FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31401

FusionGeneSummary for RNF121_PPP6R3

check button Fusion gene summary
Fusion gene informationFusion gene name: RNF121_PPP6R3
Fusion gene ID: 31401
HgeneTgene
Gene symbol

RNF121

PPP6R3

Gene ID

55298

55291

Gene namering finger protein 121protein phosphatase 6 regulatory subunit 3
Synonyms-C11orf23|PP6R3|SAP190|SAPL|SAPLa|SAPS3
Cytomap

11q13.4

11q13.2

Type of geneprotein-codingprotein-coding
DescriptionRING finger protein 121serine/threonine-protein phosphatase 6 regulatory subunit 3SAPS domain family, member 3sporulation-induced transcript 4-associated protein SAPL
Modification date2018052320180520
UniProtAcc

Q9H920

Q5H9R7

Ensembl transtripts involved in fusion geneENST00000361756, ENST00000533380, 
ENST00000393713, ENST00000490867, 
ENST00000545854, ENST00000530137, 
ENST00000393799, ENST00000530427, 
ENST00000393800, ENST00000534534, 
ENST00000524845, ENST00000265637, 
ENST00000524904, ENST00000393801, 
ENST00000265636, ENST00000529710, 
ENST00000527403, 
Fusion gene scores* DoF score14 X 4 X 7=39215 X 15 X 6=1350
# samples 1519
** MAII scorelog2(15/392*10)=-1.38589115361933
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(19/1350*10)=-2.82888808360725
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RNF121 [Title/Abstract] AND PPP6R3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgenePPP6R3

GO:0043666

regulation of phosphoprotein phosphatase activity

16716191


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A8-A0A9-01ARNF121chr11

71701763

+PPP6R3chr11

68331771

+
TCGALDLUSCTCGA-85-A511-01ARNF121chr11

71640170

+PPP6R3chr11

68334482

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000361756ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000361756ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-3CDSENST00000533380ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
intron-intronENST00000533380ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
Frame-shitENST00000393713ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000393713ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-3CDSENST00000490867ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
3UTR-intronENST00000490867ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
Frame-shitENST00000545854ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000545854ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
Frame-shitENST00000530137ENST00000393799RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000530427RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000393800RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000534534RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000524845RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000265637RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000524904RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000393801RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000265636RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000529710RNF121chr11

71701763

+PPP6R3chr11

68331771

+
5CDS-intronENST00000530137ENST00000527403RNF121chr11

71701763

+PPP6R3chr11

68331771

+
In-frameENST00000361756ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000361756ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+
Frame-shitENST00000533380ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000533380ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+
Frame-shitENST00000393713ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000393713ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-3CDSENST00000490867ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
3UTR-intronENST00000490867ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-3CDSENST00000545854ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5UTR-intronENST00000545854ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+
Frame-shitENST00000530137ENST00000393799RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000530427RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000393800RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000534534RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000524845RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000265637RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000524904RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000393801RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000265636RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000529710RNF121chr11

71640170

+PPP6R3chr11

68334482

+
5CDS-intronENST00000530137ENST00000527403RNF121chr11

71640170

+PPP6R3chr11

68334482

+

Top

FusionProtFeatures for RNF121_PPP6R3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNF121

Q9H920

PPP6R3

Q5H9R7


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+19100_12021328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+19148_16821328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+19172_19221328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+19306_32621328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+1950_7021328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+1979_9921328TransmembraneHelical
HgeneRNF121chr11:71640170chr11:68334482ENST00000361756+19226_27621328Zinc fingerRING-type%3B atypical


