FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31245

FusionGeneSummary for RILPL1_CDK4

check button Fusion gene summary
Fusion gene informationFusion gene name: RILPL1_CDK4
Fusion gene ID: 31245
HgeneTgene
Gene symbol

RILPL1

CDK4

Gene ID

353116

1019

Gene nameRab interacting lysosomal protein like 1cyclin dependent kinase 4
SynonymsGOSPEL|RLP1CMM3|PSK-J3
Cytomap

12q24.31

12q14.1

Type of geneprotein-codingprotein-coding
DescriptionRILP-like protein 1GAPDH competitor of SIAH protein enhances lifecyclin-dependent kinase 4cell division protein kinase 4
Modification date2018052320180523
UniProtAcc

Q5EBL4

P11802

Ensembl transtripts involved in fusion geneENST00000376874, ENST00000340724, 
ENST00000544468, 
ENST00000257904, 
ENST00000312990, ENST00000549606, 
ENST00000540325, ENST00000551888, 
Fusion gene scores* DoF score9 X 7 X 4=2527 X 2 X 3=42
# samples 96
** MAII scorelog2(9/252*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(6/42*10)=0.514573172829758
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RILPL1 [Title/Abstract] AND CDK4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneCDK4

GO:0006468

protein phosphorylation

8114739

TgeneCDK4

GO:0010971

positive regulation of G2/M transition of mitotic cell cycle

19124461

TgeneCDK4

GO:0071157

negative regulation of cell cycle arrest

19124461


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSARCTCGA-3B-A9HO-01ARILPL1chr12

123968727

-CDK4chr12

58142400

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000376874ENST00000257904RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000376874ENST00000312990RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000376874ENST00000549606RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000376874ENST00000540325RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-intronENST00000376874ENST00000551888RILPL1chr12

123968727

-CDK4chr12

58142400

-
In-frameENST00000340724ENST00000257904RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000340724ENST00000312990RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000340724ENST00000549606RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000340724ENST00000540325RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-intronENST00000340724ENST00000551888RILPL1chr12

123968727

-CDK4chr12

58142400

-
Frame-shitENST00000544468ENST00000257904RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000544468ENST00000312990RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000544468ENST00000549606RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-3UTRENST00000544468ENST00000540325RILPL1chr12

123968727

-CDK4chr12

58142400

-
5CDS-intronENST00000544468ENST00000551888RILPL1chr12

123968727

-CDK4chr12

58142400

-

Top

FusionProtFeatures for RILPL1_CDK4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RILPL1

Q5EBL4

CDK4

P11802

Plays a role in the regulation of cell shape andpolarity. Plays a role in cellular protein transport, includingprotein transport away from primary cilia. Neuroprotectiveprotein, which acts by sequestring GAPDH in the cytosol andprevent the apoptotic function of GAPDH in the nucleus. Competeswith SIAH1 for binding GAPDH (By similarity). Does not regulatelysosomal morphology and distribution. {ECO:0000250}. Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexesthat phosphorylate and inhibit members of the retinoblastoma (RB)protein family including RB1 and regulate the cell-cycle duringG(1)/S transition. Phosphorylation of RB1 allows dissociation ofthe transcription factor E2F from the RB/E2F complexes and thesubsequent transcription of E2F target genes which are responsiblefor the progression through the G(1) phase. Hypophosphorylates RB1in early G(1) phase. Cyclin D-CDK4 complexes are major integratorsof various mitogenenic and antimitogenic signals. Alsophosphorylates SMAD3 in a cell-cycle-dependent manner andrepresses its transcriptional activity. Component of the ternarycomplex, cyclin D/CDK4/CDKN1B, required for nuclear translocationand activity of the cyclin D-CDK4 complex.{ECO:0000269|PubMed:15241418, ECO:0000269|PubMed:18827403,ECO:0000269|PubMed:9003781}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRILPL1chr12:123968727chr12:58142400ENST00000376874-6776_258355404Coiled coilOntology_term=ECO:0000255
HgeneRILPL1chr12:123968727chr12:58142400ENST00000376874-6710_97355404DomainRH1
HgeneRILPL1chr12:123968727chr12:58142400ENST00000376874-67291_356355404DomainRH2

