FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31521

FusionGeneSummary for RNF213_IL22RA1

check button Fusion gene summary
Fusion gene informationFusion gene name: RNF213_IL22RA1
Fusion gene ID: 31521
HgeneTgene
Gene symbol

RNF213

IL22RA1

Gene ID

57674

58985

Gene namering finger protein 213interleukin 22 receptor subunit alpha 1
SynonymsALO17|C17orf27|KIAA1618|MYMY2|MYSTR|NET57CRF2-9|IL22R|IL22R1
Cytomap

17q25.3

1p36.11

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase RNF213ALK lymphoma oligomerization partner on chromosome 17RING-type E3 ubiquitin transferase RNF213mysterininterleukin-22 receptor subunit alpha-1IL-22 receptor subunit alpha-1IL-22R-alpha-1IL-22RA1cytokine receptor class-II member 9cytokine receptor family 2 member 9interleukin 22 receptor, alpha 1zcytoR11
Modification date2018052720180523
UniProtAcc

Q63HN8

Q8N6P7

Ensembl transtripts involved in fusion geneENST00000508628, ENST00000456466, 
ENST00000582970, ENST00000319921, 
ENST00000336301, ENST00000427003, 
ENST00000270800, 
Fusion gene scores* DoF score22 X 22 X 12=58081 X 1 X 1=1
# samples 301
** MAII scorelog2(30/5808*10)=-4.27500704749987
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(1/1*10)=3.32192809488736
Context

PubMed: RNF213 [Title/Abstract] AND IL22RA1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRNF213

GO:0016567

protein ubiquitination

21799892

HgeneRNF213

GO:0051260

protein homooligomerization

24658080|26126547

HgeneRNF213

GO:0051865

protein autoubiquitination

21799892


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-GV-A3JZ-01ARNF213chr17

78237577

+IL22RA1chr1

24465204

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000508628ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-
In-frameENST00000456466ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-
In-frameENST00000582970ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-
In-frameENST00000319921ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-
intron-3CDSENST00000336301ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-
intron-3CDSENST00000427003ENST00000270800RNF213chr17

78237577

+IL22RA1chr1

24465204

-

Top

FusionProtFeatures for RNF213_IL22RA1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNF213

Q63HN8

IL22RA1

Q8N6P7

Component of the receptor for IL20, IL22 and IL24.Component of IL22 receptor formed by IL22RA1 and IL10RB enablingIL22 signaling via JAK/STAT pathways. IL22 also induces activationof MAPK1/MAPK3 and Akt kinases pathways. Component of one of thereceptor for IL20 and IL24 formed by IL22RA1 and IL20RB alsosignaling through STATs activation. Mediates IL24 antiangiogenicactivity as well as IL24 inhibitory effect on endothelial celltube formation and differentiation. {ECO:0000269|PubMed:11035029,ECO:0000269|PubMed:11564763, ECO:0000269|PubMed:11706020,ECO:0000269|PubMed:12351624, ECO:0000269|PubMed:12941841,ECO:0000269|PubMed:17204547}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneIL22RA1chr17:78237577chr1:24465204ENST00000270800-07141_22114575DomainFibronectin type-III 2
TgeneIL22RA1chr17:78237577chr1:24465204ENST00000270800-0717_12414575DomainFibronectin type-III 1
TgeneIL22RA1chr17:78237577chr1:24465204ENST00000270800-0716_22814575Topological domainExtracellular
TgeneIL22RA1chr17:78237577chr1:24465204ENST00000270800-07250_57414575Topological domainCytoplasmic
TgeneIL22RA1chr17:78237577chr1:24465204ENST00000270800-07229_24914575TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF213chr17:78237577chr1:24465204ENST00000319921+217343_374321064Coiled coilOntology_term=ECO:0000255
HgeneRNF213chr17:78237577chr1:24465204ENST00000508628+269343_374325257Coiled coilOntology_term=ECO:0000255
HgeneRNF213chr17:78237577chr1:24465204ENST00000582970+268343_374325208Coiled coilOntology_term=ECO:0000255
HgeneRNF213chr17:78237577chr1:24465204ENST00000319921+2173997_4036321064Zinc fingerRING-type
HgeneRNF213chr17:78237577chr1:24465204ENST00000508628+2693997_4036325257Zinc fingerRING-type
HgeneRNF213chr17:78237577chr1:24465204ENST00000582970+2683997_4036325208Zinc fingerRING-type


Top

FusionGeneSequence for RNF213_IL22RA1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNF213_ENST00000508628_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_593aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIETKTYGERDWVAKKGCQ
RITRKSCNLTVETGNLTELYTARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHD
LFYHLELQVNRTYQMHLGGKQRETEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYR
TVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPP
PQILSPLSTAPNAAPEVGPPSTAPQVTPEAQFPFYAPQAISKVQPSSTAPQATPDSWPPSTGVCMEGSGKDSPTGTLSSPKHLRPKGQLQ
KEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSP

>In-frame_RNF213_ENST00000456466_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_593aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIETKTYGERDWVAKKGCQ
RITRKSCNLTVETGNLTELYTARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHD
LFYHLELQVNRTYQMHLGGKQRETEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYR
TVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPP
PQILSPLSTAPNAAPEVGPPSTAPQVTPEAQFPFYAPQAISKVQPSSTAPQATPDSWPPSTGVCMEGSGKDSPTGTLSSPKHLRPKGQLQ
KEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSP

>In-frame_RNF213_ENST00000582970_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_593aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIETKTYGERDWVAKKGCQ
RITRKSCNLTVETGNLTELYTARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHD
LFYHLELQVNRTYQMHLGGKQRETEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYR
TVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPP
PQILSPLSTAPNAAPEVGPPSTAPQVTPEAQFPFYAPQAISKVQPSSTAPQATPDSWPPSTGVCMEGSGKDSPTGTLSSPKHLRPKGQLQ
KEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSP

>In-frame_RNF213_ENST00000319921_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_593aa
MECPSCQHVSKEETPKFCSQCGERLPPAAPIAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIETKTYGERDWVAKKGCQ
RITRKSCNLTVETGNLTELYTARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHD
LFYHLELQVNRTYQMHLGGKQRETEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYR
TVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPP
PQILSPLSTAPNAAPEVGPPSTAPQVTPEAQFPFYAPQAISKVQPSSTAPQATPDSWPPSTGVCMEGSGKDSPTGTLSSPKHLRPKGQLQ
KEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNF213_ENST00000508628_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_1779nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGCTCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGAC
AGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCATCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAG
CGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGA
GGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTG
AGATCGATTCAGATGATTGTTCATCCTACCCCCACGCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGAC
CTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACC
CCTGACACAGAGTTCCTTGGCACCATCATGATTTGCGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTG
CCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCTTCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGA
TATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGAACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTC
CTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCC
GCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCT
CCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACGCTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCT
CAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGGTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCC
TATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCCCCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAG
AAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCCTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAA
TCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAACATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTA
AAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCGAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCC
TCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGAC

>In-frame_RNF213_ENST00000456466_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_1779nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGCTCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGAC
AGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCATCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAG
CGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGA
GGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTG
AGATCGATTCAGATGATTGTTCATCCTACCCCCACGCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGAC
CTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACC
CCTGACACAGAGTTCCTTGGCACCATCATGATTTGCGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTG
CCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCTTCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGA
TATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGAACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTC
CTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCC
GCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCT
CCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACGCTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCT
CAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGGTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCC
TATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCCCCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAG
AAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCCTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAA
TCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAACATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTA
AAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCGAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCC
TCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGAC

>In-frame_RNF213_ENST00000582970_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_1779nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGCTCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGAC
AGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCATCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAG
CGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGA
GGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTG
AGATCGATTCAGATGATTGTTCATCCTACCCCCACGCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGAC
CTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACC
CCTGACACAGAGTTCCTTGGCACCATCATGATTTGCGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTG
CCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCTTCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGA
TATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGAACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTC
CTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCC
GCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCT
CCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACGCTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCT
CAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGGTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCC
TATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCCCCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAG
AAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCCTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAA
TCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAACATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTA
AAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCGAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCC
TCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGAC

>In-frame_RNF213_ENST00000319921_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_1779nt
ATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCC
ATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGCTCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGAC
AGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCATCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAG
CGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGA
GGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTG
AGATCGATTCAGATGATTGTTCATCCTACCCCCACGCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGAC
CTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACC
CCTGACACAGAGTTCCTTGGCACCATCATGATTTGCGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTG
CCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCTTCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGA
TATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGAACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTC
CTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCC
GCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCT
CCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACGCTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCT
CAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGGTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCC
TATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCCCCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAG
AAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCCTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAA
TCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAACATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTA
AAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCGAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCC
TCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNF213_ENST00000508628_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_2958nt
GACAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGC
TGCCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGA
GGAAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCT
GCTCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGACAGCGGGCCGGAGGGCACCCCAGACACGGTCTACAG
CATCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAGCGGATCACCCGGAAGTCCTGCAACCTGACGGTGGA
GACGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGAGGCCGGTCAGCCACCAAGATGACTGACAGGTTCAG
CTCTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTGAGATCGATTCAGATGATTGTTCATCCTACCCCCAC
GCCAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGACCTGTTCTACCACTTAGAGCTCCAGGTCAACCGCAC
CTACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACCCCTGACACAGAGTTCCTTGGCACCATCATGATTTG
CGTTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTGCCAGACCGGACATGGACCTACTCCTTCTCCGGAGC
CTTCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGATATGTCACCAAGCCGCCTGCACCTCCCAACTCCCT
GAACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTCCTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAG
TCTGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCCGCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGAT
CACCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCTCCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAA
CGCTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCTCAATTCCCATTCTACGCCCCACAGGCCATCTCTAA
GGTCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCCTATGGGGTATGCATGGAAGGTTCTGGCAAAGACTC
CCCCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAGAAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGG
CCTTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAATCATTGCACCAGCCCCTGGGGATTTGCACAGACAG
AACATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTAAAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGAT
CGAGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCCTCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGA
GTCCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGACCTGGAGCAGCCCACAGAACTGGATTCTCTTTTCAG
AGGCCTGGCCCTGACTGTGCAGTGGGAGTCCTGAGGGGAATGGGAAAGGCTTGGTGCTTCCTCCCTGTCCCTACCCAGTGTCACATCCTT
GGCTGTCAATCCCATGCCTGCCCACGCCACACACTCTGCGATCTGGCCTCAGACGGGTGCCCTTGAGAGAAGCAGAGGGAGTGGCATGCA
GGGCCCCTGCCATGGGTGCGCTCCTCACCGGAGCAAAGCAGCATGATAAGGACTGCAGCGGGGGAGCTCTGGGGAGCAGCTTGTGTAGAC
AAGCGCGTGCTCGCTGAGCCCTGCAAGGCAGAAATGACAGTGCAAGGAGGAAATGCAGGGAAACTCCCGAGGTCCAGAGCCCCACCTCCT
AACACCATGGATTCAAAGTGCTCAGGGAATTTGCCTCTCCTTGCCCCATTCCTGGCCAGTTTCACAATCTAGCTCGACAGAGCATGAGGC
CCCTGCCTCTTCTGTCATTGTTCAAAGGTGGGAAGAGAGCCTGGAAAAGAACCAGGCCTGGAAAAGAACCAGAAGGAGGCTGGGCAGAAC
CAGAACAACCTGCACTTCTGCCAAGGCCAGGGCCAGCAGGACGGCAGGACTCTAGGGAGGGGTGTGGCCTGCAGCTCATTCCCAGCCAGG
GCAACTGCCTGACGTTGCACGATTTCAGCTTCATTCCTCTGATAGAACAAAGCGAAATGCAGGTCCACCAGGGAGGGAGACACACAAGCC
TTTTCTGCAGGCAGGAGTTTCAGACCCTATCCTGAGAATGGGGTTTGAAAGGAAGGTGAGGGCTGTGGCCCCTGGACGGGTACAATAACA
CACTGTACTGATGTCACAACTTTGCAAGCTCTGCCTTGGGTTCAGCCCATCTGGGCTCAAATTCCAGCCTCACCACTCACAAGCTGTGTG
ACTTCAAACAAATGAAATCAGTGCCCAGAACCTCGGTTTCCTCATCTGTAATGTGGGGATCATAACACCTACCTCATGGAGTTGTGGTGA

>In-frame_RNF213_ENST00000456466_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_2956nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGC
TCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGACAGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCA
TCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAGCGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGA
CGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGAGGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCT
CTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTGAGATCGATTCAGATGATTGTTCATCCTACCCCCACGC
CAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGACCTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCT
ACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACCCCTGACACAGAGTTCCTTGGCACCATCATGATTTGCG
TTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTGCCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCT
TCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGATATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGA
ACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTCCTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTC
TGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCCGCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCA
CCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCTCCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACG
CTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCTCAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGG
TCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCCTATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCC
CCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAGAAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCC
TTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAATCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAA
CATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTAAAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCG
AGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCCTCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGT
CCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGACCTGGAGCAGCCCACAGAACTGGATTCTCTTTTCAGAG
GCCTGGCCCTGACTGTGCAGTGGGAGTCCTGAGGGGAATGGGAAAGGCTTGGTGCTTCCTCCCTGTCCCTACCCAGTGTCACATCCTTGG
CTGTCAATCCCATGCCTGCCCACGCCACACACTCTGCGATCTGGCCTCAGACGGGTGCCCTTGAGAGAAGCAGAGGGAGTGGCATGCAGG
GCCCCTGCCATGGGTGCGCTCCTCACCGGAGCAAAGCAGCATGATAAGGACTGCAGCGGGGGAGCTCTGGGGAGCAGCTTGTGTAGACAA
GCGCGTGCTCGCTGAGCCCTGCAAGGCAGAAATGACAGTGCAAGGAGGAAATGCAGGGAAACTCCCGAGGTCCAGAGCCCCACCTCCTAA
CACCATGGATTCAAAGTGCTCAGGGAATTTGCCTCTCCTTGCCCCATTCCTGGCCAGTTTCACAATCTAGCTCGACAGAGCATGAGGCCC
CTGCCTCTTCTGTCATTGTTCAAAGGTGGGAAGAGAGCCTGGAAAAGAACCAGGCCTGGAAAAGAACCAGAAGGAGGCTGGGCAGAACCA
GAACAACCTGCACTTCTGCCAAGGCCAGGGCCAGCAGGACGGCAGGACTCTAGGGAGGGGTGTGGCCTGCAGCTCATTCCCAGCCAGGGC
AACTGCCTGACGTTGCACGATTTCAGCTTCATTCCTCTGATAGAACAAAGCGAAATGCAGGTCCACCAGGGAGGGAGACACACAAGCCTT
TTCTGCAGGCAGGAGTTTCAGACCCTATCCTGAGAATGGGGTTTGAAAGGAAGGTGAGGGCTGTGGCCCCTGGACGGGTACAATAACACA
CTGTACTGATGTCACAACTTTGCAAGCTCTGCCTTGGGTTCAGCCCATCTGGGCTCAAATTCCAGCCTCACCACTCACAAGCTGTGTGAC
TTCAAACAAATGAAATCAGTGCCCAGAACCTCGGTTTCCTCATCTGTAATGTGGGGATCATAACACCTACCTCATGGAGTTGTGGTGAAG

>In-frame_RNF213_ENST00000582970_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_2956nt
CAGCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTG
CCAGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGG
AAACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGC
TCCAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGACAGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCA
TCGAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAGCGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGA
CGGGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGAGGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCT
CTCTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTGAGATCGATTCAGATGATTGTTCATCCTACCCCCACGC
CAATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGACCTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCT
ACCAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACCCCTGACACAGAGTTCCTTGGCACCATCATGATTTGCG
TTCCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTGCCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCT
TCCTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGATATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGA
ACGTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTCCTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTC
TGGCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCCGCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCA
CCTACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCTCCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACG
CTGCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCTCAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGG
TCCAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCCTATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCC
CCACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAGAAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCC
TTTCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAATCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAA
CATCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTAAAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCG
AGGGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCCTCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGT
CCCTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGACCTGGAGCAGCCCACAGAACTGGATTCTCTTTTCAGAG
GCCTGGCCCTGACTGTGCAGTGGGAGTCCTGAGGGGAATGGGAAAGGCTTGGTGCTTCCTCCCTGTCCCTACCCAGTGTCACATCCTTGG
CTGTCAATCCCATGCCTGCCCACGCCACACACTCTGCGATCTGGCCTCAGACGGGTGCCCTTGAGAGAAGCAGAGGGAGTGGCATGCAGG
GCCCCTGCCATGGGTGCGCTCCTCACCGGAGCAAAGCAGCATGATAAGGACTGCAGCGGGGGAGCTCTGGGGAGCAGCTTGTGTAGACAA
GCGCGTGCTCGCTGAGCCCTGCAAGGCAGAAATGACAGTGCAAGGAGGAAATGCAGGGAAACTCCCGAGGTCCAGAGCCCCACCTCCTAA
CACCATGGATTCAAAGTGCTCAGGGAATTTGCCTCTCCTTGCCCCATTCCTGGCCAGTTTCACAATCTAGCTCGACAGAGCATGAGGCCC
CTGCCTCTTCTGTCATTGTTCAAAGGTGGGAAGAGAGCCTGGAAAAGAACCAGGCCTGGAAAAGAACCAGAAGGAGGCTGGGCAGAACCA
GAACAACCTGCACTTCTGCCAAGGCCAGGGCCAGCAGGACGGCAGGACTCTAGGGAGGGGTGTGGCCTGCAGCTCATTCCCAGCCAGGGC
AACTGCCTGACGTTGCACGATTTCAGCTTCATTCCTCTGATAGAACAAAGCGAAATGCAGGTCCACCAGGGAGGGAGACACACAAGCCTT
TTCTGCAGGCAGGAGTTTCAGACCCTATCCTGAGAATGGGGTTTGAAAGGAAGGTGAGGGCTGTGGCCCCTGGACGGGTACAATAACACA
CTGTACTGATGTCACAACTTTGCAAGCTCTGCCTTGGGTTCAGCCCATCTGGGCTCAAATTCCAGCCTCACCACTCACAAGCTGTGTGAC
TTCAAACAAATGAAATCAGTGCCCAGAACCTCGGTTTCCTCATCTGTAATGTGGGGATCATAACACCTACCTCATGGAGTTGTGGTGAAG

>In-frame_RNF213_ENST00000319921_chr17_78237577_+_IL22RA1_ENST00000270800_chr1_24465204_-_2954nt
GCGCGCGGCAGGCGGCGAGCTCGGGGGCCGCAGAAAATGAAACTGAAGCCGTGGTCACGTGACAGGACATGTAGTATATAGCAGGCTGCC
AGCGACTCCTGCTCTTGCTTCTGGATCTGCAGGGCAGTCCCAGCAGGACCCATGGAGTGTCCTTCGTGCCAGCATGTCTCCAAGGAGGAA
ACCCCCAAGTTCTGCAGCCAGTGCGGAGAGAGGCTGCCTCCTGCAGCCCCCATAGCAGCTCACGCCCCTGAGGACCCCTCGGATCTGCTC
CAGCACGTGAAATTCCAGTCCAGCAACTTTGAAAACATCCTGACGTGGGACAGCGGGCCGGAGGGCACCCCAGACACGGTCTACAGCATC
GAGTATAAGACGTACGGAGAGAGGGACTGGGTGGCAAAGAAGGGCTGTCAGCGGATCACCCGGAAGTCCTGCAACCTGACGGTGGAGACG
GGCAACCTCACGGAGCTCTACTATGCCAGGGTCACCGCTGTCAGTGCGGGAGGCCGGTCAGCCACCAAGATGACTGACAGGTTCAGCTCT
CTGCAGCACACTACCCTCAAGCCACCTGATGTGACCTGTATCTCCAAAGTGAGATCGATTCAGATGATTGTTCATCCTACCCCCACGCCA
ATCCGTGCAGGCGATGGCCACCGGCTAACCCTGGAAGACATCTTCCATGACCTGTTCTACCACTTAGAGCTCCAGGTCAACCGCACCTAC
CAAATGCACCTTGGAGGGAAGCAGAGAGAATATGAGTTCTTCGGCCTGACCCCTGACACAGAGTTCCTTGGCACCATCATGATTTGCGTT
CCCACCTGGGCCAAGGAGAGTGCCCCCTACATGTGCCGAGTGAAGACACTGCCAGACCGGACATGGACCTACTCCTTCTCCGGAGCCTTC
CTGTTCTCCATGGGCTTCCTCGTCGCAGTACTCTGCTACCTGAGCTACAGATATGTCACCAAGCCGCCTGCACCTCCCAACTCCCTGAAC
GTCCAGCGAGTCCTGACTTTCCAGCCGCTGCGCTTCATCCAGGAGCACGTCCTGATCCCTGTCTTTGACCTCAGCGGCCCCAGCAGTCTG
GCCCAGCCTGTCCAGTACTCCCAGATCAGGGTGTCTGGACCCAGGGAGCCCGCAGGAGCTCCACAGCGGCATAGCCTGTCCGAGATCACC
TACTTAGGGCAGCCAGACATCTCCATCCTCCAGCCCTCCAACGTGCCACCTCCCCAGATCCTCTCCCCACTGTCCTATGCCCCAAACGCT
GCCCCTGAGGTCGGGCCCCCATCCTATGCACCTCAGGTGACCCCCGAAGCTCAATTCCCATTCTACGCCCCACAGGCCATCTCTAAGGTC
CAGCCTTCCTCCTATGCCCCTCAAGCCACTCCGGACAGCTGGCCTCCCTCCTATGGGGTATGCATGGAAGGTTCTGGCAAAGACTCCCCC
ACTGGGACACTTTCTAGTCCTAAACACCTTAGGCCTAAAGGTCAGCTTCAGAAAGAGCCACCAGCTGGAAGCTGCATGTTAGGTGGCCTT
TCTCTGCAGGAGGTGACCTCCTTGGCTATGGAGGAATCCCAAGAAGCAAAATCATTGCACCAGCCCCTGGGGATTTGCACAGACAGAACA