Top

FusionGeneSequence for RNF121_PPP6R3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNF121_ENST00000361756_chr11_71640170_+_PPP6R3_ENST00000393799_chr11_68334482_+_576aa
MAAVVEVEVGGGAAGERELDEKSVMKTTWGVLDPPVGNTRLNVIRLISSLLQTNTSSINGDLMELNSIGVILNMFFKTTWNNFLHTQVEI
CIALILASPFENTENATITDQDSTGDNLLLKHLFQKCQLIERILEAWEMNEKKQAEGGRRHGYMGHLTRIANCIVHSTDKGPNSALVQQL
IKDLPDEVRERWETFCTSSLGETNKRNTVDLVTTCHIHSSSDDEIDFKETGFSQDSSLQQAFSDTQMQQMTSNFIDQFGFNDEKFADQDD
IGNVSFDRVSDINFTLNTNESGNIALFEACCKERIQQFDDGGSDEEDIWEEKHIAFTPESQRRSSSGSTDSEESTDSEEEDGAKQDLFEP
SSANTEDKMEVDLSEPPNWSANFDVPMETTHGAPLDSVGSDVWSTEEPMPTKETGWASFSEFTSSLSTKDSLRSNSPVEMETSTEPMDPL
TPSAAALAVQPEAAGSVAMEASSDGEEDAESTDKVTETVMNGGMKETLSLTVDAKTETAVFKRLLGGCSEEGKLSTSQDAACKDAEECPE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNF121_ENST00000361756_chr11_71640170_+_PPP6R3_ENST00000393799_chr11_68334482_+_1728nt
ATGGCGGCAGTGGTGGAGGTGGAGGTTGGAGGTGGTGCTGCTGGGGAACGGGAGCTGGATGAGAAAAGTGTGATGAAGACCACATGGGGT
GTGCTGGATCCTCCTGTGGGGAATACCCGGTTGAATGTCATTAGGTTGATATCCAGCCTGCTTCAAACCAATACCAGCAGTATAAATGGG
GACCTTATGGAGCTGAATAGCATTGGAGTCATATTGAACATGTTCTTCAAGTATACATGGAATAACTTTTTGCATACACAAGTGGAAATT
TGTATTGCACTGATTCTTGCAAGTCCTTTTGAAAACACAGAAAATGCCACAATTACCGATCAAGACTCCACTGGTGATAATTTGTTATTA
AAACATCTTTTCCAAAAATGTCAATTAATAGAACGAATACTTGAAGCCTGGGAAATGAATGAGAAGAAACAGGCTGAGGGAGGAAGACGG
CATGGTTACATGGGACACCTAACGAGGATAGCTAACTGTATCGTGCACAGCACTGACAAGGGCCCCAACAGTGCATTAGTGCAGCAGCTT
ATCAAAGATCTTCCCGACGAAGTCAGGGAACGATGGGAGACGTTCTGCACAAGCTCCTTAGGAGAAACTAACAAGAGGAACACGGTAGAT
CTAGTTACAACCTGCCATATTCATTCATCCAGTGATGATGAAATTGACTTTAAAGAAACGGGTTTCTCACAGGATTCTTCTTTGCAGCAA
GCCTTTTCTGATTATCAGATGCAACAAATGACGTCCAATTTTATTGACCAGTTTGGCTTCAACGATGAGAAGTTTGCAGATCAAGATGAC
ATTGGCAATGTTTCTTTTGATCGAGTATCAGACATCAACTTTACTCTCAATACAAATGAAAGTGGAAATATTGCCTTGTTTGAAGCATGT
TGTAAGGAAAGAATACAACAGTTTGATGATGGTGGCTCTGATGAGGAAGATATATGGGAGGAAAAGCACATCGCATTCACACCAGAATCC
CAAAGACGATCCAGCTCGGGGAGTACAGACAGTGAGGAAAGTACAGACTCTGAAGAAGAAGATGGAGCAAAGCAAGACTTGTTTGAACCC