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCDK4chr12:123968727chr12:58142400ENST00000257904-6842_48273304Compositional biasNote=Poly-Gly
TgeneCDK4chr12:123968727chr12:58142400ENST00000257904-686_295273304DomainProtein kinase
TgeneCDK4chr12:123968727chr12:58142400ENST00000257904-6812_20273304Nucleotide bindingATP
TgeneCDK4chr12:123968727chr12:58142400ENST00000257904-6850_56273304RegionNote=Required for binding D-type cyclins


Top

FusionGeneSequence for RILPL1_CDK4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RILPL1_ENST00000376874_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_386aa
MEEERGSALAAESALEKNVAELTVMDVYDIASLVGHEFERVIDQHGCEAIARLMPKVVRVLEILEVLVSRHHVAPELDELRLELDRLRLE
RMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEVVDKQRDEIRAK
DRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEP
VGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYTKSEEMEEENRIPQPPPIAHPRTSPQPESGIKRLKC_L

>In-frame_RILPL1_ENST00000340724_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_266aa
MSMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRVTVVEAQGKALIEQKVELEADLQTKEQEMGS
LRAELGKLRERLQGEHSQNGEEEPETEPVGEESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYTKRFPHETTS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RILPL1_ENST00000376874_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_1160nt
ATGGAGGAGGAGCGGGGGTCGGCGCTGGCGGCCGAGTCGGCGCTGGAGAAGAACGTGGCCGAGCTGACCGTCATGGACGTGTACGACATC
GCGTCGCTTGTGGGCCACGAGTTCGAGCGGGTCATTGACCAGCACGGCTGCGAGGCCATCGCGCGCCTCATGCCCAAGGTCGTGCGCGTC
CTGGAGATCCTGGAGGTGCTGGTCAGCCGCCACCACGTCGCGCCCGAGCTGGACGAGCTGCGCCTGGAGCTGGACCGCCTGCGCCTGGAG
AGGATGGACCGCATCGAGAAGGAGCGCAAGCACCAGAAGGAGCTGGAGCTGGTGGAGGATGTGTGGCGAGGGGAGGCGCAGGACCTCCTC
TCCCAGATCGCCCAGCTGCAGGAGGAGAACAAGCAGCTCATGACCAACCTCTCCCACAAGGATGTCAATTTCTCAGAGGAGGAGTTCCAG
AAGCATGAAGGCATGTCAGAGCGGGAGCGACAGGTGATGAAGAAGCTGAAGGAGGTGGTGGACAAACAACGCGACGAGATCCGCGCCAAG
GACAGGGAGCTGGGCCTGAAAAATGAGGACGTTGAGGCTTTACAGCAGCAGCAGACACGGCTGATGAAGATCAACCATGACCTTCGGCAC
CGGGTCACGGTGGTGGAGGCCCAGGGGAAAGCCCTGATCGAACAGAAGGTGGAGCTGGAGGCAGACCTGCAGACCAAGGAGCAGGAGATG
GGCAGCCTGCGAGCAGAGCTGGGGAAGTTGCGAGAGAGGCTGCAGGGGGAGCACAGCCAGAATGGGGAGGAGGAGCCTGAGACGGAGCCG
GTGGGAGAGGAGAGCATCTCCGACGCAGAGAAGGTGGCCATGGATCTCAAGGACCCCAACCGCCCCCGGTTCACCCTGCAGGAGCTGCGG
GACGTGCTGCACGAGAGGAACGAGCTCAAGTCCAAGGTGTTCTTGCTGCAGGAGGAGCTGGCTTACTATAAGAGTGAAGAAATGGAAGAG
GAAAACCGAATACCCCAACCCCCACCCATCGCCCACCCGAGGACGTCCCCCCAGCCGGAGTCGGGCATCAAGCGACTGAAATGCTGACTT

