FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 31018

FusionGeneSummary for RFC1_CORIN

check button Fusion gene summary
Fusion gene informationFusion gene name: RFC1_CORIN
Fusion gene ID: 31018
HgeneTgene
Gene symbol

RFC1

CORIN

Gene ID

6573

10699

Gene namesolute carrier family 19 member 1corin, serine peptidase
SynonymsCHMD|FOLT|IFC-1|IFC1|REFC|RFC|RFC1ATC2|CRN|Lrp4|PEE5|TMPRSS10
Cytomap

21q22.3

4p12

Type of geneprotein-codingprotein-coding
Descriptionfolate transporter 1intestinal folate carrier 1placental folate transporterreduced folate carrier 1reduced folate carrier proteinsolute carrier family 19 (folate transporter), member 1atrial natriuretic peptide-converting enzymeheart-specific serine proteinase ATC2pro-ANP-convertasepro-ANP-converting enzymetransmembrane protease serine 10
Modification date2018052720180506
UniProtAcc

P35251

Q9Y5Q5

Ensembl transtripts involved in fusion geneENST00000349703, ENST00000381897, 
ENST00000418436, 
ENST00000273857, 
ENST00000508498, ENST00000502252, 
ENST00000505909, ENST00000504584, 
ENST00000515827, 
Fusion gene scores* DoF score5 X 4 X 5=1005 X 6 X 5=150
# samples 75
** MAII scorelog2(7/100*10)=-0.514573172829758
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/150*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RFC1 [Title/Abstract] AND CORIN [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneRFC1

GO:0098838

folate transmembrane transport

14609557

TgeneCORIN

GO:0016486

peptide hormone processing

10880574


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-CC-A9FU-01ARFC1chr4

39343965

-CORINchr4

47680071

-
TCGALDLIHCTCGA-CC-A9FU-01ARFC1chr4

39343965

-CORINchr4

47682268

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000349703ENST00000273857RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000349703ENST00000508498RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000349703ENST00000502252RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000349703ENST00000505909RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000349703ENST00000504584RFC1chr4

39343965

-CORINchr4

47680071

-
5CDS-intronENST00000349703ENST00000515827RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000381897ENST00000273857RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000381897ENST00000508498RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000381897ENST00000502252RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000381897ENST00000505909RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000381897ENST00000504584RFC1chr4

39343965

-CORINchr4

47680071

-
5CDS-intronENST00000381897ENST00000515827RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-3CDSENST00000418436ENST00000273857RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-3CDSENST00000418436ENST00000508498RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-3CDSENST00000418436ENST00000502252RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-3CDSENST00000418436ENST00000505909RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-3CDSENST00000418436ENST00000504584RFC1chr4

39343965

-CORINchr4

47680071

-
5UTR-intronENST00000418436ENST00000515827RFC1chr4

39343965

-CORINchr4

47680071

-
In-frameENST00000349703ENST00000273857RFC1chr4

39343965

-CORINchr4

47682268

-
In-frameENST00000349703ENST00000508498RFC1chr4

39343965

-CORINchr4

47682268

-
In-frameENST00000349703ENST00000502252RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000349703ENST00000505909RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000349703ENST00000504584RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000349703ENST00000515827RFC1chr4

39343965

-CORINchr4

47682268

-
In-frameENST00000381897ENST00000273857RFC1chr4

39343965

-CORINchr4

47682268

-
In-frameENST00000381897ENST00000508498RFC1chr4

39343965

-CORINchr4

47682268

-
In-frameENST00000381897ENST00000502252RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000381897ENST00000505909RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000381897ENST00000504584RFC1chr4

39343965

-CORINchr4

47682268

-
5CDS-intronENST00000381897ENST00000515827RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-3CDSENST00000418436ENST00000273857RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-3CDSENST00000418436ENST00000508498RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-3CDSENST00000418436ENST00000502252RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-intronENST00000418436ENST00000505909RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-intronENST00000418436ENST00000504584RFC1chr4