AGCAGTGCCAACACGGAGGATAAAATGGAGGTGGACCTGAGTGAACCACCCAACTGGTCAGCTAACTTTGATGTCCCAATGGAAACAACC
CACGGTGCTCCATTGGATTCTGTGGGATCTGATGTCTGGAGCACAGAGGAGCCGATGCCAACTAAAGAGACGGGCTGGGCTTCTTTTTCA
GAGTTCACGTCTTCCCTGAGCACAAAAGATTCTTTAAGGAGTAATTCTCCAGTGGAAATGGAAACCAGCACTGAACCCATGGACCCTCTG
ACTCCCAGTGCGGCTGCCCTGGCAGTGCAGCCAGAAGCGGCAGGCAGTGTGGCCATGGAAGCCAGCTCTGACGGAGAGGAGGATGCAGAA
AGTACAGACAAGGTAACTGAGACAGTGATGAATGGCGGCATGAAGGAAACGCTCAGCCTCACTGTAGATGCCAAGACAGAGACTGCGGTC
TTCAAAAGGTTATTGGGAGGATGCAGTGAGGAAGGGAAACTGTCTACCTCTCAAGATGCTGCTTGTAAAGACGCAGAGGAGTGTCCCGAG
ACTGCAGAGGCGAAGTGCGCGGCGCCCAGGCCTCCCAGCAGCAGTCCCGAGCAGAGGACTGGCCAACCAAGCGCACCAGGTGACACTTCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNF121_ENST00000361756_chr11_71640170_+_PPP6R3_ENST00000393799_chr11_68334482_+_4301nt
ACGTCTCGCTCCTTGGAGCCCAGACTGAGGGAGCGTCGCGAAAGTTGCCCGTTTTGGAACGCTCCCATTTGGCTCTCCAAAGGGAAGAAT
TGGTTAAATAGTTGCACTGAAAATAATGCGATTCAAATTTCTCATTTTCCAAGAACGCTCCCTTGCTGAAGCTTGCAAGGGCACGGTACT
CCCCTCTCCTTGACCCTGAAACGTGCAGCAAGTAGATAACCTCCTGATCCCTGACAGTCTCCGCCTGTGTTGATGCCCCGCCCCCTCTGC
TGGAGTCCGAGCCGCCGATTGGCTAGGAGCACTTGAGCAGCGGAAGCAGCTGGCTCGCGCGGGGACTGCGGTGAGGGGGCGAGCCGTGAA
GATGGCGGCAGTGGTGGAGGTGGAGGTTGGAGGTGGTGCTGCTGGGGAACGGGAGCTGGATGAGAAAAGTGTGATGAAGACCACATGGGG
TGTGCTGGATCCTCCTGTGGGGAATACCCGGTTGAATGTCATTAGGTTGATATCCAGCCTGCTTCAAACCAATACCAGCAGTATAAATGG
GGACCTTATGGAGCTGAATAGCATTGGAGTCATATTGAACATGTTCTTCAAGTATACATGGAATAACTTTTTGCATACACAAGTGGAAAT
TTGTATTGCACTGATTCTTGCAAGTCCTTTTGAAAACACAGAAAATGCCACAATTACCGATCAAGACTCCACTGGTGATAATTTGTTATT
AAAACATCTTTTCCAAAAATGTCAATTAATAGAACGAATACTTGAAGCCTGGGAAATGAATGAGAAGAAACAGGCTGAGGGAGGAAGACG
GCATGGTTACATGGGACACCTAACGAGGATAGCTAACTGTATCGTGCACAGCACTGACAAGGGCCCCAACAGTGCATTAGTGCAGCAGCT
TATCAAAGATCTTCCCGACGAAGTCAGGGAACGATGGGAGACGTTCTGCACAAGCTCCTTAGGAGAAACTAACAAGAGGAACACGGTAGA
TCTAGTTACAACCTGCCATATTCATTCATCCAGTGATGATGAAATTGACTTTAAAGAAACGGGTTTCTCACAGGATTCTTCTTTGCAGCA
AGCCTTTTCTGATTATCAGATGCAACAAATGACGTCCAATTTTATTGACCAGTTTGGCTTCAACGATGAGAAGTTTGCAGATCAAGATGA