>In-frame_RILPL1_ENST00000340724_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_800nt
ATGAGCATGTCAGAGCGGGAGCGACAGGTGATGAAGAAGCTGAAGGAGGTGGTGGACAAACAACGCGACGAGATCCGCGCCAAGGACAGG
GAGCTGGGCCTGAAAAATGAGGACGTTGAGGCTTTACAGCAGCAGCAGACACGGCTGATGAAGATCAACCATGACCTTCGGCACCGGGTC
ACGGTGGTGGAGGCCCAGGGGAAAGCCCTGATCGAACAGAAGGTGGAGCTGGAGGCAGACCTGCAGACCAAGGAGCAGGAGATGGGCAGC
CTGCGAGCAGAGCTGGGGAAGTTGCGAGAGAGGCTGCAGGGGGAGCACAGCCAGAATGGGGAGGAGGAGCCTGAGACGGAGCCGGTGGGA
GAGGAGAGCATCTCCGACGCAGAGAAGGTGGCCATGGATCTCAAGGACCCCAACCGCCCCCGGTTCACCCTGCAGGAGCTGCGGGACGTG
CTGCACGAGAGGAACGAGCTCAAGTCCAAGGTGTTCTTGCTGCAGGAGGAGCTGGCTTACTATAAGAGGTTTCCACATGAGACCACAAGC
AACATGAGACCAGAAGTCTTATTTATCTTGTCCATGGCTAAGTTCCCAGCACTTAGAATGGAGCTTGGCACACATGAAGAAATGGAAGAG
GAAAACCGAATACCCCAACCCCCACCCATCGCCCACCCGAGGACGTCCCCCCAGCCGGAGTCGGGCATCAAGCGACTGAAATGCTGACTT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RILPL1_ENST00000376874_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_2194nt
CTCGGGAGCAGCTCCGGGCCGAGCCGGGCGCCCAGACCCCGGGCCCGCACACCCCGCGCCGCCGCCCGTGCCCGCGCCCGCGCCCGCCGC
CCGCTGCCCGCTGCGCCCTCGCCCCAGCGCCCGCTGAGCGCGCCCGCCCGCGGCCCAGGCTGGGCCCGGCCGGCCCGGCCCTCGACAGCG
GCAAGTTTGGGAGTTGCACGAGTTTGCGGGGCGGGGGACAGGCCAGGAGGGTGGCCATGGAGGAGGAGCGGGGGTCGGCGCTGGCGGCCG
AGTCGGCGCTGGAGAAGAACGTGGCCGAGCTGACCGTCATGGACGTGTACGACATCGCGTCGCTTGTGGGCCACGAGTTCGAGCGGGTCA
TTGACCAGCACGGCTGCGAGGCCATCGCGCGCCTCATGCCCAAGGTCGTGCGCGTCCTGGAGATCCTGGAGGTGCTGGTCAGCCGCCACC
ACGTCGCGCCCGAGCTGGACGAGCTGCGCCTGGAGCTGGACCGCCTGCGCCTGGAGAGGATGGACCGCATCGAGAAGGAGCGCAAGCACC
AGAAGGAGCTGGAGCTGGTGGAGGATGTGTGGCGAGGGGAGGCGCAGGACCTCCTCTCCCAGATCGCCCAGCTGCAGGAGGAGAACAAGC
AGCTCATGACCAACCTCTCCCACAAGGATGTCAATTTCTCAGAGGAGGAGTTCCAGAAGCATGAAGGCATGTCAGAGCGGGAGCGACAGG
TGATGAAGAAGCTGAAGGAGGTGGTGGACAAACAACGCGACGAGATCCGCGCCAAGGACAGGGAGCTGGGCCTGAAAAATGAGGACGTTG
AGGCTTTACAGCAGCAGCAGACACGGCTGATGAAGATCAACCATGACCTTCGGCACCGGGTCACGGTGGTGGAGGCCCAGGGGAAAGCCC
TGATCGAACAGAAGGTGGAGCTGGAGGCAGACCTGCAGACCAAGGAGCAGGAGATGGGCAGCCTGCGAGCAGAGCTGGGGAAGTTGCGAG
AGAGGCTGCAGGGGGAGCACAGCCAGAATGGGGAGGAGGAGCCTGAGACGGAGCCGGTGGGAGAGGAGAGCATCTCCGACGCAGAGAAGG
TGGCCATGGATCTCAAGGACCCCAACCGCCCCCGGTTCACCCTGCAGGAGCTGCGGGACGTGCTGCACGAGAGGAACGAGCTCAAGTCCA
AGGTGTTCTTGCTGCAGGAGGAGCTGGCTTACTATAAGAGTGAAGAAATGGAAGAGGAAAACCGAATACCCCAACCCCCACCCATCGCCC
ACCCGAGGACGTCCCCCCAGCCGGAGTCGGGCATCAAGCGACTGAAATGCTGACTTTTAACCCACACAAGCGAATCTCTGCCTTTCGAGC
TCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGAGTGAGCAATGGAGTGGCTGCCATGGAAGGAAGAAAAGCTGCCATTTCC
CTTCTGGACACTGAGAGGGCAATCTTTGCCTTTATCTCTGAGGCTATGGAGGGTCCTCCTCCATCTTTCTACAGAGATTACTTTGCTGCC
TTAATGACATTCCCCTCCCACCTCTCCTTTTGAGGCTTCTCCTTCTCCTTCCCATTTCTCTACACTAAGGGGTATGTTCCCTCTTGTCCC
TTTCCCTACCTTTATATTTGGGGTCCTTTTTTATACAGGAAAAACAAAACAAAGAAATAATGGTCTTTTTTTTTTTTTTAATGTTTCTTC
CTCTGTTTGGCTTTGCCATTGTGCGATTTGGAAAAACCACTTGGAAGAAGGGACTTTCCTGCAAAACCTTAAAGACTGGTTAAATTACAG
GGCCTAGGAAGTCAGTGGAGCCCCTTGACTGACAAAGCTTAGAAAGGAACTGAAATTGCTTCTTTGAATATGGATTTTAGGCGGGGCGTG
GTGGCTCACGCCTATAATCCCAGCACGTTGGGAGGCCAACGCGGGTGGATCACCTGAGGTCAGGAGTTCGAGACCAGCCTGACTAACATG
GTGAAACCCTGTCTCTACTAAAAATACAAAATTAGTCAGGCGTGGTGGTGCACACCTGTAATCCCAGCTACTTGGGAGACTGAGGCAGGA
GGATCGCTTGAACCCGGGAGGCAGAGGTTGCGGTGAGCCGAGATCATGCCATTGCACTCCAGCCTGGGCAACAGAGCAAGACTCTGTGTC

>In-frame_RILPL1_ENST00000340724_chr12_123968727_-_CDK4_ENST00000257904_chr12_58142400_-_2665nt
AAAATCATGACAGTGTTGTACAACCATCACCTGTTTTGTTCCAAAACACTTTCACCACCTTCCTGAGGTGACTGCACCTGGCAGGTCTCT
CCCCAGCCTCTTGTCTCTGCCCTCCCTCCCTGCAGGTACAACCACTGGCAGCCTCTAATCTGCTTTCTGCCTCTGTGGATTTGCCAGTTC
TGGATATTTCCTATCGATGAAATCACACTGTATGCAACCTTGGGGTCTGATCTTAGACCCCACGTCATTTTTGAGGTTCATCCGTGCTGT
GGCGTGTCAGAGCTGCTTTCCTCGTTATGGCTGAATTGTCCTCCACTGTGTGGACTGAGCGCGTTGTGCTTATCCATTCTTAGCGGGGGG
ACATTTGGGTGGCTTCCATCTTTCATCTGCTACAGATAGTGCTGCTGTGAACTTTGTCACTTAACAGTCTATCTCAGTGTTTTCGACGGC
ACATCGTGTCTCATGGTGTCCCACTGCCTGGACAGTGCCTTGCTGGTGGACAGTAGCTCACTGCCAGATTCTCACTCCCACACGTGTGGC
TGCTGTGGCTGGCCACGGACGAGCTTCTCCATGGTGCCCCTGCCCAAGTGTCTCTTAAAATCTAGGTCCCTAGATCCTGAATTGCTGGGT
GTGTATGATGGCTCACAACTCTTCCAGCTTTTAACAGTGTCTGTTAAGAATACTTGGCCTTCTCTTAGTTTTCCAAAGCACTCTTGTACT
TTCTCTTAGCAGTGACCTGTGAAGCGGGGAGGCCTGGTCTTTCCGTATCAGGATAAAATGACTTAGACACTCTGGCCCTGGGCCCCTCTG
TTGTGAGCACTTCACATCGATGAAGCGTGCACAGGCCTCTCGAGAGCACCGAGGCCTGAAGGGAAAGCAACTAAGAGGCCGAAGCTGGGA
TAGGAGTCAGGCGCCAGGCTTCTGCCTCGGTCTCATAGCTCCTACGGCTGCCGCCCAGGAAGGTGATGAGGCTGCTGGGCTTCCACATAG
ACCCAGCCGCCCCTCTCTCCTCATGCTCGCCTCCCGCCCACCTCTCGGGGAGCCAAGGCAGCCCCAGCAAGGAGTAAATGAGCATGTCAG
AGCGGGAGCGACAGGTGATGAAGAAGCTGAAGGAGGTGGTGGACAAACAACGCGACGAGATCCGCGCCAAGGACAGGGAGCTGGGCCTGA
AAAATGAGGACGTTGAGGCTTTACAGCAGCAGCAGACACGGCTGATGAAGATCAACCATGACCTTCGGCACCGGGTCACGGTGGTGGAGG
CCCAGGGGAAAGCCCTGATCGAACAGAAGGTGGAGCTGGAGGCAGACCTGCAGACCAAGGAGCAGGAGATGGGCAGCCTGCGAGCAGAGC
TGGGGAAGTTGCGAGAGAGGCTGCAGGGGGAGCACAGCCAGAATGGGGAGGAGGAGCCTGAGACGGAGCCGGTGGGAGAGGAGAGCATCT
CCGACGCAGAGAAGGTGGCCATGGATCTCAAGGACCCCAACCGCCCCCGGTTCACCCTGCAGGAGCTGCGGGACGTGCTGCACGAGAGGA
ACGAGCTCAAGTCCAAGGTGTTCTTGCTGCAGGAGGAGCTGGCTTACTATAAGAGGTTTCCACATGAGACCACAAGCAACATGAGACCAG
AAGTCTTATTTATCTTGTCCATGGCTAAGTTCCCAGCACTTAGAATGGAGCTTGGCACACATGAAGAAATGGAAGAGGAAAACCGAATAC
CCCAACCCCCACCCATCGCCCACCCGAGGACGTCCCCCCAGCCGGAGTCGGGCATCAAGCGACTGAAATGCTGACTTTTAACCCACACAA
GCGAATCTCTGCCTTTCGAGCTCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGAGTGAGCAATGGAGTGGCTGCCATGGAA
GGAAGAAAAGCTGCCATTTCCCTTCTGGACACTGAGAGGGCAATCTTTGCCTTTATCTCTGAGGCTATGGAGGGTCCTCCTCCATCTTTC
TACAGAGATTACTTTGCTGCCTTAATGACATTCCCCTCCCACCTCTCCTTTTGAGGCTTCTCCTTCTCCTTCCCATTTCTCTACACTAAG
GGGTATGTTCCCTCTTGTCCCTTTCCCTACCTTTATATTTGGGGTCCTTTTTTATACAGGAAAAACAAAACAAAGAAATAATGGTCTTTT
TTTTTTTTTTAATGTTTCTTCCTCTGTTTGGCTTTGCCATTGTGCGATTTGGAAAAACCACTTGGAAGAAGGGACTTTCCTGCAAAACCT
TAAAGACTGGTTAAATTACAGGGCCTAGGAAGTCAGTGGAGCCCCTTGACTGACAAAGCTTAGAAAGGAACTGAAATTGCTTCTTTGAAT
ATGGATTTTAGGCGGGGCGTGGTGGCTCACGCCTATAATCCCAGCACGTTGGGAGGCCAACGCGGGTGGATCACCTGAGGTCAGGAGTTC
GAGACCAGCCTGACTAACATGGTGAAACCCTGTCTCTACTAAAAATACAAAATTAGTCAGGCGTGGTGGTGCACACCTGTAATCCCAGCT
ACTTGGGAGACTGAGGCAGGAGGATCGCTTGAACCCGGGAGGCAGAGGTTGCGGTGAGCCGAGATCATGCCATTGCACTCCAGCCTGGGC


