FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30977

FusionGeneSummary for RERE_TPM3

check button Fusion gene summary
Fusion gene informationFusion gene name: RERE_TPM3
Fusion gene ID: 30977
HgeneTgene
Gene symbol

RERE

TPM3

Gene ID

473

7170

Gene namearginine-glutamic acid dipeptide repeatstropomyosin 3
SynonymsARG|ARP|ATN1L|DNB1|NEDBEHCAPM1|CFTD|HEL-189|HEL-S-82p|NEM1|OK/SW-cl.5|TM-5|TM3|TM30|TM30nm|TM5|TPM3nu|TPMsk3|TRK|hscp30
Cytomap

1p36.23

1q21.3

Type of geneprotein-codingprotein-coding
Descriptionarginine-glutamic acid dipeptide repeats proteinarginine-glutamic acid dipeptide (RE) repeatsatrophin 2atrophin-1 like proteinatrophin-1 related proteintropomyosin alpha-3 chainalpha-tropomyosin, slow skeletalcytoskeletal tropomyosin TM30epididymis luminal protein 189epididymis secretory sperm binding protein Li 82pheat-stable cytoskeletal protein 30 kDatropomyosin 3 nutropomyosin gammatropomyosi
Modification date2018052320180523
UniProtAcc

Q9P2R6

P06753

Ensembl transtripts involved in fusion geneENST00000337907, ENST00000377464, 
ENST00000400907, ENST00000400908, 
ENST00000476556, ENST00000460659, 
ENST00000368533, ENST00000469717, 
ENST00000330188, ENST00000341485, 
ENST00000341372, ENST00000328159, 
ENST00000271850, ENST00000302206, 
ENST00000368531, ENST00000323144, 
ENST00000368530, 
Fusion gene scores* DoF score19 X 16 X 9=27367 X 6 X 4=168
# samples 249
** MAII scorelog2(24/2736*10)=-3.51096191927738
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/168*10)=-0.900464326449086
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RERE [Title/Abstract] AND TPM3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVSTADTCGA-RD-A8MW-01AREREchr1

8674620

-TPM3chr1

154148724

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337907ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000337907ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000337907ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000337907ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000337907ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000337907ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-
intron-3CDSENST00000377464ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000377464ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000377464ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000377464ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000377464ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000377464ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-
In-frameENST00000400907ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400907ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400907ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400907ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400907ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400907ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-
Frame-shitENST00000400908ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-intronENST00000400908ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400908ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400908ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400908ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
5CDS-5UTRENST00000400908ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-
intron-3CDSENST00000476556ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000476556ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000476556ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000476556ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000476556ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000476556ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-
intron-3CDSENST00000460659ENST00000368533REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000469717REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000330188REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000341485REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000341372REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000328159REREchr1

8674620

-TPM3chr1

154148724

-
intron-intronENST00000460659ENST00000271850REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000460659ENST00000302206REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000460659ENST00000368531REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000460659ENST00000323144REREchr1

8674620

-TPM3chr1

154148724

-
intron-5UTRENST00000460659ENST00000368530REREchr1

8674620

-TPM3chr1

154148724

-

Top

FusionProtFeatures for RERE_TPM3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RERE

Q9P2R6

TPM3

P06753

Plays a role as a transcriptional repressor duringdevelopment. May play a role in the control of cell survival.Overexpression of RERE recruits BAX to the nucleus particularly toPOD and triggers caspase-3 activation, leading to cell death.{ECO:0000269|PubMed:11331249}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneREREchr1:8674620chr1:154148724ENST00000337907-5241156_12111741567Coiled coilOntology_term=ECO:0000255
HgeneREREchr1:8674620chr1:154148724ENST00000400908-4231156_12111741567Coiled coilOntology_term=ECO:0000255
HgeneREREchr1:8674620chr1:154148724ENST00000476556-1131156_1211-1891013Coiled coilOntology_term=ECO:0000255
HgeneREREchr1:8674620chr1:154148724ENST00000337907-5241179_12041741567Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000337907-5241300_13221741567Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000337907-5241425_14451741567Compositional biasNote=His-rich
HgeneREREchr1:8674620chr1:154148724ENST00000337907-5241451_15101741567Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000337907-524738_11181741567Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000400908-4231179_12041741567Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000400908-4231300_13221741567Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000400908-4231425_14451741567Compositional biasNote=His-rich
HgeneREREchr1:8674620chr1:154148724ENST00000400908-4231451_15101741567Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000400908-423738_11181741567Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000476556-1131179_1204-1891013Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000476556-1131300_1322-1891013Compositional biasNote=Arg/Glu-rich (mixed charge)
HgeneREREchr1:8674620chr1:154148724ENST00000476556-1131425_1445-1891013Compositional biasNote=His-rich
HgeneREREchr1:8674620chr1:154148724ENST00000476556-1131451_1510-1891013Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000476556-113738_1118-1891013Compositional biasNote=Pro-rich
HgeneREREchr1:8674620chr1:154148724ENST00000337907-524103_2831741567DomainBAH
HgeneREREchr1:8674620chr1:154148724ENST00000337907-524284_3871741567DomainELM2
HgeneREREchr1:8674620chr1:154148724ENST00000337907-524391_4431741567DomainSANT
HgeneREREchr1:8674620chr1:154148724ENST00000400908-423103_2831741567DomainBAH
HgeneREREchr1:8674620chr1:154148724ENST00000400908-423284_3871741567DomainELM2
HgeneREREchr1:8674620chr1:154148724ENST00000400908-423391_4431741567DomainSANT
HgeneREREchr1:8674620chr1:154148724ENST00000476556-113103_283-1891013DomainBAH
HgeneREREchr1:8674620chr1:154148724ENST00000476556-113284_387-1891013DomainELM2
HgeneREREchr1:8674620chr1:154148724ENST00000476556-113391_443-1891013DomainSANT
HgeneREREchr1:8674620chr1:154148724ENST00000337907-524507_5321741567Zinc fingerNote=GATA-type
HgeneREREchr1:8674620chr1:154148724ENST00000400908-423507_5321741567Zinc fingerNote=GATA-type
HgeneREREchr1:8674620chr1:154148724ENST00000476556-113507_532-1891013Zinc fingerNote=GATA-type
TgeneTPM3chr1:8674620chr1:154148724ENST00000323144-081_28544248Coiled coilOntology_term=ECO:0000250
TgeneTPM3chr1:8674620chr1:154148724ENST00000330188-081_28544249Coiled coilOntology_term=ECO:0000250
TgeneTPM3chr1:8674620chr1:154148724ENST00000368530-1101_28581286Coiled coilOntology_term=ECO:0000250
TgeneTPM3chr1:8674620chr1:154148724ENST00000368531-081_28544248Coiled coilOntology_term=ECO:0000250
TgeneTPM3chr1:8674620chr1:154148724ENST00000368533-081_28544249Coiled coilOntology_term=ECO:0000250


Top

FusionGeneSequence for RERE_TPM3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RERE_ENST00000337907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_379aa
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNTAESDHSEDEDNDNNSATAEESTKKNKKKPPKKKSRTERTD
TGEITSYITEDDVVYRPGDCVTIESRRPNTPTFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGAEAEVA
SLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDL
ERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEE

>In-frame_RERE_ENST00000400907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_379aa
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNTAESDHSEDEDNDNNSATAEESTKKNKKKPPKKKSRTERTD
TGEITSYITEDDVVYRPGDCVTIESRRPNTPTFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGAEAEVA
SLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKTEEVARKLVIIEGDL
ERTEERAELAESRCREMDEQIRLMDQNLKCLSAAEEKYSQKEDKTEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RERE_ENST00000337907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_1137nt
ATGACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGA
GAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGAC
AATGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGAT
ACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACA
CCGTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCC
CCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGGCTGAGGCTGAGGTGGCC
TCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCT
GAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATC
CAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTG
GAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGT
CTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAG
ACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGATAAACTGAAATGCACCAAAGAGGAG

>In-frame_RERE_ENST00000400907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_1137nt
ATGACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGA
GAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGAC
AATGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGAT
ACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACA
CCGTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCC
CCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGGCTGAGGCTGAGGTGGCC
TCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCT
GAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATC
CAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTG
GAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGT
CTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAG
ACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGATAAACTGAAATGCACCAAAGAGGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RERE_ENST00000337907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_4103nt
AAAATCACCATCATCCTCAGGGAGCCCCCTCGCCCTCGGAAAACAAAACCAGACATGATCCTGGGCTCCTGCTTCTGAAAGATCTGCCCG
ACCGAGGAGGAGGGAGCCTAGGTTCAAGTCGCAGGAAAGGTCACGGCAGGGAAGCCCCCTCAGCCCCTCCGCGTCGCCTCCCCGCGGGCC
GCCCCTCTCGGCCCTGCGCCCCGCGGCCCCGCAGCCTCCGCGCGGCCTCCCGCCCCATCCCCGCCACTTTCCCCGGAGCTGGGCCGCGAA
CACCTCACTATTGATGGTGTAGCGCTTTAGGGGAAGGAGGTGATTGTCTAGGAGTAACTGTATGTGCGCTCAGCACCGGGTCACAACCAC
CGTGGGATCCACTTACAGAGAAGATTTGTGGAGAGCTTCAGCCTGTTTATGGTGTTACTGAGAAAGGAATTGTGGCCATTTGATATAATT
CTGGATGGAAGACCTCTTATTTGTATTACATTGAATTAGAGCATTTTTGAAACGTTGGGGTTGTTGGAGTGGTTGGATTTTCCCTGGAAT
TGAGTGAGAAATTCAGAAGACTGAAGCCCAGGCTTACTGTCTACCTTTCACGGAGGCCTAGCCGTGAGAGGACAGAAGAAGGCACGTGGC
GAATCATGACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAG
CAAGAGAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACG
AGGACAATGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGA
CAGATACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAA
ACACACCGTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTG
ACCCCCCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGGCTGAGGCTGAGG
TGGCCTCCTTGAACCGTAGGATCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAG
AAGCTGAAAAAGCTGCTGATGAGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGG
AAATCCAACTCAAAGAAGCTAAGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAG
ACTTGGAACGCACAGAGGAACGAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGA
AGTGTCTGAGTGCTGCTGAAGAAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGG
CAGAGACCCGTGCTGAGTTTGCTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGATAAACTGAAATGCACCAAAG
AGGAGCACCTCTGTACACAAAGGATGCTGGACCAGACCCTGCTTGACCTGAATGAGATGTAGAACGCCCCAGTCCCACCCTGCTGCTGCT
CCTCCCTCTGACCCAGACTCCGCCTGAGGCCAGCCTGCGGGAAGCTGACCTTTAACTGAGGGCTGATCTTTAACTGGAAGGCTGCTTTCT
CCTTTCACCACCCCCTCCTTCCCTGTGTCTTTTTCGCCAAACTGTCTCTGCCTCTTCCCGGAGAATCCAGCTGGGCTAGAGGCTGAGCAC
CTTTGGAAACAACATTTAAGGGAATGTGAGCACAATGCATAATGTCTTTAAAAAGCATGTTGTGATGTACACATTTTGTAATTACCTTTT
TTGTTGTTTTGTAGCAACCATTTGTAAAACATTCCAAATAATTCCACAGTCCTGAAGCAGCAATCGAATCCCTTTCTCACTTTTGGAAGG
TGACTTTTCACCTTAATGCATATTCCCCTCTCCATAGAGGAGAGGAAAAGGTGTAGGCCTGCCTTACCGAGAGCCAAACAGAGCCCAGGG
AGACTCCGCTGTGGGAAACCTCATTGTTCTGTACAAAGTACTAGCTAAACCAGAAAGGTGATTCCAGGAGGAGTTAGCCAAACAACAACA
AAAACAAAAAATGTGCTGTTCAAGTTTTCAGCTTTAAGATATCTTTGGATAATGTTATTTCTATTTTTTATTTTTTTCATTAGAAGTTAC
CAAATTAAGATGGTAAGACCTCTGAGACCAAAATTTTGTCCCATCTCTACCCCCTCACAACTGCTTACAGAATGGATCATGTCCCCCTTA
TGTTGAGGTGACCACTTAATTGCTTTCCTGCCTCCTTGAAAGAAAGAAAGAAAGAAGACTGTGTTTTTGCCACTGATTTAGCCATGTGAA
ACTCATCTCATTACCCTTTTCTGGGTTTGAAGCTGCTGTCTCTAGAAGTGCCATCTCAATTGTGCTTTGTATCAGTCAGTGCTGGAGAAA
TCTTGAATAGCTTATGTACAAAACTTTTTAAATTTTATATTATTTTGAAACTTTGCTTTGGGTTTGTGGCACCCTGGCCACCCCATCTGG
CTGTGACAGCCTCTGCAGTCCGTGGGCTGGCAGTTTGTTGATCTTTTAAGTTTCCTTCCCTACCCAGTCCCCATTTTCTGGTAAGGTTTC
TAGGAGGTCTGTTAGGTGTACATCCTGCAGCTTATTGGCTTAAAATGTACTCTCCTTTTATGTGGTCTCTTTGGGGCCGATTGGGAGAAA
GAGAAATCAATAGTGCAACTGTTTTGATACTGAATATTGACAAGTGTCTTTTTGAAATAAAGAACCAGTCCCTCCAACCCTCAGACCTAT
TTGACTTTTATTTATTAAAACTAAATGTGCTTTCTCCACAGAAGCTATGAGGTTTGGGTTAAAAATAGCATCTTTGTGGGTGGTAGCAAC
AGGATTTATTCTTTATTATTATTATTTTTGAGATGAAGTTTCATTCTTGTTGCCTGGGCTGGAGCGTAATGGCTCGATCTCGGCTCACTG
CAACCTCCGCCTCCTGGTTCAAGAGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCATGCCCGGGTAATT
TTTTATATTTTAAGTAGAGACAGGGCTTCACCATGTTGGCCAGGCTGGTCTCGAACTCCTGACCTTCAGGTGATCCACCTGCCTCAGCTT
CCCAAAATGCTGGGATTACGGGCGTGAGCCACCGCACCCAGCTGGAGCAACAGGATTTAATATAGAGCAAATGTTTAGTTTTATCATCTG
TAAAATGGAGATAAGTATTGTCAGAGTAAACATGAAGATTAGAAAGAACACTTAATGTGCTGGGCCTTTTATAGGTTAACACTGACATCT
CAGGCTGAACTATATACATTTTCCTTCACAACCATATCAATCCTTATAAACTATGGATTTATGCTCCTTAAAACAATATATAATGCTGAT
CACTACTATAAATGCGTGGTTTTAACCAACTGTACTGAAACAGCTTTGAGTTTATATTCTGTTTGGATATTTGGAGAAAACAACAAGTGC
TCTCAAGAGTATTTGCTTAGAGGCCGGCTGTGTGAGTGGATAACTTTGAAAGCTGCTTTTGAGACGCCAGTGTCTGGCATTTCCTGCATT
CTGGCCTGGAGGCCGGACGTGAATCTGACTTCTAGTAAAAATACACGGTTCCCTTGACAAAGTCGAGCTGTTTATCCCAGAGACTGCACA
ATTTTCCGTTGATAGGCATGGACCAATGCTAACTGGAAATCATTGCAAAAAGTTTTTTTGTCGGGCGGAGGGTGTGGTGTTAAGATAAAC

