FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30971

FusionGeneSummary for RERE_OOEP

check button Fusion gene summary
Fusion gene informationFusion gene name: RERE_OOEP
Fusion gene ID: 30971
HgeneTgene
Gene symbol

RERE

OOEP

Gene ID

473

441161

Gene namearginine-glutamic acid dipeptide repeatsoocyte expressed protein
SynonymsARG|ARP|ATN1L|DNB1|NEDBEHC6orf156|FLOPED|HOEP19|KHDC2
Cytomap

1p36.23

6q13

Type of geneprotein-codingprotein-coding
Descriptionarginine-glutamic acid dipeptide repeats proteinarginine-glutamic acid dipeptide (RE) repeatsatrophin 2atrophin-1 like proteinatrophin-1 related proteinoocyte-expressed protein homologKH homology domain containing 2KH homology domain-containing protein 2oocyte and embryo protein 19oocyte expressed protein homolog (dog)oocyte- and embryo-specific protein 19
Modification date2018052320180329
UniProtAcc

Q9P2R6

A6NGQ2

Ensembl transtripts involved in fusion geneENST00000337907, ENST00000377464, 
ENST00000400907, ENST00000400908, 
ENST00000476556, ENST00000460659, 
ENST00000370363, ENST00000370359, 
Fusion gene scores* DoF score19 X 16 X 9=27365 X 2 X 3=30
# samples 245
** MAII scorelog2(24/2736*10)=-3.51096191927738
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/30*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: RERE [Title/Abstract] AND OOEP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-G9-7522-01AREREchr1

8482787

-OOEPchr6

74079108

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000337907ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
Frame-shitENST00000337907ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-
Frame-shitENST00000377464ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
Frame-shitENST00000377464ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-
Frame-shitENST00000400907ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
Frame-shitENST00000400907ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-
In-frameENST00000400908ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
In-frameENST00000400908ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-
5UTR-3CDSENST00000476556ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
5UTR-3CDSENST00000476556ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-
5UTR-3CDSENST00000460659ENST00000370363REREchr1

8482787

-OOEPchr6

74079108

-
5UTR-3CDSENST00000460659ENST00000370359REREchr1

8482787

-OOEPchr6

74079108

-

Top

FusionProtFeatures for RERE_OOEP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RERE

Q9P2R6

OOEP

A6NGQ2

Plays a role as a transcriptional repressor duringdevelopment. May play a role in the control of cell survival.Overexpression of RERE recruits BAX to the nucleus particularly toPOD and triggers caspase-3 activation, leading to cell death.{ECO:0000269|PubMed:11331249}. As a member of the subcortical maternal complex (SCMC),plays an essential role for zygotes to progress beyond the firstembryonic cell divisions. {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RERE_OOEP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370363_chr6_74079108_-_514aa
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNTAESDHSEDEDNDNNSATAEESTKKNKKKPPKKKSRTERTD
TGEITSYITEDDVVYRPGDCVTIESRRPNTPTFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
LMNVKWYYRQSEVPDSVTQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAALRGKCNISHFSDIFAAREFKARVDSFFYIL
GTNPETRRLNSTQGEIRVGPSHQAKLPDLQPFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETAQTEP_FQKWSGRARPC_QWT_

>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370359_chr6_74079108_-_514aa
MTADKDKDKDKEKDRDRDRDREREKRDKARESENSRPRRSCTLEGGAKNTAESDHSEDEDNDNNSATAEESTKKNKKKPPKKKSRTERTD
TGEITSYITEDDVVYRPGDCVTIESRRPNTPTFICSIQDFKLVHNSQACCRSPTPALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHL
LMNVKWYYRQSEVPDSVTQHLVQDRHNENDSGRELVITDPVIKNRELFISDYVDTYHAAALRGKCNISHFSDIFAAREFKARVDSFFYIL
GTNPETRRLNSTQGEIRVGPSHQAKLPDLQPFPSPDGDTVTQHEELVWMPGVNDCDLLMYLRAARSMAAFAGMCDGGSTEDGCVAASRDD
TTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETAQTEP_FQKWSGRARPC_QWT_