Top

FusionGenePPI for RILPL1_CDK4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RILPL1MOV10CDK4CDKN2D, VTA1, CDKN2B, CCND3, CDKN2C, CDC37, CDKN2A, RPRM, ACTR3B, DBNL, SMC3, GEMIN4, UBXN1, SMC1A, LYN, SERTAD1, BAG6, SETDB1, CAPNS1, CCND1, PCNA, CCND2, CDKN1B, CNOT7, RFC1, BRCA1, CEBPA, MYOD1, BIRC5, CDKN1A, RB1, SP1, SAP25, CDT1, HSPA8, NCOA2, TSPYL2, WDR77, PRMT5, ARID4A, PPP2R1B, PPP2R1A, UHRF2, IRF8, DAZAP2, SNCA, TK1, APLP1, DDAH2, ZBTB16, QARS, HMGXB3, TRMT2A, ATP5B, PKM, LUC7L2, ANXA7, HSP90AA1, HIST1H1D, PSMD9, HIST1H1A, CDK5R1, ARRB2, MARCKS, RPL34, PSMA6, CCNE1, CCNA2, PPP1CA, CUL3, CUL4B, CUL1, COPS5, COPS6, H1F0, PSMD10, APP, UBTF, POLD1, VCP, SMAD3, SMAD2, FOXM1, CDC6, GLI1, MYC, OTX2, RBL1, RBL2, SHOX2, MZF1, SLBP, ANKRD12, SENP3, ZNF219, BCL11A, WDR33, ZNF335, ZNF101, MCM2, CDC7, UCHL1, KLHL32, CAMK1, PTMA, IL15RA, DUSP9, PGD, SKP1, CIB1, MAPRE2, CDK13, TARDBP, HSP90AB1, CDK6, TRAP1, FKBP5, RELA, HOOK1, LIMK2, RCAN3, HSP90AB4P, HSP90AB3P, HSP90AA5P, OGFR, EIF1AX, GUSB, OGFRL1, JAK3, GFER, VSIG8, NTRK1, ANKRA2, CEP135, IQGAP1, SMTN, SORBS1, NUP133, ZNFX1, ZC3H14, TMEM126A, ASPM, UBXN10, VHL, HDAC1, PRKDC, CHEK2, ERBB2, BCL2, TOP1, PTEN, YBX3, USP17L2, FNIP1, FNIP2, MTMR14, MTMR8, VTN, PTPN1, PTPN21, DNAJC9, E2F4, CDKN1C


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RILPL1_CDK4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCDK4P11802DB09073PalbociclibCyclin-dependent kinase 4small moleculeapproved|investigational

Top

RelatedDiseases for RILPL1_CDK4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneCDK4C0024668Mammary Neoplasms, Experimental3CTD_human
TgeneCDK4C1836892MELANOMA, CUTANEOUS MALIGNANT, SUSCEPTIBILITY TO, 33CTD_human;UNIPROT
TgeneCDK4C0023827liposarcoma2CTD_human
TgeneCDK4C0024667Animal Mammary Neoplasms2CTD_human
TgeneCDK4C0006118Brain Neoplasms1CTD_human
TgeneCDK4C0027659Neoplasms, Experimental1CTD_human
TgeneCDK4C0038356Stomach Neoplasms1CTD_human
TgeneCDK4C0677866Brain Stem Neoplasms1CTD_human
TgeneCDK4C2239176Liver carcinoma1CTD_human