39343965

-CORINchr4

47682268

-
5UTR-intronENST00000418436ENST00000515827RFC1chr4

39343965

-CORINchr4

47682268

-

Top

FusionProtFeatures for RFC1_CORIN


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RFC1

P35251

CORIN

Q9Y5Q5

The elongation of primed DNA templates by DNA polymerasedelta and epsilon requires the action of the accessory proteinsPCNA and activator 1. This subunit binds to the primer-templatejunction. Binds the PO-B transcription element as well as other GArich DNA sequences. Could play a role in DNA transcriptionregulation as well as DNA replication and/or repair. Can bindsingle- or double-stranded DNA. {ECO:0000269|PubMed:8999859}. Interacts with C-terminus of PCNA. 5' phosphate residueis required for binding of the N-terminal DNA-binding domain toduplex DNA, suggesting a role in recognition of non-primertemplate DNA structures during replication and/or repair.{ECO:0000269|PubMed:8999859}. Serine-type endopeptidase involved in atrial natriureticpeptide hormone (NPPA) processing. Converts through proteolyticcleavage the non-functional propeptide NPPA into the activehormone, thereby regulating blood pressure in heart and promotingnatriuresis, diuresis and vasodilation. Proteolytic cleavage ofpro-NPPA also plays a role in female pregnancy by promotingtrophoblast invasion and spiral artery remodeling in uterus. Alsoacts as a regulator of sodium reabsorption in kidney. May alsoprocess pro-NPPB the B-type natriuretic peptide. Isoform 2: has weaker endopeptidase activity compared toisoform 1.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722378_4153771043DomainLDL-receptor class A 4
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722450_5733771043DomainFZ 2
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722579_6143771043DomainLDL-receptor class A 5
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722615_6533771043DomainLDL-receptor class A 6
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722654_6893771043DomainLDL-receptor class A 7
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722690_8013771043DomainNote=SRCR
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722802_10353771043DomainPeptidase S1
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622341_3773401043DomainLDL-receptor class A 3
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622378_4153401043DomainLDL-receptor class A 4
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622450_5733401043DomainFZ 2
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622579_6143401043DomainLDL-receptor class A 5
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622615_6533401043DomainLDL-receptor class A 6
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622654_6893401043DomainLDL-receptor class A 7
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622690_8013401043DomainNote=SRCR
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622802_10353401043DomainPeptidase S1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRFC1chr4:39343965chr4:47680071ENST00000349703-425402_4921101148DomainBRCT
HgeneRFC1chr4:39343965chr4:47680071ENST00000381897-425402_4921101149DomainBRCT
HgeneRFC1chr4:39343965chr4:47682268ENST00000349703-425402_4921101148DomainBRCT
HgeneRFC1chr4:39343965chr4:47682268ENST00000381897-425402_4921101149DomainBRCT
HgeneRFC1chr4:39343965chr4:47680071ENST00000349703-4251120_11241101148MotifNuclear localization signal
HgeneRFC1chr4:39343965chr4:47680071ENST00000381897-4251120_11241101149MotifNuclear localization signal
HgeneRFC1chr4:39343965chr4:47682268ENST00000349703-4251120_11241101148MotifNuclear localization signal
HgeneRFC1chr4:39343965chr4:47682268ENST00000381897-4251120_11241101149MotifNuclear localization signal
HgeneRFC1chr4:39343965chr4:47680071ENST00000349703-425650_6571101148Nucleotide bindingATP
HgeneRFC1chr4:39343965chr4:47680071ENST00000381897-425650_6571101149Nucleotide bindingATP
HgeneRFC1chr4:39343965chr4:47682268ENST00000349703-425650_6571101148Nucleotide bindingATP
HgeneRFC1chr4:39343965chr4:47682268ENST00000381897-425650_6571101149Nucleotide bindingATP
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722134_2593771043DomainFZ 1
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722268_3043771043DomainLDL-receptor class A 1
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722305_3403771043DomainLDL-receptor class A 2
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-722341_3773771043DomainLDL-receptor class A 3
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622134_2593401043DomainFZ 1
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622268_3043401043DomainLDL-receptor class A 1
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-622305_3403401043DomainLDL-receptor class A 2
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-72226_293771043MotifNote=DDNN motif
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-62226_293401043MotifNote=DDNN motif
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-7221_453771043Topological domainCytoplasmic
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-72267_10423771043Topological domainExtracellular
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-6221_453401043Topological domainCytoplasmic
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-62267_10423401043Topological domainExtracellular
TgeneCORINchr4:39343965chr4:47680071ENST00000273857-72246_663771043TransmembraneHelical%3B Signal-anchor for type II membrane protein
TgeneCORINchr4:39343965chr4:47682268ENST00000273857-62246_663401043TransmembraneHelical%3B Signal-anchor for type II membrane protein


