FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31375

FusionGeneSummary for RNF111_SLTM

check button Fusion gene summary
Fusion gene informationFusion gene name: RNF111_SLTM
Fusion gene ID: 31375
HgeneTgene
Gene symbol

RNF111

SLTM

Gene ID

54778

79811

Gene namering finger protein 111SAFB like transcription modulator
SynonymsARK|hRNF111Met
Cytomap

15q22.1-q22.2

15q22.1

Type of geneprotein-codingprotein-coding
DescriptionE3 ubiquitin-protein ligase ArkadiaArkadiaRING-type E3 ubiquitin transferase ArkadiaSAFB-like transcription modulatormodulator of estrogen-induced transcription
Modification date2018052320180523
UniProtAcc

Q6ZNA4

Q9NWH9

Ensembl transtripts involved in fusion geneENST00000348370, ENST00000434298, 
ENST00000559209, ENST00000557998, 
ENST00000561186, ENST00000560080, 
ENST00000380516, ENST00000536328, 
ENST00000557950, 
Fusion gene scores* DoF score7 X 3 X 6=1268 X 9 X 2=144
# samples 79
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/144*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RNF111 [Title/Abstract] AND SLTM [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBLCATCGA-ZF-A9RN-01ARNF111chr15

59359282

+SLTMchr15

59193486

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000348370ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000348370ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000348370ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-
In-frameENST00000434298ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000434298ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000434298ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-
In-frameENST00000559209ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000559209ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000559209ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-
In-frameENST00000557998ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000557998ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000557998ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-
In-frameENST00000561186ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000561186ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
5CDS-5UTRENST00000561186ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-
intron-3CDSENST00000560080ENST00000380516RNF111chr15

59359282

+SLTMchr15

59193486

-
intron-5UTRENST00000560080ENST00000536328RNF111chr15

59359282

+SLTMchr15

59193486

-
intron-5UTRENST00000560080ENST00000557950RNF111chr15

59359282

+SLTMchr15

59193486

-

Top

FusionProtFeatures for RNF111_SLTM


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RNF111

Q6ZNA4

SLTM

Q9NWH9


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614252_464562987Compositional biasNote=Ser-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614494_523562987Compositional biasNote=His-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614252_4645621004Compositional biasNote=Ser-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614494_5235621004Compositional biasNote=His-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614252_464562995Compositional biasNote=Ser-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614494_523562995Compositional biasNote=His-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614252_464562996Compositional biasNote=Ser-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614494_523562996Compositional biasNote=His-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513252_4645621004Compositional biasNote=Ser-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513494_5235621004Compositional biasNote=His-rich
TgeneSLTMchr15:59359282chr15:59193486ENST00000380516-421609_7281871035Coiled coilOntology_term=ECO:0000255
TgeneSLTMchr15:59359282chr15:59193486ENST00000380516-421569_9061871035Compositional biasNote=Arg/Glu-rich
TgeneSLTMchr15:59359282chr15:59193486ENST00000380516-421384_4621871035DomainRRM

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614629_781562987Compositional biasNote=Pro-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614629_7815621004Compositional biasNote=Pro-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614629_781562995Compositional biasNote=Pro-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614629_781562996Compositional biasNote=Pro-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513629_7815621004Compositional biasNote=Pro-rich
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614907_909562987RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614957_961562987RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614907_9095621004RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614957_9615621004RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614907_909562995RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614957_961562995RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614907_909562996RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614957_961562996RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513907_9095621004RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513957_9615621004RegionUbiquitin binding
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614942_983562987Zinc fingerRING-type%3B atypical
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614942_9835621004Zinc fingerRING-type%3B atypical
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614942_983562995Zinc fingerRING-type%3B atypical
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614942_983562996Zinc fingerRING-type%3B atypical
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513942_9835621004Zinc fingerRING-type%3B atypical
TgeneSLTMchr15:59359282chr15:59193486ENST00000380516-421108_2391871035Compositional biasNote=Glu-rich
TgeneSLTMchr15:59359282chr15:59193486ENST00000380516-42122_561871035DomainSAP


Top

FusionGeneSequence for RNF111_SLTM


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RNF111_ENST00000348370_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_1410aa
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLV
VRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSS
TEGEEDLFVSASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSEQASDTASAVTSSQPSTVSETSATLTSNSTT
GTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITL
DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSS
TEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKD
EKNDNGASGQTSESIKKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYRRKEILPFEKMKEQRL
REHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFPESSAVQSSSFERRDR
FVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKS
EGSMSTDKRETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQG

>In-frame_RNF111_ENST00000434298_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_1410aa
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLV
VRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSS
TEGEEDLFVSASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSEQASDTASAVTSSQPSTVSETSATLTSNSTT
GTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITL
DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSS
TEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKD
EKNDNGASGQTSESIKKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYRRKEILPFEKMKEQRL
REHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFPESSAVQSSSFERRDR
FVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKS
EGSMSTDKRETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQG

>In-frame_RNF111_ENST00000559209_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_1410aa
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLV
VRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSS
TEGEEDLFVSASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSEQASDTASAVTSSQPSTVSETSATLTSNSTT
GTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITL
DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSS
TEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKD
EKNDNGASGQTSESIKKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYRRKEILPFEKMKEQRL
REHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFPESSAVQSSSFERRDR
FVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKS
EGSMSTDKRETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQG

>In-frame_RNF111_ENST00000557998_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_1410aa
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLV
VRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSS
TEGEEDLFVSASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSEQASDTASAVTSSQPSTVSETSATLTSNSTT
GTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITL
DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSS
TEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKD
EKNDNGASGQTSESIKKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYRRKEILPFEKMKEQRL
REHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFPESSAVQSSSFERRDR
FVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKS
EGSMSTDKRETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQG

>In-frame_RNF111_ENST00000561186_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_1410aa
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLV
VRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSAR
SHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSS
TEGEEDLFVSASENHQNNPAVPSGSIDEDVVVIEASSTPQVTANEEINVTSTDSEVEIVTVGESYRSRSTLGHSRSHWSQGSSSHASRPQ
EPRNRSRISTVIQPLRQNAAEVVDLTVDEDEPTVVPTTSARMESQATSASINNSNPSTSEQASDTASAVTSSQPSTVSETSATLTSNSTT
GTSIGDDSRRTTSSAVTETGPPAMPRLPSCCPQHSPCGGSSQNHHALGHPHTSCFQQHGHHFQHHHHHHHTPHPAVPVSPSFSDPACPVE
RPPQVQAPCGANSSSGTSYHEQDGEEEENEKDIAGSGDGTQEVSKPLPSEGSLAEADHTAHEEMEAHTTVKEAEDDNISVTIQAEDAITL
DFDGDDLLETGKNVKITDSEASKPKDGQDAIAQSPEKESKDYEMNANHKDGKKEDCVKGDPVEKEARESSKKAESGDKEKDTLKKGPSST
GASGQAKSSSKESKDSKTSSKDDKGSTSSTSGSSGSSTKNIWVSGLSSNTKAADLKNLFGKYGKVLSAKVVTNARSPGAKCYGIVTMSSS
TEVSRCIAHLHRTELHGQLISVEKVKGDPSKKEMKKENDEKSSSRSSGDKKNTSDRSSKTQASVKKEEKRSSEKSEKKESKDTKKIEGKD
EKNDNGASGQTSESIKKSEEKKRISSKSPGHMVILDQTKGDHCRPSRRGRYEKIHGRSKEKERASLDKKRDKDYRRKEILPFEKMKEQRL
REHLVRFERLRRAMELRRRREIAERERRERERIRIIREREERERLQRERERLEIERQKLERERMERERLERERIRIEQERRKEAERIARE
REELRRQQQQLRYEQEKRNSLKRPRDVDHRRDDPYWSENKKLSLDTDARFGHGSDYSRQQNRFNDFDHRERGRFPESSAVQSSSFERRDR
FVGQSEGKKARPTARREDPSFERYPKNFSDSRRNEPPPPRNELRESDRREVRGERDERRTVIIHDRPDITHPRHPREAGPNPSRPTSWKS
EGSMSTDKRETRVERPERSGREVSGHSVRGAPPGNRSSASGYGSREGDRGVITDRGGGSQHYPEERHVVERHGRDTSGPRKEWHGPPSQG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RNF111_ENST00000348370_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_4230nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA

>In-frame_RNF111_ENST00000434298_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_4230nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA

>In-frame_RNF111_ENST00000559209_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_4230nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA

>In-frame_RNF111_ENST00000557998_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_4230nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA

>In-frame_RNF111_ENST00000561186_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_4230nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_RNF111_ENST00000348370_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_5617nt
AGAGCCCTAGTGTCGTGCTCTCCTCGGTAGGGGAGGAATTGGTTAGGCGGCGGCGGCGGCGAAGCGGCGGCGGCGGCTGTAGGGGAGCAG
CGGCAGTGGCGGCGACGGCGAGGAGGTGTTCGGTTTGCGCAGCGTAGAAACGCCCGCAGCTTCAGAGAAGGAGTTCTTGTGGGACCAAAT
TAGGCATTCTGAACCCACGCCGGCTTAGCTGGGCCGAGTCCAGGCGCTGCCGCACGTACAGTTTTGGTGGCGGTGACAGACACTGTTCTT
GACTCTAGGGGCCTATTAGGCCGACGTCTGAGGCGCAGATCGCTGGCTCTCGACGCATTACTCTTTACGCCTTACATTTCTGTCTTCCTT
CCTGGGTCAGTGATTCCCGGACCCTGGAAGAGAAGAGGGTGGCTAATGATTAAGGCTTTCCTTAAAGTTTCCCATGTCTCAATGGACTCC
TGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAGGAGAGTCTGAAAGGGAT
CCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTGGGGAATGAATTCTCTCA
CCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTTGTGAGGAAAAAACGCAA
AAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAACACCTAGGGACACCAAG
TGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCTGATACTGTGACTTCAGA
TGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGGTCTCATAAGTGGCCTCG
GACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTTCCATGCAGAAAGAGATT
TGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAAGTGTTAGCTCGAAGAAA
ATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCAACTGAAGGAGAAGAAGA
TTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTTGTGGTGATAGAAGCTTC
CTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACAGTTGGAGAAAGCTATCG
GTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAGGAGCCACGGAACCGCAG
TAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGATGAACCTACTGTAGTACC
AACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAGCAGGCCTCTGATACTGC
TTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACTGGCACTTCTATAGGAGA
TGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGCTGTCCCCAGCACTCACC
ATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCACCATTTTCAACATCATCA
CCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAAAGACCTCCACAAGTACA
AGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAGAAAGATATAGCAGGTTC
TGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCTCATGAAGAGATGGAAGC
TCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTGGATTTTGATGGTGATGA
CCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCCATTGCACAGAGCCCGGA
GAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGACCCTGTCGAGAAGGAAGC
CAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACTGGGGCCTCTGGTCAAGC
AAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACTAGTGGTAGCAGTGGAAG
CTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGCAAATATGGAAAGGTTCT
GAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGCACAGAGGTGTCCAGGTG
TATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCTAAGAAAGAAATGAAGAA
AGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACACAAGCCTCTGTCAAAAA
AGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGATGAGAAGAATGATAATGG
AGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGACATATGGTAATACTAGA
CCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAAAAGGAGAGAGCTAGTCT
AGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTGAGAGAACATTTAGTTCG
TTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGAGAACGCATTAGAATAAT
TCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAGAGAGAGAGAATGGAACG
CGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAAAGAGAGGAACTCAGAAG
GCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGGCGAGATGATCCTTACTG
GAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAGAACAGATTTAATGACTT
TGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGCTTTGTTGGTCAAAGTGA
GGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGACTCCAGAAGAAATGAGCC
TCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACGGTGATTATTCATGACAG
GCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGTGAAGGAAGCATGTCCAC
TGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGCGCTCCCCCTGGGAATCG
TAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAGCACTATCCTGAGGAGCG
ACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGGCCTAGCTATCATGATAC
GAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAATAGAATTGTACAAATCAG
TGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGAAAATGAGCTCTCTGCCA
AGGTTTTAAGATAATTTATTGAAATCTCCTGTAAACTTTACTTGACTACTTATGAAGAGGACCTCTGACTTGCTTGAGAGTTCTGTCAGA
CTTTTCTTTTTAAAAATTTAACATGATTGCTTTTCTCAATTTTGGAGAAGATGTTTAAATAGTTCTGTTGTAACTTTTAATAGTTTTGTG
TATCATTCAACTTTTTTTCTTGCAGCACCGAGGCACATTTGAAAAGATGGAATTGAAGTCGTTTTGTTTAACGCTGTGTGAATATAAAGA
GTAGTTTGCAGCTGTGTGGTAGTGGTTTAATTTGCAGCCTTAGCTCTGTGGTGTCTGGCTCTAGAGTTACTTCTTTTTACCAAGCATTTT
CAGCCTCCATTTTGAAGGCTGTCTACACTTAAGAAGTCTTAGCTGTCTAATTTTTAGAGAATAAGATTGTTCATTGCATTTCTGAGTATT
ATGTAACCTATTTTTGCAGAAGGTACTGTTACATTAAGTGCATCTGTGTATCCTGGTTTAAAAAAATGTAATCTTTTTTGAAATAAACCT
TCATATTCTGTATAGTTGCTAAAGTGTTGAGAACCTTTTTAATTGTAAAATGAGAACCGATTTTCAGTTTAGTGTAGCAGCACACTTGTT
CAGGTTTGCATGGTATGAAACCAAATAGATTCATGAAACCTTGGCCATGAGGTTTGTTTCACAAGGTTCTTAGACCGAGTTGTGCAGGTA
AGTGCACTTTTAGGTAATCTGCACTGTTTGTTTGATGGATAAATTCCATCTCTGGGAATTGTGTGGGTATTAATGTTTCCATGTTCCCAA
CTATGTTGAGAAGTGGAAAAAAACCCAGGTTCTAGATGGGTGAATCAGTTGGGTTTTGTAAATACTTGTATGTGGGGAAGACATTGTTGT