CATTGGCAATGTTTCTTTTGATCGAGTATCAGACATCAACTTTACTCTCAATACAAATGAAAGTGGAAATATTGCCTTGTTTGAAGCATG
TTGTAAGGAAAGAATACAACAGTTTGATGATGGTGGCTCTGATGAGGAAGATATATGGGAGGAAAAGCACATCGCATTCACACCAGAATC
CCAAAGACGATCCAGCTCGGGGAGTACAGACAGTGAGGAAAGTACAGACTCTGAAGAAGAAGATGGAGCAAAGCAAGACTTGTTTGAACC
CAGCAGTGCCAACACGGAGGATAAAATGGAGGTGGACCTGAGTGAACCACCCAACTGGTCAGCTAACTTTGATGTCCCAATGGAAACAAC
CCACGGTGCTCCATTGGATTCTGTGGGATCTGATGTCTGGAGCACAGAGGAGCCGATGCCAACTAAAGAGACGGGCTGGGCTTCTTTTTC
AGAGTTCACGTCTTCCCTGAGCACAAAAGATTCTTTAAGGAGTAATTCTCCAGTGGAAATGGAAACCAGCACTGAACCCATGGACCCTCT
GACTCCCAGTGCGGCTGCCCTGGCAGTGCAGCCAGAAGCGGCAGGCAGTGTGGCCATGGAAGCCAGCTCTGACGGAGAGGAGGATGCAGA
AAGTACAGACAAGGTAACTGAGACAGTGATGAATGGCGGCATGAAGGAAACGCTCAGCCTCACTGTAGATGCCAAGACAGAGACTGCGGT
CTTCAAAAGGTTATTGGGAGGATGCAGTGAGGAAGGGAAACTGTCTACCTCTCAAGATGCTGCTTGTAAAGACGCAGAGGAGTGTCCCGA
GACTGCAGAGGCGAAGTGCGCGGCGCCCAGGCCTCCCAGCAGCAGTCCCGAGCAGAGGACTGGCCAACCAAGCGCACCAGGTGACACTTC
AGTGAATGGCCCTGTATGACGGGTGACGTCTGCTGCTGCTGACTGAGGACTGCAGACCGCCACCACTCAGGGGCTCTGGAGGGGTCAGCT
GGAGCCCACCAAGCTGTCACTGCTGCACTCACTCTGCAAGGGATCAGGACCAGCAACCTTTATATTCTAGATTCTAAGACATTGTACAGA
GAAATTCAGAAGTGTAAAAATATTGCACATTGACAAATACCAAGAATTTTTGCGTATGTTTATATTGTATTGTTCTAAATAATGGGTAGC
CTGTGAAATAAGATCTTGCCACCCATGTAATAATAGTAGTAATACTATAGTTAAAATGGCTGTAAGAATAGTTTTATAAAAGTGAATACA
CAGATCTATTGTATTTGAAACATAACTTTGACAATTATTAGTGTGACCAAAGTATTAGGCGGTTTTCATACATTTTTCACCTTGTACAAA
ATTATGAATTCATTTTTCCTCCAGGCCGACAAGGAGTTGTAGAATGAAAATGCCCTCTAAGTGTTATTTTGGTTGTTCTAACTTACAAAA
GTGATTTTGAATAAGAAATATTTGGTGTTCTTTTTATAACCAGTTTTTGATTGGTAATTGTTTTCTGTATTGTTTAAAACGGATCAAAAA
TGTAAGTCTATTGGTAGAGATTAAGTAAAGTATTTATTGCTACATCATAGTTGATAAATTGATGTTATCGTAAAGCCATATGTTCTGTTC
AAGTCTTGTTTGCTTGAAATGATTATTCCTACAAGTGAAACACTAGACTATTTGGAGTGTATATGGCTTGTGTTTTGGGATTTTTTTTTT
TTTTTTTTGGCTTTTGTTTTTGTTTGTTTTTTTGTTTCATTTGGTAGTTCATCTGCCTTTTAACCCATTCACCAAAATTTACCTTGTTAA
CAAGCATCACCAATGAACATTTCAGAGCAATCTGCATATTTAACAGACCTAAAATAAATCCTATTAGGCAAGTCAGTTGAAAATGCTCGT