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370363_chr6_74079108_-_1544nt
ATGACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGA
GAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGAC
AATGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGAT
ACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACA
CCGTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCC
CCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGAGTAAGAGGGACCATCTC
CTCATGAACGTCAAATGGTACTACCGTCAATCTGAGGTTCCAGATTCTGTGTATCAGCATTTGGTTCAGGATCGACATAATGAAAATGAC
TCTGGAAGAGAACTTGTCATTACAGACCCAGTTATCAAGAACCGAGAGCTCTTCATTTCTGATTACGTTGACACTTACCATGCTGCTGCC
CTTAGAGGGAAGTGTAACATCTCCCATTTTTCTGACATATTTGCTGCTAGAGAGTTTAAAGCCCGAGTGGATTCATTTTTCTACATATTA
GGATATAACCCTGAGACAAGGAGGCTGAACAGTACCCAGGGGGAGATTCGTGTCGGTCCTAGTCATCAGGCCAAACTTCCAGATCTGCAA
CCATTTCCTTCTCCAGATGGTGATACAGTGACCCAACATGAGGAACTGGTCTGGATGCCTGGAGTTAACGACTGTGACCTCCTTATGTAC
TTGAGGGCAGCAAGGAGCATGGCGGCATTTGCAGGAATGTGTGATGGAGGCTCTACAGAGGACGGCTGTGTCGCAGCCTCTCGGGATGAC
ACCACTCTGAATGCACTGAACACACTGCATGAAAGCGGTTACGATGCTGGCAAAGCCCTGCAGCGCCTGGTGAAGAAGCCTGTGCCCAAG
CTCATCGAGAAGTGCTGGACCGAGGACGAAGTGAAACGCTTCGTTAAGGGACTCAGGCAGTACGGGAAGAACTTCTTCAGAATTAGAAAG
GAGCTGCTTCCCAATAAGGAAACAGCCCAGACCGAGCCATAATTCCAGAAATGGAGTGGACGAGCCAGGCCCTGCTGACAGTGGACATAG
TTGACTCAGGGAACCTAGTCGAAATCACCGTTTTCGGGCGGCCCCGTGTACAGAATCGGGTGAAGAGCATGCTCCTGTGCCTGGCATGGT
TTCACCGAGAACATCGTGCCCGAGCTGAGAAGATGAAACACCTTGAGAAGAACTTGAAGGCCCATGCATCAGACCCCCACTCTCCCCAGG