>In-frame_RNF111_ENST00000434298_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_5606nt
GTCGTGCTCTCCTCGGTAGGGGAGGAATTGGTTAGGCGGCGGCGGCGGCGAAGCGGCGGCGGCGGCTGTAGGGGAGCAGCGGCAGTGGCG
GCGACGGCGAGGAGGTGTTCGGTTTGCGCAGCGTAGAAACGCCCGCAGCTTCAGAGAAGGAGTTCTTGTGGGACCAAATTAGGCATTCTG
AACCCACGCCGGCTTAGCTGGGCCGAGTCCAGGCGCTGCCGCACGTACAGTTTTGGTGGCGGTGACAGACACTGTTCTTGACTCTAGGGG
CCTATTAGGCCGACGTCTGAGGCGCAGATCGCTGGCTCTCGACGCATTACTCTTTACGCCTTACATTTCTGTCTTCCTTCCTGGGTCAGT
GATTCCCGGACCCTGGAAGAGAAGAGGGTGGCTAATGATTAAGGCTTTCCTTAAAGTTTCCCATGTCTCAATGGACTCCTGAATATAACG
AGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAGGAGAGTCTGAAAGGGATCCTTTTGCATC
CAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTGGGGAATGAATTCTCTCACCTGTGTGATG
ATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTTGTGAGGAAAAAACGCAAAAGCCAGCAGG
CTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAACACCTAGGGACACCAAGTGATGAAGATA
ATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCTGATACTGTGACTTCAGATGAGGATAAAG
AAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGGTCTCATAAGTGGCCTCGGACTGAGACAG
AATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTTCCATGCAGAAAGAGATTTGTAAAAAATA
ATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAAGTGTTAGCTCGAAGAAAATATGCCTTGC
TACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCAACTGAAGGAGAAGAAGATTTGTTTGTTT
CTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTTGTGGTGATAGAAGCTTCCTCCACTCCCC
AGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACAGTTGGAGAAAGCTATCGGTCTCGTTCAA
CCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAGGAGCCACGGAACCGCAGTAGGATTTCTA
CTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGATGAACCTACTGTAGTACCAACCACTTCTG
CAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAGCAGGCCTCTGATACTGCTTCAGCTGTCA
CCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACTGGCACTTCTATAGGAGATGACTCAAGGA
GAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGCTGTCCCCAGCACTCACCATGTGGAGGGT
CGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCACCATTTTCAACATCATCACCACCACCACC
ATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAAAGACCTCCACAAGTACAAGCACCTTGTG
GAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAGAAAGATATAGCAGGTTCTGGTGATGGTA
CACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCTCATGAAGAGATGGAAGCTCATACGACTG
TGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTGGATTTTGATGGTGATGACCTCCTAGAAA
CAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCCATTGCACAGAGCCCGGAGAAGGAAAGCA
AGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGACCCTGTCGAGAAGGAAGCCAGAGAAAGTT
CTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACTGGGGCCTCTGGTCAAGCAAAGAGCTCTT
CAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACTAGTGGTAGCAGTGGAAGCTCAACTAAAA
ATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGCAAATATGGAAAGGTTCTGAGTGCAAAAG
TAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGCACAGAGGTGTCCAGGTGTATTGCACATC
TTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCTAAGAAAGAAATGAAGAAAGAAAATGATG
AAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACACAAGCCTCTGTCAAAAAAGAAGAGAAAA
GATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGATGAGAAGAATGATAATGGAGCAAGTGGCC
AAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGACATATGGTAATACTAGACCAAACTAAAG
GAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAAAAGGAGAGAGCTAGTCTAGATAAAAAAA
GAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTGAGAGAACATTTAGTTCGTTTTGAAAGGC
TGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGAGAACGCATTAGAATAATTCGTGAACGGG
AAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAGAGAGAGAGAATGGAACGCGAACGCTTGG
AAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAAAGAGAGGAACTCAGAAGGCAACAACAGC
AGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGGCGAGATGATCCTTACTGGAGCGAGAATA
AAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAGAACAGATTTAATGACTTTGATCACCGAG
AGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGCTTTGTTGGTCAAAGTGAGGGGAAAAAAG
CACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGACTCCAGAAGAAATGAGCCTCCACCACCAA
GAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACGGTGATTATTCATGACAGGCCTGATATCA
CTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGTGAAGGAAGCATGTCCACTGACAAACGGG
AAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGCGCTCCCCCTGGGAATCGTAGCAGCGCTT
CGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAGCACTATCCTGAGGAGCGACATGTGGTTG
AACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGGCCTAGCTATCATGATACGAGGCGAATGG
GTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAATAGAATTGTACAAATCAGTGGCAATTCCA
TGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGAAAATGAGCTCTCTGCCAAGGTTTTAAGA
TAATTTATTGAAATCTCCTGTAAACTTTACTTGACTACTTATGAAGAGGACCTCTGACTTGCTTGAGAGTTCTGTCAGACTTTTCTTTTT
AAAAATTTAACATGATTGCTTTTCTCAATTTTGGAGAAGATGTTTAAATAGTTCTGTTGTAACTTTTAATAGTTTTGTGTATCATTCAAC
TTTTTTTCTTGCAGCACCGAGGCACATTTGAAAAGATGGAATTGAAGTCGTTTTGTTTAACGCTGTGTGAATATAAAGAGTAGTTTGCAG
CTGTGTGGTAGTGGTTTAATTTGCAGCCTTAGCTCTGTGGTGTCTGGCTCTAGAGTTACTTCTTTTTACCAAGCATTTTCAGCCTCCATT
TTGAAGGCTGTCTACACTTAAGAAGTCTTAGCTGTCTAATTTTTAGAGAATAAGATTGTTCATTGCATTTCTGAGTATTATGTAACCTAT
TTTTGCAGAAGGTACTGTTACATTAAGTGCATCTGTGTATCCTGGTTTAAAAAAATGTAATCTTTTTTGAAATAAACCTTCATATTCTGT
ATAGTTGCTAAAGTGTTGAGAACCTTTTTAATTGTAAAATGAGAACCGATTTTCAGTTTAGTGTAGCAGCACACTTGTTCAGGTTTGCAT
GGTATGAAACCAAATAGATTCATGAAACCTTGGCCATGAGGTTTGTTTCACAAGGTTCTTAGACCGAGTTGTGCAGGTAAGTGCACTTTT
AGGTAATCTGCACTGTTTGTTTGATGGATAAATTCCATCTCTGGGAATTGTGTGGGTATTAATGTTTCCATGTTCCCAACTATGTTGAGA
AGTGGAAAAAAACCCAGGTTCTAGATGGGTGAATCAGTTGGGTTTTGTAAATACTTGTATGTGGGGAAGACATTGTTGTCTTTTTGTGAA