GCTGCTAATGGAATTAGAGTGCGTTCATTTTACAGGCTAGTATTTTAAAAGTAGAAATCAAAATCTGGCACCGAAGCATGCTAATTGTTT
ACTGTACCTTGTGAGGTTTTCACTCATAAATTTAAACCAGTGTATTTTTTTAGAACTGGTTTGTGTATATATATAGTGATTATGGATACT
AATTCAATGTAATTTATAATTTTCTATGTCAATACAAAAATACATCACAGCCTTCTCAAACAGCTCAAGCAATATATTGTATATTGCCAT
ATCGTCTGGTGAAAGGGTTAAATTACTTCACCTCTTGCACTTTTAGATGCAAATCAGTTTTTCATTTCTGTAATAGAAAATTATTCACGT
ATTTTTACATCATTTGTTTTTCCTGACCAGTATTTAAAACCAAAAGGATATTCTGAAAAATGGCCAACAATTTTTTTAGAAGTAGCATCC
CAAGCAGCGTGCCTAAACATTACATTGCATATGGAAATAAAAGAATCAAACGTCTAATGCCTTATTATTTCTGATTTCCTTTTTCATTTT
AAGTGGTGTGGAGATTCCAGCACTCCCAGGACAGTGGAGTCAGCAGTAAGCCCTGGGACAGGTGGCAAGGGTGGGTCCCTTGACCTTTGC
ACGCCTCCTCAGGAACCCCCTTTCCCGGGTGAGCCCCTCTCTGAAGAGACTGTCCTTGGGCCTCCTCTGGAAGCAGCACCCCCAGAGGAC
AGGGCTCCTCCTGCTTGCCTCAGGGCTGCCTGACTTGAATGGCGTTGGACCTCGGGGATTACTGGTAGATAATATGCTCTGGTCTCGCCT
GGTGGTGAGTTTTGCCAGCCATGGCCAGGGTTTGGCTCCACTGGTGGCACACGTGGCCTCCGTGGTATGGACCTGGTGGCTTCTCCATCC
CACTGTGGCCTCTGTGGTATGGACCTGGTGGCTTCTCCATCCTACCCAAGGTAACAGTGTCTTGCTTCATCCCACTGACTGCTGGGAGAG
AGCCTCTGGGACTTTTCTTTGGGGCATCATTTTGTTTTGTCTTTCGTAGCAGGGAAAGGATATGACAATGGGGAGGACAGTTCTTTTGGA
GGTTGGAGGGGCCAAGCCAAGGACAGGAGCAAGTGTGCCCTCATTTTGTTTCTACTTTTAATTTCTGTGTGTTGGCCATACTGAATTATG


Top

FusionGenePPI for RNF121_PPP6R3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNF121NFKBIA, LPAR1, TRIM25PPP6R3KDM6A, TNFAIP3, USP21, USP36, USP49, PPP6C, PRKDC, HDAC1, HDAC2, ELAVL1, SIRT7, TERF2IP, TINF2, TFAP4, GRK5, PFAS, BRCA1, ECT2, NOTCH1, LATS1, GPSM1, HDAC11, USP10, ANKRD28, MOB1A, MOB1B, ACAD11, ANKRD44, ANKRD52, AP1B1, AP2A1, AP2A2, AURKA, DNAJC11, ECH1, ERLIN2, PPP6R1, PPP6R2, CDC37, ENAH, ETFA, HSP90AA1, HSP90AB1, RUVBL2, SRRT, TPM1, USP7, CSNK1E, SNAI2, RNF2, GPHA2, RPS6KB2, UNK, DIEXF, NSUN5, EIF4A3, TIPRL, NTRK1, CEP44, CEP19, XPO1, ZNRF2, ZNF746, TRMT2A, TRIM25, TES


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNF121_PPP6R3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RNF121_PPP6R3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource