNRPA, NDUFA9, MRPS21, NME3, RAB10, RPS15, PSMC3, MIER2, MLLT1, TRIM27, RPLP0, TOP2A, WDR6, AKIP1, ACTL8, MAX, FOXJ2, CDC5L, NANOG, KDM6A, SIK1, TSC22D2, ZNF131, UBR5, KIAA0430, HELZ, SOWAHA, PAN2, MTNR1A, ERG, DDB2, PCBP2-OT1, BAALCPTPRRMAPK1, MAPK3, MAPK7, MAPK14, NTRK1, CEP290, EGFR, ERBB2, IGF1R, RET, MST1R, ERBB4, FGFR2, FGFR4, KDR, TEK, INSR, ALDH18A1, DHPS, PNMA2, TRIM11, KIAA0196, TBC1D5, DNAJC13, SNX6, PTPRR, MAPK1IP1L, MAPKAPK3, MAD2L1BP, CBS, MAPK11, CCT8L1P, HSPA4L, LMTK2, AATK, ERBB3, RYK, ROR1, ROR2, PTK7, EPHA2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRNF2chr1:185069094chr12:71056385ENST00000367510+672_179303337HIP2
HgeneRNF2chr1:185069094chr12:71056385ENST00000367510+6793_98303337nucleosomes via an acidic patch on histone H2A and histone H2B


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNF2_PTPRR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RNF2_PTPRR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePTPRRC0041696Unipolar Depression1PSYGENET
TgenePTPRRC1269683Major Depressive Disorder1PSYGENET