>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370359_chr6_74079108_-_1544nt
ATGACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGA
GAGAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGAC
AATGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGAT
ACCGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACA
CCGTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCC
CCAGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGAGTAAGAGGGACCATCTC
CTCATGAACGTCAAATGGTACTACCGTCAATCTGAGGTTCCAGATTCTGTGTATCAGCATTTGGTTCAGGATCGACATAATGAAAATGAC
TCTGGAAGAGAACTTGTCATTACAGACCCAGTTATCAAGAACCGAGAGCTCTTCATTTCTGATTACGTTGACACTTACCATGCTGCTGCC
CTTAGAGGGAAGTGTAACATCTCCCATTTTTCTGACATATTTGCTGCTAGAGAGTTTAAAGCCCGAGTGGATTCATTTTTCTACATATTA
GGATATAACCCTGAGACAAGGAGGCTGAACAGTACCCAGGGGGAGATTCGTGTCGGTCCTAGTCATCAGGCCAAACTTCCAGATCTGCAA
CCATTTCCTTCTCCAGATGGTGATACAGTGACCCAACATGAGGAACTGGTCTGGATGCCTGGAGTTAACGACTGTGACCTCCTTATGTAC
TTGAGGGCAGCAAGGAGCATGGCGGCATTTGCAGGAATGTGTGATGGAGGCTCTACAGAGGACGGCTGTGTCGCAGCCTCTCGGGATGAC
ACCACTCTGAATGCACTGAACACACTGCATGAAAGCGGTTACGATGCTGGCAAAGCCCTGCAGCGCCTGGTGAAGAAGCCTGTGCCCAAG
CTCATCGAGAAGTGCTGGACCGAGGACGAAGTGAAACGCTTCGTTAAGGGACTCAGGCAGTACGGGAAGAACTTCTTCAGAATTAGAAAG
GAGCTGCTTCCCAATAAGGAAACAGCCCAGACCGAGCCATAATTCCAGAAATGGAGTGGACGAGCCAGGCCCTGCTGACAGTGGACATAG
TTGACTCAGGGAACCTAGTCGAAATCACCGTTTTCGGGCGGCCCCGTGTACAGAATCGGGTGAAGAGCATGCTCCTGTGCCTGGCATGGT
TTCACCGAGAACATCGTGCCCGAGCTGAGAAGATGAAACACCTTGAGAAGAACTTGAAGGCCCATGCATCAGACCCCCACTCTCCCCAGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370363_chr6_74079108_-_2401nt
CACAGACGCTCGCGAGCAACCCTCCGCGCTCCGGAGCCTCCTCAGCCTCCCGCACACCCCGAGACGCTCGCCCCGCTGGGCCTCGGTCCC
CGCCTCCTCCCCCGTCCTTTTCCCCTCTCTCGCTCCCCACATTGTCTCTGCCTCATTTTCTCTCCTAGTTGAGGATTAAAAAAAAAAAAA
AATCACCATCATCCTCAGGGAGCCCCCTCGCCCTCGGAAAACAAAACCAGACATGATCCTGGGCTCCTGCTTCTGAAAGATCTGCCCGAC
CGAGGAGGAGGGAGCCTAGGTTCAAGTCGCAGGAAAGGTCACGGCAGGGAAGCCCCCTCAGCCCCTCCGCGTCGCCTCCCCGCGGGCCGC
CCCTCTCGGCCCTGCGCCCCGCGGCCCCGCAGCCTCCGCGCGGCCTCCCGCCCCATCCCCGCCACTTTCCCCGGAGCTGGGCCGCGAACA
CCTCACTATTGATGGTGTAGCGCTTTAGGGGAAGCATTTTTGAAACGTTGGGGTTGTTGGAGTGGTTGGATTTTCCCTGGAATTGAGTGA
GAAATTCAGAAGACTGAAGCCCAGGCTTACTGTCTACCTTTCACGGAGGCCTAGCCGTGAGAGGACAGAAGAAGGCACGTGGCGAATCAT
GACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGAGA
GAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGACAA
TGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGATAC
CGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACACC
GTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCCCC
AGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGAGTAAGAGGGACCATCTCCT
CATGAACGTCAAATGGTACTACCGTCAATCTGAGGTTCCAGATTCTGTGTATCAGCATTTGGTTCAGGATCGACATAATGAAAATGACTC
TGGAAGAGAACTTGTCATTACAGACCCAGTTATCAAGAACCGAGAGCTCTTCATTTCTGATTACGTTGACACTTACCATGCTGCTGCCCT
TAGAGGGAAGTGTAACATCTCCCATTTTTCTGACATATTTGCTGCTAGAGAGTTTAAAGCCCGAGTGGATTCATTTTTCTACATATTAGG
ATATAACCCTGAGACAAGGAGGCTGAACAGTACCCAGGGGGAGATTCGTGTCGGTCCTAGTCATCAGGCCAAACTTCCAGATCTGCAACC
ATTTCCTTCTCCAGATGGTGATACAGTGACCCAACATGAGGAACTGGTCTGGATGCCTGGAGTTAACGACTGTGACCTCCTTATGTACTT
GAGGGCAGCAAGGAGCATGGCGGCATTTGCAGGAATGTGTGATGGAGGCTCTACAGAGGACGGCTGTGTCGCAGCCTCTCGGGATGACAC
CACTCTGAATGCACTGAACACACTGCATGAAAGCGGTTACGATGCTGGCAAAGCCCTGCAGCGCCTGGTGAAGAAGCCTGTGCCCAAGCT
CATCGAGAAGTGCTGGACCGAGGACGAAGTGAAACGCTTCGTTAAGGGACTCAGGCAGTACGGGAAGAACTTCTTCAGAATTAGAAAGGA
GCTGCTTCCCAATAAGGAAACAGCCCAGACCGAGCCATAATTCCAGAAATGGAGTGGACGAGCCAGGCCCTGCTGACAGTGGACATAGTT
GACTCAGGGAACCTAGTCGAAATCACCGTTTTCGGGCGGCCCCGTGTACAGAATCGGGTGAAGAGCATGCTCCTGTGCCTGGCATGGTTT
CACCGAGAACATCGTGCCCGAGCTGAGAAGATGAAACACCTTGAGAAGAACTTGAAGGCCCATGCATCAGACCCCCACTCTCCCCAGGAT
CCTGTTGCTTAAGACAACATAGTTACTGTTGGGAACATCTTAACTTTCTAACTTTTGCTGCTAAAGTTGAAGAAAAGCAAGTATAGCATT
CTTAAATCCCCGTATTCCTTTTTCCTGTGTCTTGATGGATTGTGGTTTATTTTGTTGCAAGAGTGAGTTTGAACTATTCTAATAAAGAAA

>In-frame_RERE_ENST00000400908_chr1_8482787_-_OOEP_ENST00000370359_chr6_74079108_-_2200nt
CACAGACGCTCGCGAGCAACCCTCCGCGCTCCGGAGCCTCCTCAGCCTCCCGCACACCCCGAGACGCTCGCCCCGCTGGGCCTCGGTCCC
CGCCTCCTCCCCCGTCCTTTTCCCCTCTCTCGCTCCCCACATTGTCTCTGCCTCATTTTCTCTCCTAGTTGAGGATTAAAAAAAAAAAAA
AATCACCATCATCCTCAGGGAGCCCCCTCGCCCTCGGAAAACAAAACCAGACATGATCCTGGGCTCCTGCTTCTGAAAGATCTGCCCGAC
CGAGGAGGAGGGAGCCTAGGTTCAAGTCGCAGGAAAGGTCACGGCAGGGAAGCCCCCTCAGCCCCTCCGCGTCGCCTCCCCGCGGGCCGC
CCCTCTCGGCCCTGCGCCCCGCGGCCCCGCAGCCTCCGCGCGGCCTCCCGCCCCATCCCCGCCACTTTCCCCGGAGCTGGGCCGCGAACA
CCTCACTATTGATGGTGTAGCGCTTTAGGGGAAGCATTTTTGAAACGTTGGGGTTGTTGGAGTGGTTGGATTTTCCCTGGAATTGAGTGA
GAAATTCAGAAGACTGAAGCCCAGGCTTACTGTCTACCTTTCACGGAGGCCTAGCCGTGAGAGGACAGAAGAAGGCACGTGGCGAATCAT
GACAGCGGACAAAGACAAAGACAAAGACAAAGAGAAGGACCGGGACCGAGACCGGGACCGAGAGAGAGAGAAAAGAGACAAAGCAAGAGA
GAGTGAGAATTCAAGGCCACGCCGGAGCTGTACCTTGGAAGGAGGAGCCAAAAATTATGCTGAGAGTGATCACAGTGAAGACGAGGACAA
TGACAACAATAGTGCCACCGCAGAGGAGTCCACGAAGAAGAATAAGAAGAAACCACCGAAAAAAAAGTCTCGTTATGAAAGGACAGATAC
CGGTGAGATAACATCCTACATCACTGAAGATGATGTGGTCTACAGACCAGGAGACTGTGTGTATATCGAGAGTCGGAGGCCAAACACACC
GTATTTCATCTGTAGCATTCAAGACTTCAAACTGGTCCACAACTCCCAGGCCTGTTGCAGATCTCCAACTCCTGCTTTGTGTGACCCCCC
AGCATGCTCTCTGCCGGTGGCATCACAGCCACCACAGCATCTTTCTGAAGCCGGGAGAGGGCCTGTAGGGAGTAAGAGGGACCATCTCCT
CATGAACGTCAAATGGTACTACCGTCAATCTGAGGTTCCAGATTCTGTGTATCAGCATTTGGTTCAGGATCGACATAATGAAAATGACTC
TGGAAGAGAACTTGTCATTACAGACCCAGTTATCAAGAACCGAGAGCTCTTCATTTCTGATTACGTTGACACTTACCATGCTGCTGCCCT
TAGAGGGAAGTGTAACATCTCCCATTTTTCTGACATATTTGCTGCTAGAGAGTTTAAAGCCCGAGTGGATTCATTTTTCTACATATTAGG
ATATAACCCTGAGACAAGGAGGCTGAACAGTACCCAGGGGGAGATTCGTGTCGGTCCTAGTCATCAGGCCAAACTTCCAGATCTGCAACC
ATTTCCTTCTCCAGATGGTGATACAGTGACCCAACATGAGGAACTGGTCTGGATGCCTGGAGTTAACGACTGTGACCTCCTTATGTACTT
GAGGGCAGCAAGGAGCATGGCGGCATTTGCAGGAATGTGTGATGGAGGCTCTACAGAGGACGGCTGTGTCGCAGCCTCTCGGGATGACAC
CACTCTGAATGCACTGAACACACTGCATGAAAGCGGTTACGATGCTGGCAAAGCCCTGCAGCGCCTGGTGAAGAAGCCTGTGCCCAAGCT
CATCGAGAAGTGCTGGACCGAGGACGAAGTGAAACGCTTCGTTAAGGGACTCAGGCAGTACGGGAAGAACTTCTTCAGAATTAGAAAGGA
GCTGCTTCCCAATAAGGAAACAGCCCAGACCGAGCCATAATTCCAGAAATGGAGTGGACGAGCCAGGCCCTGCTGACAGTGGACATAGTT
GACTCAGGGAACCTAGTCGAAATCACCGTTTTCGGGCGGCCCCGTGTACAGAATCGGGTGAAGAGCATGCTCCTGTGCCTGGCATGGTTT
CACCGAGAACATCGTGCCCGAGCTGAGAAGATGAAACACCTTGAGAAGAACTTGAAGGCCCATGCATCAGACCCCCACTCTCCCCAGGAT


Top

FusionGenePPI for RERE_OOEP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
REREATN1, LZTR1, NR2E1, HDAC1, HDAC2, EHMT2, HIST2H3C, ELAVL1, KRTAP4-12, PLSCR1, TRIM22, CBFA2T2, EFEMP2, ZMYND8, PSMA3, PRRC2A, ALG13, ECM1, EFEMP1, PRRC2B, KAT6A, RBFOX2, WDR5, EP300, AUTS2, FBXW7, CDO1, TRIM25OOEP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RERE_OOEP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for RERE_OOEP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneREREC3495559Juvenile arthritis1CTD_human