Top

FusionGeneSequence for RFC1_CORIN


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_505aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCGELLVSAICCTLSCLSATEAEWILNYFL

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_776aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADG
WQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLVNGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRT
SRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVE
LSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGG

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_505aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETACHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNN
SLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSK
ERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSN
KQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCGELLVSAICCTLSCLSATEAEWILNYFL

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_813aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPSKKKRIIYDSDSESEETLQVKNAKKPPEKLP
VSSKPGKISRQDPVTYISETDCNPTTEHRCGDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSD
EENCSVIQTSCQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQT
NCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSG
QCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADC
SDSSDEWDCVTLSINVNSSSFLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLTVAHCFEGRENAAVWKVVLGI
NNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRII
SLEHCQSYFDMKTITTRMICAGYESGTVDSCMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFL


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_1515nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGGTGAGCTACTTGTTTCTGCCATCTGTTGTACTCTCTCATGCCTGTCAGCCACTGAAGCTGAATGGATCCTAAATTACTTCCTG
GATTTTACTGACCAAGTTCATCTATTTTGTTTTACTGTTATAAAAGCTGATAGTGCTGATCTATGTGTGTTATTTCCAACTCACAGAAAA

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_2328nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGC
TGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAG
CCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGC
AGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACG
AGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGG
GTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCA
GTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAG
CTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTAT
ATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCC
TACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGG
CCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_1515nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGC
AGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATT
CAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAAC
AGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTT
GGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATG
TTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAA
GAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAAT
CAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGA
AGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAAT
AAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGAT
GATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGG
GACTGTGGTGAGCTACTTGTTTCTGCCATCTGTTGTACTCTCTCATGCCTGTCAGCCACTGAAGCTGAATGGATCCTAAATTACTTCCTG
GATTTTACTGACCAAGTTCATCTATTTTGTTTTACTGTTATAAAAGCTGATAGTGCTGATCTATGTGTGTTATTTCCAACTCACAGAAAA

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_2439nt
ATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGAT
GAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGC
AAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCA
GTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGC
GGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCAC
AGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGAT
GAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGC
TCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGT
ACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACC
AACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGG
GCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTT
CCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGA
CAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGAT
CTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAA
AACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGC
TCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAA
CACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTG
ATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTA
AATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAA
AGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGT
GTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATC
AACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGAC
TATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTA
GAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATT
TCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCA
TGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGC
TTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_4161nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACA
GCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATG
AGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCT
CTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTA
CAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCA
ACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGG
CATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTC
CAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGAC
AGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATC
TTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAA
ACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCT
CAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAAC
ACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGA
TACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAA
ATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAA
GGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTG
TCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCA
ACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACT
ATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAG
AGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTT
CTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCAT
GCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCT
TTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCC
TAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGC
TGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTT
TTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGACTTTGTCCTTTTGCCAGGCCTAACC
ATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTATGGAATGGTCTCTTTTATCCTATCA
CAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGTGCATAGTGGTAAATTTCAGTGTTA
ACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAATTTTAGGGTACACGAGCACAACGT
GCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGATTTATTAAAAGCCAAGATAATTTA
CATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGACAGCAATAAAAGACCAGTGTCATCC
ATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCAATATTAACACTTGACATTATTGGACCCCCCATTCTGGATGTATAT
CAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATATATGAGTTGGCTGATTGAGACTGCA
ACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAACTTTGCAAAAGAGAATTTAGATGA
GAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTTTTCTTGCGTTCATCCATACCAACA
AAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTTCCTCAAAAGATGTTTAATATCTGG
TTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCAATTTCTGAAGCAATTAGTGGTAAA
AAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATATATACTTAATTTAATTAGTCAGGCATCCATTTTGCCTTTTAAACA
ACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACCTGCAATTTTATACATGTATTTTTG
TATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCTCCTGTCCTTCAGTTTGTATAAACC
TAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATGTCAGTTTTGTTACAGTTGTAGCTA
CATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGTGAAATATATATATTATACTTATTTTAAATAATTCTTAATACAAAT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_2677nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACA
GCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATG
AGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCT
CTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTA
CAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCA
ACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGG
CATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTC
CAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGAC
AGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATC
TTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAA
ACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCT
CAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAAC
ACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGA
TACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAA
ATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAA
GGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTG
TCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCA
ACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACT
ATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAG
AGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTT
CTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCAT
GCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCT
TTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCC
TAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGC
TGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_2499nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACA
GCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATG
AGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCT
CTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTA
CAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCA
ACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGG
CATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTC
CAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGAC
AGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATC
TTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAA
ACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCT
CAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAAC
ACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGA
TACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAA
ATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAA
GGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTG
TCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCA
ACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACT
ATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAG
AGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTT
CTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCAT
GCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCT
TTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCC

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_2438nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACA
GCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATG
AGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCT
CTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTA
CAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCA
ACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGG
CATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTC
CAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGAC
AGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATC
TTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAA
ACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCT
CAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAAC
ACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGA
TACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAA
ATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAA
GGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTG
TCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCA
ACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACT
ATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAG
AGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTT
CTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCAT
GCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCT
TTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCC

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_1680nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGCCTGTCACA
GCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATG
AGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCT
CTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTA
CAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCA
ACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGG
CATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTC
CAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGAC
AGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATC
TTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAA
ACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCT
CAGACAGTTCAGATGAATGGGACTGTGGTGAGCTACTTGTTTCTGCCATCTGTTGTACTCTCTCATGCCTGTCAGCCACTGAAGCTGAAT
GGATCCTAAATTACTTCCTGGATTTTACTGACCAAGTTCATCTATTTTGTTTTACTGTTATAAAAGCTGATAGTGCTGATCTATGTGTGT
TATTTCCAACTCACAGAAAATTTCCCCACGAAGCTACTTCTCTATTTGAAATATCTATATTGTATGGAAAAACGTTTGGGTTCAAAATGT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47680071_-_4185nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACG
AGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCT
GCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCT
GCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTC
TTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAG
GCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTG
AAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTA
GTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAA
ACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACT
GCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGT
GGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGA
TGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAG
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC
TTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTAT
GGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGT
GCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAA
TTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGA
TTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGAC
AGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCAATATTAACACTTGACATTATT
GGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATAT
ATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAA
CTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTT
TTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTT
CCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCA
ATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATATATACTTAATTTAATTAGTCA
GGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACC
TGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCT
CCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATG
TCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGTGAAATATATATATTATACTTA

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47680071_-_2701nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACG
AGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCT
GCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCT
GCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTC
TTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAG
GCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTG
AAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTA
GTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAA
ACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACT
GCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGT
GGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGA
TGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAG
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC
TGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTT
GGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGAC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47680071_-_2523nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACG
AGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCT
GCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCT
GCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTC
TTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAG
GCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTG
AAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTA
GTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAA
ACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACT
GCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGT
GGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGA
TGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAG
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC
AGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGAC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000505909_chr4_47680071_-_2462nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACG
AGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCT
GCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCT
GCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTC
TTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAG
GCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTG
AAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTA
GTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAA
ACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACT
GCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGT
GGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGA
TGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAG
GAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGA
CCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCC
GCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAAC
CCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAG
TTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCC
GCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCT
TGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGC
AAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCT
ATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGAT
TAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGAC

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000504584_chr4_47680071_-_1704nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACG
AGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCT
GCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCT
GCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTC
TTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAG
GCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTG
AAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTA
GTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAA
ACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACT
GCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGT
GGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGGTGAGCTACTTGTTTCTGCCATCTGTTGTACTCTCTCAT
GCCTGTCAGCCACTGAAGCTGAATGGATCCTAAATTACTTCCTGGATTTTACTGACCAAGTTCATCTATTTTGTTTTACTGTTATAAAAG
CTGATAGTGCTGATCTATGTGTGTTATTTCCAACTCACAGAAAATTTCCCCACGAAGCTACTTCTCTATTTGAAATATCTATATTGTATG

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_4272nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATC
CCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACG
AGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGG
ACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCC
TTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCA
TGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTT
TCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCG
AGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAG
ACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTC
ATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACT
GTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCC
CTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGT
GTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGG
TTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAG
AACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCA
CTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCC
CTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCA
GTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTT
GGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCT
ACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGC
CCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAG
AGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATG
AGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAA
CTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGA
TTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGT
GAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGA
CTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTTACAAAAGCAAACAAAGCAGACTTT
GTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCAGGTGCTACAGTAACAGGTTATGGA
ATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAGTTTTTGTTTCTCAAGCTCAGTGCA
TAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAATTCTTTTTTATTACACTTCGAATTT
TAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGAACCCAGTAACTCGTCATTTGATTT
ATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAATTCTGAGAACTGATAAAAGACAGC
AATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCAATATTAACACTTGACATTATTGGA
CCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCATAGCTGGGTTTGTTCAGGATATATG
AGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGTGGCAAAGAACTGGATATTAAACTT
TGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTTAATTAAATTTATTTTTCAGTTTTC
TTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGGAGTAAAACATTTTGTAATTTTCCT
CAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTCTAGGCCACTTTACGCAACTCAATT
TCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATATATACTTAATTTAATTAGTCAGGC
ATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCAGCATTCCAAATAGATACTACCTGC
AATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAGCAATTTCTATACTATTCATCTCCT
GTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGTATGAAAGTTCAAGAACATATGTCA
GTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGTGAAATATATATATTATACTTATTT

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_2788nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATC
CCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACG
AGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGG
ACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCC
TTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCA
TGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTT
TCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCG
AGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAG
ACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTC
ATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACT
GTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCC
CTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGT
GTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGG
TTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAG
AACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCA
CTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCC
CTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCA
GTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTT
GGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCT
ACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGC
CCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAG
AGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATG
AGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAA
CTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGA
TTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGT
GAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACTGCAAATTTGCATGTTTGTTTTGGA

>In-frame_RFC1_ENST00000349703_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_2610nt
CTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAACCGGCCCACCCGCCAGCCAGCCAGC
GCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAACTTGTAAGTGAAACAGTAAAGAAGA
ATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAAATAGCTCCCGTAAAGAGGATGACT
TCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGACGTTGCAGGTAAAAAATGCCAAAA
AGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACATACATTTCAGAAACAGATTGCAATC
CCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACCACGACTGTGTGGATAAGTCTGACG
AGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCACGTTTCAATGTGATGGTGACGAGG
ACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACCAAAGATGCCTCTACAATCCCTGCC
TTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTGAACCAATTACATTGGAACTCTGCA
TGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCATCCATCAGCTGGGAGTCTTCTCTTT
TCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTACCAAAATGTGATGTGAATACAGGCG
AGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGATTGTGGGCCTACAGTGGCCTGAAG
ACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAATATGTGGAAGAATGCTCACCTAGTC
ATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTGACGATGACAGTGATGAGGAAAACT
GTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGATCTGCGATGGGTTCCCAGACTGCC
CTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATGCGTGTGTGTCACGTGACCTGTGGT
GTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATGTGAACTCCTCTTCCTTTCTGATGG
TTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGGCCTGCAAGCAGATGGGTTTAGGAG
AACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCAACTGGGAGAGCCTCAATGGGACCA
CTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTACTAAACAAGACTGTGGGCGCCGCC
CTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGCAGTGTTCTCTGCAGAGTGAACCCA
GTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCGAGGGGAGAGAGAATGCTGCAGTTT
GGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGAAGACCATCATCCTGCATCCCCGCT
ACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTGGCTACGTCCGGCCTGTCTGCTTGC
CCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCAATAAAATGCCATTTAAGCTGCAAG
AGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCACTCGGATGATATGTGCTGGCTATG
AGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAGGACGGTGGACATTATTTGGATTAA
CTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATTTCGTCGAATGGATTAAAAGACAGA
TTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTAAAAGAAAATGGCCTTCTTGACTGT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000273857_chr4_47682268_-_4296nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACC
ACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCA
CGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACC
AAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTG
AACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCAT
CCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTAC
CAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGA
TTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAAT
ATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTG
ACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGA
TCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATG
CGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATG
TGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGG
CCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCA
ACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTA
CTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGC
AGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCG
AGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGA
AGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTG
GCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCA
ATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCA
CTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAG
GACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATT
TCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTA
AAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACT
GCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTT
ACAAAAGCAAACAAAGCAGACTTTGTCCTTTTGCCAGGCCTAACCATGACTGCAGCACAAAATTATCGACTCTGGCGAGATTTAAAATCA
GGTGCTACAGTAACAGGTTATGGAATGGTCTCTTTTATCCTATCACAAAAAAAGACATAGATATTTAGGCTGATTAATTATCTCTACCAG
TTTTTGTTTCTCAAGCTCAGTGCATAGTGGTAAATTTCAGTGTTAACATTGGAGACTTGCTTTTCTTTTTCTTTTTTTATACCCCACAAT
TCTTTTTTATTACACTTCGAATTTTAGGGTACACGAGCACAACGTGCAGGTTAGTTACATATGTATACATGTGCCATGTTGGTGTGCTGA
ACCCAGTAACTCGTCATTTGATTTATTAAAAGCCAAGATAATTTACATGTTTAAAGTATTTACTATTACCCCCTTCTAATGTTTGCATAA
TTCTGAGAACTGATAAAAGACAGCAATAAAAGACCAGTGTCATCCATTTAGGTAGCAAGACATATTGAATGCAAAGTTCTTTAGATATCA
ATATTAACACTTGACATTATTGGACCCCCCATTCTGGATGTATATCAAGATCATAATTTTATAGAAGAGTCTCTATAGAACTGTCCTCAT
AGCTGGGTTTGTTCAGGATATATGAGTTGGCTGATTGAGACTGCAACAACTACATCTATATTTATGGGCAATATTTTGTTTTACTTATGT
GGCAAAGAACTGGATATTAAACTTTGCAAAAGAGAATTTAGATGAGAGATGCAATTTTTTAAAAAGAAAATTAATTTGCATCCCTCGTTT
AATTAAATTTATTTTTCAGTTTTCTTGCGTTCATCCATACCAACAAAGTCATAAAGAGCATATTTTAGAGCACAGTAAGACTTTGCATGG
AGTAAAACATTTTGTAATTTTCCTCAAAAGATGTTTAATATCTGGTTTCTTCTCATTGGTAATTAAAATTTTAGAAATGATTTTTAGCTC
TAGGCCACTTTACGCAACTCAATTTCTGAAGCAATTAGTGGTAAAAAGTATTTTTCCCCACTAAAAAACTTTAAAACACAAATCTTCATA
TATACTTAATTTAATTAGTCAGGCATCCATTTTGCCTTTTAAACAACTAGGATTCCCTACTAACCTCCACCAGCAACCTGGACTGCCTCA
GCATTCCAAATAGATACTACCTGCAATTTTATACATGTATTTTTGTATCTTTTCTGTGTGTAAACATAGTTGAAATTCAAAAAGTTGTAG
CAATTTCTATACTATTCATCTCCTGTCCTTCAGTTTGTATAAACCTAAGGAGAGTGTGAAATCCAGCAACTGAATTGTGGTCACGATTGT
ATGAAAGTTCAAGAACATATGTCAGTTTTGTTACAGTTGTAGCTACATACTCAATGTATCAACTTTTAGCCTGCTCAACTTAGGCTCAGT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000508498_chr4_47682268_-_2812nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACC
ACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCA
CGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACC
AAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTG
AACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCAT
CCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTAC
CAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGA
TTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAAT
ATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTG
ACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGA
TCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATG
CGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATG
TGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGG
CCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCA
ACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTA
CTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGC
AGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCG
AGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGA
AGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTG
GCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCA
ATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCA
CTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAG
GACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATT
TCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTA
AAAGAAAATGGCCTTCTTGACTGTGAAGAGCTGCCTGCAGAGAGCTGTACAGAAGCACTTTTCATGGACAGAAATGCTCAATCGTGCACT
GCAAATTTGCATGTTTGTTTTGGACTAATTTTTTTCAATTTATTTTTTCACCTTCATTTTTCTCTTATTTCAAGTTCAATGAAAGACTTT