>In-frame_RNF111_ENST00000559209_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_5320nt
CTGAGGCGCAGATCGCTGGCTCTCGACGCATTACTCTTTACGCCTTACATTTCTGTCTTCCTTCCTGGGTCAGTGATTCCCGGACCCTGG
AAGAGAAGAGGGTGGCTAATGATTAAGGCTTTCCTTAAAGTTTCCCATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAA
AGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAGGAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGC
AGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTGGGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGA
GAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTTGTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGT
GCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAACACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAG
TGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCTGATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACA
TTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGGTCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATT
GTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTTCCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGAC
ACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAAGTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAG
TTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCAACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCA
CCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTTGTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGA
AGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACAGTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAG
ATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAGGAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTT
GAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGATGAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACA
AGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAGCAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTC
CACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACTGGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGC
TGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGCTGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCA
TGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCACCATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGC
TGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAAAGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTC
TGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAGAAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAA
ACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCTCATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGA
TGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTGGATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAA
AATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCCATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAA
TGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGACCCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATC
TGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACTGGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGA
CAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACTAGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGG
ACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGCAAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCG
AAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGCACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCT
GCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCTAAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAG
AAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACACAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATC
TGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGATGAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGAT
TAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGACATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACC
ATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAAAAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAG
AAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTGAGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGA
ACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGAGAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTT
ACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAGAGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCG
TATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAAAGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACA
AGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGGCGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGA
TACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAGAACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCC
TGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGCTTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACG
AAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGACTCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGA
ATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACGGTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCC
TCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGTGAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAG
GCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGCGCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAG
AGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAGCACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGA
CACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGGCCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGG
AGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAATAGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGG
CTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGAAAATGAGCTCTCTGCCAAGGTTTTAAGATAATTTATTGAAATCT
CCTGTAAACTTTACTTGACTACTTATGAAGAGGACCTCTGACTTGCTTGAGAGTTCTGTCAGACTTTTCTTTTTAAAAATTTAACATGAT
TGCTTTTCTCAATTTTGGAGAAGATGTTTAAATAGTTCTGTTGTAACTTTTAATAGTTTTGTGTATCATTCAACTTTTTTTCTTGCAGCA
CCGAGGCACATTTGAAAAGATGGAATTGAAGTCGTTTTGTTTAACGCTGTGTGAATATAAAGAGTAGTTTGCAGCTGTGTGGTAGTGGTT
TAATTTGCAGCCTTAGCTCTGTGGTGTCTGGCTCTAGAGTTACTTCTTTTTACCAAGCATTTTCAGCCTCCATTTTGAAGGCTGTCTACA
CTTAAGAAGTCTTAGCTGTCTAATTTTTAGAGAATAAGATTGTTCATTGCATTTCTGAGTATTATGTAACCTATTTTTGCAGAAGGTACT
GTTACATTAAGTGCATCTGTGTATCCTGGTTTAAAAAAATGTAATCTTTTTTGAAATAAACCTTCATATTCTGTATAGTTGCTAAAGTGT
TGAGAACCTTTTTAATTGTAAAATGAGAACCGATTTTCAGTTTAGTGTAGCAGCACACTTGTTCAGGTTTGCATGGTATGAAACCAAATA
GATTCATGAAACCTTGGCCATGAGGTTTGTTTCACAAGGTTCTTAGACCGAGTTGTGCAGGTAAGTGCACTTTTAGGTAATCTGCACTGT
TTGTTTGATGGATAAATTCCATCTCTGGGAATTGTGTGGGTATTAATGTTTCCATGTTCCCAACTATGTTGAGAAGTGGAAAAAAACCCA
GGTTCTAGATGGGTGAATCAGTTGGGTTTTGTAAATACTTGTATGTGGGGAAGACATTGTTGTCTTTTTGTGAAAATAAAAATCCACACC