>In-frame_RERE_ENST00000400907_chr1_8674620_-_TPM3_ENST00000368533_chr1_154148724_-_3542nt
TGAAGCCCAGGCTTACTGTCTACCTTTCACGGAGGCCTAGCCGTGAGAGGACAGAAGAAGGCACGTGGCGAATCATGACAGCGGACAAAG
ACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGAGAGAGTGAGAATTCAA
GGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGACAATGACAACAATAGTG
CCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGATACCGGTGAGATAACAT
CCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACACCGTATTTCATCTGTA
GCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCCCCAGCATGCTCTCTGC
CGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGGCTGAGGCTGAGGTGGCCTCCTTGAACCGTAGGA
TCCAGCTGGTTGAAGAAGAGCTGGACCGTGCTCAGGAGCGCCTGGCCACTGCCCTGCAAAAGCTGGAAGAAGCTGAAAAAGCTGCTGATG
AGAGTGAGAGAGGTATGAAGGTTATTGAAAACCGGGCCTTAAAAGATGAAGAAAAGATGGAACTCCAGGAAATCCAACTCAAAGAAGCTA
AGCACATTGCAGAAGAGGCAGATAGGAAGTATGAAGAGGTGGCTCGTAAGTTGGTGATCATTGAAGGAGACTTGGAACGCACAGAGGAAC
GAGCTGAGCTGGCAGAGTCCCGTTGCCGAGAGATGGATGAGCAGATTAGACTGATGGACCAGAACCTGAAGTGTCTGAGTGCTGCTGAAG
AAAAGTACTCTCAAAAAGAAGATAAATATGAGGAAGAAATCAAGATTCTTACTGATAAACTCAAGGAGGCAGAGACCCGTGCTGAGTTTG
CTGAGAGATCGGTAGCCAAGCTGGAAAAGACAATTGATGACCTGGAAGATAAACTGAAATGCACCAAAGAGGAGCACCTCTGTACACAAA
GGATGCTGGACCAGACCCTGCTTGACCTGAATGAGATGTAGAACGCCCCAGTCCCACCCTGCTGCTGCTCCTCCCTCTGACCCAGACTCC
GCCTGAGGCCAGCCTGCGGGAAGCTGACCTTTAACTGAGGGCTGATCTTTAACTGGAAGGCTGCTTTCTCCTTTCACCACCCCCTCCTTC
CCTGTGTCTTTTTCGCCAAACTGTCTCTGCCTCTTCCCGGAGAATCCAGCTGGGCTAGAGGCTGAGCACCTTTGGAAACAACATTTAAGG
GAATGTGAGCACAATGCATAATGTCTTTAAAAAGCATGTTGTGATGTACACATTTTGTAATTACCTTTTTTGTTGTTTTGTAGCAACCAT
TTGTAAAACATTCCAAATAATTCCACAGTCCTGAAGCAGCAATCGAATCCCTTTCTCACTTTTGGAAGGTGACTTTTCACCTTAATGCAT
ATTCCCCTCTCCATAGAGGAGAGGAAAAGGTGTAGGCCTGCCTTACCGAGAGCCAAACAGAGCCCAGGGAGACTCCGCTGTGGGAAACCT
CATTGTTCTGTACAAAGTACTAGCTAAACCAGAAAGGTGATTCCAGGAGGAGTTAGCCAAACAACAACAAAAACAAAAAATGTGCTGTTC
AAGTTTTCAGCTTTAAGATATCTTTGGATAATGTTATTTCTATTTTTTATTTTTTTCATTAGAAGTTACCAAATTAAGATGGTAAGACCT
CTGAGACCAAAATTTTGTCCCATCTCTACCCCCTCACAACTGCTTACAGAATGGATCATGTCCCCCTTATGTTGAGGTGACCACTTAATT
GCTTTCCTGCCTCCTTGAAAGAAAGAAAGAAAGAAGACTGTGTTTTTGCCACTGATTTAGCCATGTGAAACTCATCTCATTACCCTTTTC
TGGGTTTGAAGCTGCTGTCTCTAGAAGTGCCATCTCAATTGTGCTTTGTATCAGTCAGTGCTGGAGAAATCTTGAATAGCTTATGTACAA
AACTTTTTAAATTTTATATTATTTTGAAACTTTGCTTTGGGTTTGTGGCACCCTGGCCACCCCATCTGGCTGTGACAGCCTCTGCAGTCC
GTGGGCTGGCAGTTTGTTGATCTTTTAAGTTTCCTTCCCTACCCAGTCCCCATTTTCTGGTAAGGTTTCTAGGAGGTCTGTTAGGTGTAC
ATCCTGCAGCTTATTGGCTTAAAATGTACTCTCCTTTTATGTGGTCTCTTTGGGGCCGATTGGGAGAAAGAGAAATCAATAGTGCAACTG
TTTTGATACTGAATATTGACAAGTGTCTTTTTGAAATAAAGAACCAGTCCCTCCAACCCTCAGACCTATTTGACTTTTATTTATTAAAAC
TAAATGTGCTTTCTCCACAGAAGCTATGAGGTTTGGGTTAAAAATAGCATCTTTGTGGGTGGTAGCAACAGGATTTATTCTTTATTATTA
TTATTTTTGAGATGAAGTTTCATTCTTGTTGCCTGGGCTGGAGCGTAATGGCTCGATCTCGGCTCACTGCAACCTCCGCCTCCTGGTTCA
AGAGATTCTCCTGCCTCAGCCTCCCGAGTAGCTGGGATTACAGGCACCTGCCACCATGCCCGGGTAATTTTTTATATTTTAAGTAGAGAC
AGGGCTTCACCATGTTGGCCAGGCTGGTCTCGAACTCCTGACCTTCAGGTGATCCACCTGCCTCAGCTTCCCAAAATGCTGGGATTACGG
GCGTGAGCCACCGCACCCAGCTGGAGCAACAGGATTTAATATAGAGCAAATGTTTAGTTTTATCATCTGTAAAATGGAGATAAGTATTGT
CAGAGTAAACATGAAGATTAGAAAGAACACTTAATGTGCTGGGCCTTTTATAGGTTAACACTGACATCTCAGGCTGAACTATATACATTT
TCCTTCACAACCATATCAATCCTTATAAACTATGGATTTATGCTCCTTAAAACAATATATAATGCTGATCACTACTATAAATGCGTGGTT
TTAACCAACTGTACTGAAACAGCTTTGAGTTTATATTCTGTTTGGATATTTGGAGAAAACAACAAGTGCTCTCAAGAGTATTTGCTTAGA
GGCCGGCTGTGTGAGTGGATAACTTTGAAAGCTGCTTTTGAGACGCCAGTGTCTGGCATTTCCTGCATTCTGGCCTGGAGGCCGGACGTG
AATCTGACTTCTAGTAAAAATACACGGTTCCCTTGACAAAGTCGAGCTGTTTATCCCAGAGACTGCACAATTTTCCGTTGATAGGCATGG
ACCAATGCTAACTGGAAATCATTGCAAAAAGTTTTTTTGTCGGGCGGAGGGTGTGGTGTTAAGATAAACAGTGTGCAACAGAAGAAATTA


Top

FusionGenePPI for RERE_TPM3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
REREATN1, LZTR1, NR2E1, HDAC1, HDAC2, EHMT2, HIST2H3C, ELAVL1, KRTAP4-12, PLSCR1, TRIM22, CBFA2T2, EFEMP2, ZMYND8, PSMA3, PRRC2A, ALG13, ECM1, EFEMP1, PRRC2B, KAT6A, RBFOX2, WDR5, EP300, AUTS2, FBXW7, CDO1, TRIM25TPM3KXD1, TFPT, MCC, EIF4A2, TPM3, TP73, NEK2, RAD21, ELAVL1, SP1, CUL3, CDK2, LRRK2, TPM4, SEC23IP, KYNU, TPM2, TPM1, PRDX1, THOC1, CDC123, SF3A2, SEPT9, HSPB1, BRCA1, MDC1, PAXIP1, HSP90AA1, HSP90AB1, FN1, PAN2, HDAC8, FBXO5, TRAP1, PARK2, FASN, FKBP4, FKBP5, MAGED2, CAP1, MCM3, MGEA5, TP53, HSF2, IFIT3, KCNE1, KIFC3, MAGEA11, PBX3, TRIM27, VPS52, TNNT1, TRIP6, MAD1L1, TLK1, OIP5, BLOC1S6, CCHCR1, THAP1, CCDC146, CCDC102B, CCDC114, SYCE1, IKBIP, C1orf216, LCA5L, FAM9C, HDDC3, WASH3P, LURAP1, SHMT2, MOV10, NXF1, CUL7, OBSL1, RNF2, EGFR, DAPK1, ACTN2, AHCYL1, ATP1A1, CKB, CKMT1B, CKMT1A, COX5A, CYC1, OSTF1, ACTN1, ACTN4, ATP5F1, COX4I1, MTCH1, MYH7B, NDUFB10, PSMA2, PSMA6, STMN1, TBCD, UQCRC2, NTRK1, DVL2, HOOK2, ADD1, CAPZA2, MYH9, PPP1CB, PPP1CC, IQGAP1, PDLIM7, ANLN, MYO5C, MYO19, MYO18A, MCM2, RNF20, IMP3, CALCOCO1, JUN, METTL2B, CCDC101, SPAG9, PARK7, PDHA1, VDAC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RERE_TPM3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RERE_TPM3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneREREC3495559Juvenile arthritis1CTD_human
TgeneTPM3C1836448Nemaline myopathy 19CTD_human;ORPHANET;UNIPROT
TgeneTPM3C0546264Congenital Fiber Type Disproportion5ORPHANET;UNIPROT
TgeneTPM3C0024667Animal Mammary Neoplasms2CTD_human
TgeneTPM3C0024668Mammary Neoplasms, Experimental2CTD_human
TgeneTPM3C0001418Adenocarcinoma1CTD_human
TgeneTPM3C0009375Colonic Neoplasms1CTD_human
TgeneTPM3C0023893Liver Cirrhosis, Experimental1CTD_human
TgeneTPM3C0038356Stomach Neoplasms1CTD_human
TgeneTPM3C0040136Thyroid Neoplasm1CTD_human