>In-frame_RFC1_ENST00000381897_chr4_39343965_-_CORIN_ENST00000502252_chr4_47682268_-_2634nt
ACCGCGCGCCACTGTCTTCGCCTTCTTGCACTTCGCGGGAGAAGTTGTTGGCGCGAATGGATCCTGAGCCTCGATAACAGATTCCTCAAC
CGGCCCACCCGCCAGCCAGCCAGCGCCTTCATCCTGGGGCTGCGATGGACATTCGGAAATTCTTTGGAGTAATACCAAGTGGAAAGAAAC
TTGTAAGTGAAACAGTAAAGAAGAATGAGAAAACAAAGTCTGATGAAGAAACTTTAAAAGCAAAGAAAGGAATAAAGGAAATCAAGGTAA
ATAGCTCCCGTAAAGAGGATGACTTCAAACAAAAGCAACCAAGCAAGAAAAAGAGGATCATCTATGATTCAGATTCAGAGTCAGAGGAGA
CGTTGCAGGTAAAAAATGCCAAAAAGCCACCAGAAAAACTGCCAGTATCTTCTAAACCTGGTAAAATTTCACGGCAGGATCCTGTTACAT
ACATTTCAGAAACAGATTGCAATCCCACAACAGAGCATCGCTGCGGGGACGGGCGCTGCATCGCCATGGAGTGGGTGTGTGATGGTGACC
ACGACTGTGTGGATAAGTCTGACGAGGTCAACTGCTCCTGTCACAGCCAGGGTCTGGTGGAATGCAGAAATGGACAATGTATCCCCAGCA
CGTTTCAATGTGATGGTGACGAGGACTGCAAGGATGGGAGTGATGAGGAGAACTGCAGCGTCATTCAGACTTCATGTCAAGAAGGAGACC
AAAGATGCCTCTACAATCCCTGCCTTGATTCATGTGGTGGTAGCTCTCTCTGTGACCCGAACAACAGTCTGAATAACTGTAGTCAATGTG
AACCAATTACATTGGAACTCTGCATGAATTTGCCCTACAACAGTACAAGTTATCCAAATTATTTTGGCCACAGGACTCAAAAGGAAGCAT
CCATCAGCTGGGAGTCTTCTCTTTTCCCTGCACTTGTTCAAACCAACTGTTATAAATACCTCATGTTCTTTTCTTGCACCATTTTGGTAC
CAAAATGTGATGTGAATACAGGCGAGCATATCCCTCCTTGCAGGGCATTGTGTGAACACTCTAAAGAACGCTGTGAGTCTGTTCTTGGGA
TTGTGGGCCTACAGTGGCCTGAAGACACAGATTGCAGTCAATTTCCAGAGGAAAATTCAGACAATCAAACCTGCCTGATGCCTGATGAAT
ATGTGGAAGAATGCTCACCTAGTCATTTCAAGTGCCGCTCAGGACAGTGTGTTCTGGCTTCCAGAAGATGTGATGGCCAGGCCGACTGTG
ACGATGACAGTGATGAGGAAAACTGTGGTTGTAAAGAGAGAGATCTTTGGGAATGTCCATCCAATAAACAATGTTTGAAGCACACAGTGA
TCTGCGATGGGTTCCCAGACTGCCCTGATTACATGGACGAGAAAAACTGCTCATTTTGCCAAGATGATGAGCTGGAATGTGCAAACCATG
CGTGTGTGTCACGTGACCTGTGGTGTGATGGTGAAGCCGACTGCTCAGACAGTTCAGATGAATGGGACTGTGTGACCCTCTCTATAAATG
TGAACTCCTCTTCCTTTCTGATGGTTCACAGAGCTGCCACAGAACACCATGTGTGTGCAGATGGCTGGCAGGAGATATTGAGTCAGCTGG
CCTGCAAGCAGATGGGTTTAGGAGAACCATCTGTGACCAAATTGATACAGGAACAGGAGAAAGAGCCGCGGTGGCTGACATTACACTCCA
ACTGGGAGAGCCTCAATGGGACCACTTTACATGAACTTCTAGTAAATGGGCAGTCTTGTGAGAGCAGAAGTAAAATTTCTCTTCTGTGTA
CTAAACAAGACTGTGGGCGCCGCCCTGCTGCCCGAATGAACAAAAGGATCCTTGGAGGTCGGACGAGTCGCCCTGGAAGGTGGCCATGGC
AGTGTTCTCTGCAGAGTGAACCCAGTGGACATATCTGTGGCTGTGTCCTCATTGCCAAGAAGTGGGTTCTGACAGTTGCCCACTGCTTCG
AGGGGAGAGAGAATGCTGCAGTTTGGAAAGTGGTGCTTGGCATCAACAATCTAGACCATCCATCAGTGTTCATGCAGACACGCTTTGTGA
AGACCATCATCCTGCATCCCCGCTACAGTCGAGCAGTGGTGGACTATGACATCAGCATCGTTGAGCTGAGTGAAGACATCAGTGAGACTG
GCTACGTCCGGCCTGTCTGCTTGCCCAACCCGGAGCAGTGGCTAGAGCCTGACACGTACTGCTATATCACAGGCTGGGGCCACATGGGCA
ATAAAATGCCATTTAAGCTGCAAGAGGGAGAGGTCCGCATTATTTCTCTGGAACATTGTCAGTCCTACTTTGACATGAAGACCATCACCA
CTCGGATGATATGTGCTGGCTATGAGTCTGGCACAGTTGATTCATGCATGGGTGACAGCGGTGGGCCTCTTGTTTGTGAGAAGCCTGGAG
GACGGTGGACATTATTTGGATTAACTTCATGGGGCTCCGTCTGCTTTTCCAAAGTCCTGGGGCCTGGCGTTTATAGTAATGTGTCATATT
TCGTCGAATGGATTAAAAGACAGATTTACATCCAGACCTTTCTCCTAAACTAATTATAAGGATGATCAGAGACTTTTGCCAGCTACACTA


Top

FusionGenePPI for RFC1_CORIN


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RFC1ATM, BLM, BRCA1, MLH1, MRE11A, MSH2, MSH6, NBN, RAD50, HDAC1, BRD4, PCNA, TP53, RELA, CDK4, CCND1, RB1, XRCC5, RFC3, RAD17, CHTF18, RFC2, RFC4, RFC5, PMS1, SSBP3, ZSCAN1, SAP25, CSNK2B, HDGF, SIRT7, MYOC, LAMP2, RBM14, WDR18, NOTCH1, SMC1A, YWHAQ, RPA1, RPA2, RPA3, SPRTN, NIFK, THBS3, NTRK1, GLYR1, PDS5A, RACGAP1, CDC45, SMC2, SMC4, XRCC6, MUS81, HIST1H2BG, HIST1H3A, DAXX, HNRNPU, EMC2, NOP56, IBTK, C10orf12, NF2, H2AFY2, TEAD2, RRP8, RPL18A, FGF3, UBC, CHEK2, CHEK1CORIN


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RFC1_CORIN


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RFC1_CORIN


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRFC1C0001973Alcoholic Intoxication, Chronic1PSYGENET
HgeneRFC1C0009375Colonic Neoplasms1CTD_human
HgeneRFC1C0029463Osteosarcoma1CTD_human
TgeneCORINC3281288PREECLAMPSIA/ECLAMPSIA 51UNIPROT