>In-frame_RNF111_ENST00000557998_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_5471nt
TGGAGGGGAGAAAGAGGAAGGGCTGCGGCCGCGGAAGGCTGGGGTCGGTGACCGGCCGGTTATCTCTGGCTCGGTGGTGACTTAGGGTCT
GGGTCTCCGCAGACGATTTGTGTTTGGGCAAGGCATTCGTCTACCGACACACCCACAGCCTACAGTGAGGGAGTGTGGGTGAGGGGATTT
CTCTCCCACTTCCGACTCTCCCTAGAGTCTCAGGATGGGGGCTGAGGACCGAGGCGTGGGAGTGCGATTTGACAATGGAGTGATGAAGGC
TTTCCTTAAAGTTTCCCATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTG
ATGCACCAAAGACACAGGAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGA
TGATTAATAGTAAAGTGGGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAAC
AAGAAAAAAGTCTCGTTGTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAA
TATTAGGACTGAGGCAACACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTC
TGCATTTTGGAGATTCTGATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTA
GAAGCCATAGTGCACGGTCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCA
GTTCGTTACGGAGACTTCCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGC
AGAGGAAGAAACGAGAAGTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAAT
CCTCTTCTAGCTCATCAACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAA
GTATTGATGAAGATGTTGTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTG
AAGTGGAGATTGTAACAGTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTC
ATGCAAGTCGGCCACAGGAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACC
TTACCGTTGATGAAGATGAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAA
ATCCATCTACCTCTGAGCAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTA
CAAGCAATAGTACCACTGGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGC
CAAGGTTACCTTCCTGCTGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCT
TTCAGCAGCATGGTCACCATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATC
CTGCTTGCCCTGTGGAAAGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTG
AGGAAGAAGAAAATGAGAAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTG
AGGCTGATCACACAGCTCATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTG
AAGATGCCATCACTCTGGATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAA
AAGATGGGCAGGACGCCATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAG
ACTGCGTGAAGGGTGACCCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGA
AAGGGCCCTCGTCTACTGGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAG
GAAGTACAAGTAGTACTAGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATT
TGAAGAACCTCTTTGGCAAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTG
TAACTATGTCTTCAAGCACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAG
TAAAAGGTGATCCCTCTAAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTG
ATAGAAGTAGCAAGACACAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGA
AAATAGAAGGTAAAGATGAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAA
GTTCCAAGAGTCCAGGACATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTC
ATGGAAGAAGTAAGGAAAAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGA
TGAAGGAACAAAGGTTGAGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGA
GAGAGCGTCGAGAGCGAGAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTG
AAAGGCAAAAACTAGAGAGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTG
AACGGATTGCTCGAGAAAGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCAC
GTGATGTAGATCATAGGCGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCG
ACTACTCTCGCCAACAGAACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTT
TTGAAAGGCGGGATCGCTTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATC
CCAAAAATTTCAGTGACTCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGC
GAGACGAAAGGAGAACGGTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGAC
CCACCAGCTGGAAAAGTGAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAG
GGCACAGTGTGAGAGGCGCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACC
GAGGAGGTGGATCACAGCACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATG
GTCCACCCTCTCAAGGGCCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTA
ACGCATCCCCAATTAATAGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGAC
CTCCGCGACGATTCTGAAAATGAGCTCTCTGCCAAGGTTTTAAGATAATTTATTGAAATCTCCTGTAAACTTTACTTGACTACTTATGAA
GAGGACCTCTGACTTGCTTGAGAGTTCTGTCAGACTTTTCTTTTTAAAAATTTAACATGATTGCTTTTCTCAATTTTGGAGAAGATGTTT
AAATAGTTCTGTTGTAACTTTTAATAGTTTTGTGTATCATTCAACTTTTTTTCTTGCAGCACCGAGGCACATTTGAAAAGATGGAATTGA
AGTCGTTTTGTTTAACGCTGTGTGAATATAAAGAGTAGTTTGCAGCTGTGTGGTAGTGGTTTAATTTGCAGCCTTAGCTCTGTGGTGTCT
GGCTCTAGAGTTACTTCTTTTTACCAAGCATTTTCAGCCTCCATTTTGAAGGCTGTCTACACTTAAGAAGTCTTAGCTGTCTAATTTTTA
GAGAATAAGATTGTTCATTGCATTTCTGAGTATTATGTAACCTATTTTTGCAGAAGGTACTGTTACATTAAGTGCATCTGTGTATCCTGG
TTTAAAAAAATGTAATCTTTTTTGAAATAAACCTTCATATTCTGTATAGTTGCTAAAGTGTTGAGAACCTTTTTAATTGTAAAATGAGAA
CCGATTTTCAGTTTAGTGTAGCAGCACACTTGTTCAGGTTTGCATGGTATGAAACCAAATAGATTCATGAAACCTTGGCCATGAGGTTTG
TTTCACAAGGTTCTTAGACCGAGTTGTGCAGGTAAGTGCACTTTTAGGTAATCTGCACTGTTTGTTTGATGGATAAATTCCATCTCTGGG
AATTGTGTGGGTATTAATGTTTCCATGTTCCCAACTATGTTGAGAAGTGGAAAAAAACCCAGGTTCTAGATGGGTGAATCAGTTGGGTTT