TCTGACCCAAATGTGCTACACAGTGGGGAGGAAGGGACACCACAGTACCTAAAGGGCCAGCTCCCCCTCCTCTCCTCAGTCCAGATCGAG
GGCCACCCCATGTCCCTCCCTTTGCAACCTCCTTCCCGTCCATGTTCCCCCTCGGACCAAGGTCCAAGTCCCTGGGGCCTGCTGGAGTCC
CTTGTGTGTCCCAAGGATGAAGCCAAGAGCCCAGCCCCTGAGACCTCAGACCTGGAGCAGCCCACAGAACTGGATTCTCTTTTCAGAGGC
CTGGCCCTGACTGTGCAGTGGGAGTCCTGAGGGGAATGGGAAAGGCTTGGTGCTTCCTCCCTGTCCCTACCCAGTGTCACATCCTTGGCT
GTCAATCCCATGCCTGCCCACGCCACACACTCTGCGATCTGGCCTCAGACGGGTGCCCTTGAGAGAAGCAGAGGGAGTGGCATGCAGGGC
CCCTGCCATGGGTGCGCTCCTCACCGGAGCAAAGCAGCATGATAAGGACTGCAGCGGGGGAGCTCTGGGGAGCAGCTTGTGTAGACAAGC
GCGTGCTCGCTGAGCCCTGCAAGGCAGAAATGACAGTGCAAGGAGGAAATGCAGGGAAACTCCCGAGGTCCAGAGCCCCACCTCCTAACA
CCATGGATTCAAAGTGCTCAGGGAATTTGCCTCTCCTTGCCCCATTCCTGGCCAGTTTCACAATCTAGCTCGACAGAGCATGAGGCCCCT
GCCTCTTCTGTCATTGTTCAAAGGTGGGAAGAGAGCCTGGAAAAGAACCAGGCCTGGAAAAGAACCAGAAGGAGGCTGGGCAGAACCAGA
ACAACCTGCACTTCTGCCAAGGCCAGGGCCAGCAGGACGGCAGGACTCTAGGGAGGGGTGTGGCCTGCAGCTCATTCCCAGCCAGGGCAA
CTGCCTGACGTTGCACGATTTCAGCTTCATTCCTCTGATAGAACAAAGCGAAATGCAGGTCCACCAGGGAGGGAGACACACAAGCCTTTT
CTGCAGGCAGGAGTTTCAGACCCTATCCTGAGAATGGGGTTTGAAAGGAAGGTGAGGGCTGTGGCCCCTGGACGGGTACAATAACACACT
GTACTGATGTCACAACTTTGCAAGCTCTGCCTTGGGTTCAGCCCATCTGGGCTCAAATTCCAGCCTCACCACTCACAAGCTGTGTGACTT
CAAACAAATGAAATCAGTGCCCAGAACCTCGGTTTCCTCATCTGTAATGTGGGGATCATAACACCTACCTCATGGAGTTGTGGTGAAGAT


Top

FusionGenePPI for RNF213_IL22RA1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNF213UBC, CBX2, CBX4, CBX6, EGFR, PLAC9, RNF213, TRIM23, GOLGA2, REL, TRIM27, TRIP6, UBXN11, KRT40, CD244, SCN2B, IFI16, PTPN1, MRPL50, RNASEH2B, GAN, MCM2, ATOH1, DLK2, SIGLECL1, SDC2, LAMP3, CYLDIL22RA1IL22, STAT3, FBXW12


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNF213_IL22RA1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RNF213_IL22RA1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRNF213C1846689MOYAMOYA DISEASE 23UNIPROT