>In-frame_RNF111_ENST00000561186_chr15_59359282_+_SLTM_ENST00000380516_chr15_59193486_-_5184nt
ATGTCTCAATGGACTCCTGAATATAACGAGCTCTACACCTTAAAAGTGGATATGAAGAGTGAGATTCCTTCTGATGCACCAAAGACACAG
GAGAGTCTGAAAGGGATCCTTTTGCATCCAGAGCCCATTGGGGCAGCCAAAAGTTTTCCTGCAGGAGTTGAGATGATTAATAGTAAAGTG
GGGAATGAATTCTCTCACCTGTGTGATGATTCTCAAAAGCAAGAGAAGGAAATGAATGGTAACCAGCAAGAACAAGAAAAAAGTCTCGTT
GTGAGGAAAAAACGCAAAAGCCAGCAGGCTGGCCCTTCGTATGTGCAGAATTGTGTTAAAGAAAACCAGGGAATATTAGGACTGAGGCAA
CACCTAGGGACACCAAGTGATGAAGATAATGATTCCTCTTTTAGTGATTGTCTTTCTTCTCCTTCATCTAGTCTGCATTTTGGAGATTCT
GATACTGTGACTTCAGATGAGGATAAAGAAGTCTCTGTAAGACATTCCCAGACCATTTTGAATGCTAAAAGTAGAAGCCATAGTGCACGG
TCTCATAAGTGGCCTCGGACTGAGACAGAATCTGTATCGGGATTGTTAATGAAAAGACCCTGTTTACATGGCAGTTCGTTACGGAGACTT
CCATGCAGAAAGAGATTTGTAAAAAATAATTCCTCACAGAGGACACAGAAACAAAAAGAGAGGATATTAATGCAGAGGAAGAAACGAGAA
GTGTTAGCTCGAAGAAAATATGCCTTGCTACCTAGTTCTAGTAGTTCCAGTGAGAATGACCTCAGCAGTGAATCCTCTTCTAGCTCATCA
ACTGAAGGAGAAGAAGATTTGTTTGTTTCTGCCAGTGAAAACCACCAAAACAATCCAGCTGTTCCCTCAGGAAGTATTGATGAAGATGTT
GTGGTGATAGAAGCTTCCTCCACTCCCCAGGTTACTGCCAATGAAGAAATTAATGTTACCTCAACTGACAGTGAAGTGGAGATTGTAACA
GTTGGAGAAAGCTATCGGTCTCGTTCAACCCTTGGACACTCCAGATCTCATTGGAGCCAGGGTTCCAGTTCTCATGCAAGTCGGCCACAG
GAGCCACGGAACCGCAGTAGGATTTCTACTGTTATACAGCCCTTGAGGCAGAATGCAGCAGAAGTTGTGGACCTTACCGTTGATGAAGAT
GAACCTACTGTAGTACCAACCACTTCTGCAAGAATGGAATCACAAGCTACTAGCGCTTCCATTAACAATTCAAATCCATCTACCTCTGAG
CAGGCCTCTGATACTGCTTCAGCTGTCACCAGTAGCCAACCTTCCACAGTGTCAGAGACTTCAGCTACTCTTACAAGCAATAGTACCACT
GGCACTTCTATAGGAGATGACTCAAGGAGAACTACATCTAGTGCTGTAACGGAAACTGGCCCTCCTGCAATGCCAAGGTTACCTTCCTGC
TGTCCCCAGCACTCACCATGTGGAGGGTCGTCACAGAACCACCATGCATTAGGACATCCTCATACAAGTTGCTTTCAGCAGCATGGTCAC
CATTTTCAACATCATCACCACCACCACCATACTCCCCACCCAGCTGTCCCAGTTTCTCCTTCCTTTAGTGATCCTGCTTGCCCTGTGGAA
AGACCTCCACAAGTACAAGCACCTTGTGGAGCAAATAGTAGTTCTGGTACCAGCTATCATGAACAGGATGGTGAGGAAGAAGAAAATGAG
AAAGATATAGCAGGTTCTGGTGATGGTACACAAGAAGTATCTAAACCTCTTCCTTCAGAAGGGAGCCTAGCTGAGGCTGATCACACAGCT
CATGAAGAGATGGAAGCTCATACGACTGTGAAAGAAGCTGAGGATGACAACATCTCGGTCACAATCCAGGCTGAAGATGCCATCACTCTG
GATTTTGATGGTGATGACCTCCTAGAAACAGGTAAAAATGTGAAAATTACAGATTCTGAAGCAAGTAAGCCAAAAGATGGGCAGGACGCC
ATTGCACAGAGCCCGGAGAAGGAAAGCAAGGATTATGAGATGAATGCGAACCATAAAGATGGTAAGAAGGAAGACTGCGTGAAGGGTGAC
CCTGTCGAGAAGGAAGCCAGAGAAAGTTCTAAGAAAGCAGAATCTGGAGACAAAGAAAAGGATACTTTGAAGAAAGGGCCCTCGTCTACT
GGGGCCTCTGGTCAAGCAAAGAGCTCTTCAAAGGAATCTAAAGACAGCAAGACATCATCTAAAGATGACAAAGGAAGTACAAGTAGTACT
AGTGGTAGCAGTGGAAGCTCAACTAAAAATATCTGGGTTAGTGGACTTTCATCTAATACCAAAGCTGCTGATTTGAAGAACCTCTTTGGC
AAATATGGAAAGGTTCTGAGTGCAAAAGTAGTTACAAATGCTCGAAGTCCTGGGGCAAAATGCTATGGCATTGTAACTATGTCTTCAAGC
ACAGAGGTGTCCAGGTGTATTGCACATCTTCATCGCACTGAGCTGCATGGACAGCTGATTTCTGTTGAAAAAGTAAAAGGTGATCCCTCT
AAGAAAGAAATGAAGAAAGAAAATGATGAAAAGAGTAGTTCAAGAAGTTCTGGAGATAAAAAAAATACGAGTGATAGAAGTAGCAAGACA
CAAGCCTCTGTCAAAAAAGAAGAGAAAAGATCGTCTGAGAAATCTGAAAAAAAAGAAAGCAAGGATACTAAGAAAATAGAAGGTAAAGAT
GAGAAGAATGATAATGGAGCAAGTGGCCAAACATCAGAATCGATTAAAAAAAGTGAAGAAAAGAAGCGAATAAGTTCCAAGAGTCCAGGA
CATATGGTAATACTAGACCAAACTAAAGGAGATCATTGTAGACCATCAAGAAGAGGAAGATATGAGAAAATTCATGGAAGAAGTAAGGAA
AAGGAGAGAGCTAGTCTAGATAAAAAAAGAGATAAAGACTACAGAAGGAAAGAGATCTTGCCTTTTGAAAAGATGAAGGAACAAAGGTTG
AGAGAACATTTAGTTCGTTTTGAAAGGCTGCGACGAGCAATGGAACTTCGAAGACGAAGAGAGATTGCAGAGAGAGAGCGTCGAGAGCGA
GAACGCATTAGAATAATTCGTGAACGGGAAGAACGGGAACGCTTACAGAGAGAGAGAGAGCGCCTAGAAATTGAAAGGCAAAAACTAGAG
AGAGAGAGAATGGAACGCGAACGCTTGGAAAGGGAACGCATTCGTATTGAACAGGAACGTCGTAAGGAAGCTGAACGGATTGCTCGAGAA
AGAGAGGAACTCAGAAGGCAACAACAGCAGCTTCGTTATGAACAAGAAAAAAGGAATTCCTTGAAACGCCCACGTGATGTAGATCATAGG
CGAGATGATCCTTACTGGAGCGAGAATAAAAAGTTGTCTCTAGATACAGATGCACGATTTGGCCATGGATCCGACTACTCTCGCCAACAG
AACAGATTTAATGACTTTGATCACCGAGAGAGGGGCAGGTTTCCTGAGAGTTCAGCAGTACAGTCTTCATCTTTTGAAAGGCGGGATCGC
TTTGTTGGTCAAAGTGAGGGGAAAAAAGCACGACCTACTGCACGAAGGGAAGATCCAAGCTTCGAAAGATATCCCAAAAATTTCAGTGAC
TCCAGAAGAAATGAGCCTCCACCACCAAGAAATGAACTTAGAGAATCAGACAGGCGAGAAGTACGAGGGGAGCGAGACGAAAGGAGAACG
GTGATTATTCATGACAGGCCTGATATCACTCATCCTAGACATCCTCGAGAGGCAGGGCCCAATCCTTCCAGACCCACCAGCTGGAAAAGT
GAAGGAAGCATGTCCACTGACAAACGGGAAACAAGAGTTGAAAGGCCAGAACGATCTGGGAGAGAAGTATCAGGGCACAGTGTGAGAGGC
GCTCCCCCTGGGAATCGTAGCAGCGCTTCGGGGTACGGGAGCAGAGAGGGAGACAGAGGAGTCATCACAGACCGAGGAGGTGGATCACAG
CACTATCCTGAGGAGCGACATGTGGTTGAACGCCATGGACGGGACACAAGCGGACCAAGGAAAGAGTGGCATGGTCCACCCTCTCAAGGG
CCTAGCTATCATGATACGAGGCGAATGGGTGACGGCCGGGCAGGAGCAGGCATGATAACCCAACATTCAAGTAACGCATCCCCAATTAAT
AGAATTGTACAAATCAGTGGCAATTCCATGCCAAGAGGAAGTGGCTCCGGATTTAAGCCATTTAAGGGTGGACCTCCGCGACGATTCTGA
AAATGAGCTCTCTGCCAAGGTTTTAAGATAATTTATTGAAATCTCCTGTAAACTTTACTTGACTACTTATGAAGAGGACCTCTGACTTGC
TTGAGAGTTCTGTCAGACTTTTCTTTTTAAAAATTTAACATGATTGCTTTTCTCAATTTTGGAGAAGATGTTTAAATAGTTCTGTTGTAA
CTTTTAATAGTTTTGTGTATCATTCAACTTTTTTTCTTGCAGCACCGAGGCACATTTGAAAAGATGGAATTGAAGTCGTTTTGTTTAACG
CTGTGTGAATATAAAGAGTAGTTTGCAGCTGTGTGGTAGTGGTTTAATTTGCAGCCTTAGCTCTGTGGTGTCTGGCTCTAGAGTTACTTC
TTTTTACCAAGCATTTTCAGCCTCCATTTTGAAGGCTGTCTACACTTAAGAAGTCTTAGCTGTCTAATTTTTAGAGAATAAGATTGTTCA
TTGCATTTCTGAGTATTATGTAACCTATTTTTGCAGAAGGTACTGTTACATTAAGTGCATCTGTGTATCCTGGTTTAAAAAAATGTAATC
TTTTTTGAAATAAACCTTCATATTCTGTATAGTTGCTAAAGTGTTGAGAACCTTTTTAATTGTAAAATGAGAACCGATTTTCAGTTTAGT
GTAGCAGCACACTTGTTCAGGTTTGCATGGTATGAAACCAAATAGATTCATGAAACCTTGGCCATGAGGTTTGTTTCACAAGGTTCTTAG
ACCGAGTTGTGCAGGTAAGTGCACTTTTAGGTAATCTGCACTGTTTGTTTGATGGATAAATTCCATCTCTGGGAATTGTGTGGGTATTAA
TGTTTCCATGTTCCCAACTATGTTGAGAAGTGGAAAAAAACCCAGGTTCTAGATGGGTGAATCAGTTGGGTTTTGTAAATACTTGTATGT


Top

FusionGenePPI for RNF111_SLTM


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RNF111SMAD3, SMAD6, SMAD7, SKIL, SMAD2, UBE2D1, UBE2D2, UBE2D3, UBE2D4, UBE2E1, UBE2E3, UBE2G2, UBE2W, UBE2I, UBE2M, UBE2V1, UBE2K, UBE2E2, UBE2Q2, TSG101, CREB1, SKI, RB1CC1, SUMO2, SUMO1, FHL2, RNF111, HSP90AA1, SMURF2, PML, UBE2N, XPC, DTX3L, TRIM21, ANAPC11, LRSAM1, MARCH7, PHF7, TRIM8, TRAF5, CSNK2A2, CTBP1, MVP, ACTN3, CSNK2A1, KRTAP5-9, EDARADD, LCE4A, SUMO3, NR4A1, AXIN2, UBC, ESRP2, ESRP1, SETD7, FAM189B, UBXN7, TPX2, DCUN1D5, TTC9C, SUGP1, CGGBP1, RBM27, GNAQ, ADD3, C21orf59, SPASTSLTMTERF2, CALM1, SIRT7, SFPQ, ZC3HAV1, PLEC, DNAJC19, OBSL1, SUZ12, EED, BMI1, FGL1, GGPS1, LTBR, MED20, SRPK2, CEP19, MATR3, PPM1J, IKZF5, APOBEC3D, SNRNP70, GHITM, SSSCA1, ID2, ZC3H18


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
HgeneRNF111chr15:59359282chr15:59193486ENST00000348370+614241_404562987AXIN1
HgeneRNF111chr15:59359282chr15:59193486ENST00000434298+614241_4045621004AXIN1
HgeneRNF111chr15:59359282chr15:59193486ENST00000557998+614241_404562995AXIN1
HgeneRNF111chr15:59359282chr15:59193486ENST00000559209+614241_404562996AXIN1
HgeneRNF111chr15:59359282chr15:59193486ENST00000561186+513241_4045621004AXIN1


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RNF111_SLTM


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RNF111_SLTM


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource