FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30944

FusionGeneSummary for REL_KIAA1841

check button Fusion gene summary
Fusion gene informationFusion gene name: REL_KIAA1841
Fusion gene ID: 30944
HgeneTgene
Gene symbol

REL

KIAA1841

Gene ID

5966

84542

Gene nameREL proto-oncogene, NF-kB subunitKIAA1841
SynonymsC-Rel-
Cytomap

2p16.1

2p15

Type of geneprotein-codingprotein-coding
Descriptionproto-oncogene c-Reloncogene REL, avian reticuloendotheliosisv-rel avian reticuloendotheliosis viral oncogene homologuncharacterized protein KIAA1841
Modification date2018052320180519
UniProtAcc

Q04864

Q6NSI8

Ensembl transtripts involved in fusion geneENST00000295025, ENST00000394479, 
ENST00000402291, ENST00000356719, 
ENST00000295031, ENST00000453873, 
ENST00000482513, 
Fusion gene scores* DoF score5 X 5 X 4=1007 X 5 X 5=175
# samples 58
** MAII scorelog2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/175*10)=-1.12928301694497
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: REL [Title/Abstract] AND KIAA1841 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneREL

GO:0010629

negative regulation of gene expression

22065573

HgeneREL

GO:0032688

negative regulation of interferon-beta production

22065573

HgeneREL

GO:0045944

positive regulation of transcription by RNA polymerase II

1406630


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDCOADTCGA-D5-6932-01ARELchr2

61145741

+KIAA1841chr2

61343114

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000295025ENST00000402291RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000295025ENST00000356719RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000295025ENST00000295031RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000295025ENST00000453873RELchr2

61145741

+KIAA1841chr2

61343114

+
5CDS-intronENST00000295025ENST00000482513RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000394479ENST00000402291RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000394479ENST00000356719RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000394479ENST00000295031RELchr2

61145741

+KIAA1841chr2

61343114

+
In-frameENST00000394479ENST00000453873RELchr2

61145741

+KIAA1841chr2

61343114

+
5CDS-intronENST00000394479ENST00000482513RELchr2

61145741

+KIAA1841chr2

61343114

+

Top

FusionProtFeatures for REL_KIAA1841


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
REL

Q04864

KIAA1841

Q6NSI8

Proto-oncogene that may play a role in differentiationand lymphopoiesis. NF-kappa-B is a pleiotropic transcriptionfactor which is present in almost all cell types and is involvedin many biological processed such as inflammation, immunity,differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-likedomain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50,REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA oftheir target genes and the individual dimers have distinctpreferences for different kappa-B sites that they can bind withdistinguishable affinity and specificity. Different dimercombinations act as transcriptional activators or repressors,respectively. NF-kappa-B is controlled by various mechanisms ofpost-translational modification and subcellularcompartmentalization as well as by interactions with othercofactors or corepressors. NF-kappa-B complexes are held in thecytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activationpathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs)in response to different activators, subsequently degraded thusliberating the active NF-kappa-B complex which translocates to thenucleus. The NF-kappa-B heterodimer RELA/p65-c-Rel is atranscriptional activator.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneRELchr2:61145741chr2:61343114ENST00000295025+7118_297284620DomainRHD
HgeneRELchr2:61145741chr2:61343114ENST00000295025+711290_295284620MotifNuclear localization signal


Top

FusionGeneSequence for REL_KIAA1841


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_411aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_411aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_422aa
MASGATNPTIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNTTGKGKVRITLVTKNDPTKPHPHDLVGKDCRDGYTE
AEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPITDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPTCKAITEPVTVKMQLRRPSDQE
VSESMDFRTLPDEKGKKEKPKKFTRQPKKQVSSPCAQRKEKALEKSASRDVSPFVMSMQKNKWDATRSLRFNQDAQREDDQRRMTEITGH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_1233nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAAACAGACAAACTGAGACCCAGAGACGGCACTGTG

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_1233nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAAACAGACAAACTGAGACCCAGAGACGGCACTGTG

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_1266nt
ATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGA
TCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAA
GTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAA
GCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATT
ACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTG
TGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCT
CCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAA
GTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTA
GCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAA
GTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAG
GTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAG
AATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCAC
CTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCA
CAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_3704nt
AGCCGCGGGAAATTCCCCTCCCGCCAGGCTGCTCGCCTCTCGGCTGGGCCAGCACTCGGCTCTCCCCGCTCCGCCCCCTGCCCCTGGCTC
CCGTACGGTGGACGGCGACGCTGGGTGACCCGGGGTGCAAGAATTCAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGA
AGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGCCGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCT
CCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTG
AACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC
CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAA
ATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTG
AAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGA
CGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGA
ATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACG
ATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCA
CAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAA
AAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGG
AGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGG
ATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGT
CAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCA
GCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCTGCATAAAGTACCTTAAAATATAAGTAAAAAGAGAGAAGGC
ACTCTTCTGGACATCTGAAATTGCTCACTTCTTGAAGATCTTCAGAACAATGACTTCCAACTGTTTTATGTTATTATTATTTTAATCCAC
ATAAATCATAATTCTAAAAGAAATGCATAGTTAGGTTTTATGAAAATCTAATTGTAAATATGAAACTTTTTAAATCTGATTTTCTTCTAA
TATCATTCTAGGCTATGTAGAAAGCAATTATTTACAAATTTGCATAGTTGAGACTCCCAGTGTTTTCCTTTATTTATTTGAAAAAGAAAG
GCCTAAACTGTCAGGTAGCCAAGTTTTTTTAAGACCTTAAAAGTTAGGGGAACACAACTGGTAGTGTTACCATGCATGGCACTGATTGTA
GTATGTCTTTGGAGCTGTAAATCTTGAGATAGCATTGAGAACTGCAGGTTGTGTGACGAAATTCCCAATGATGCTAATTTTAAGTCTGCA
TGAATATTAAGGAGTGACAGGTCTCAAGACTGCATTAAATGAAGTTTCAGGGTAAGGTATTTCAGTACTGTGTTGGGCAGAAGGGTTAAT
TTTTTTCAGCATTATATCGTGGAAAGTACAATGTTAATCCAACTTTTTTTTCTTTCAGTTTTTAATGCTTATCTATTGATCATCTGAGCT
GGAATTACTGATTATTACTCTGTCCTCTGTGAAACTAGTGGCATTCTGAATTTGGTAAAATAACCATTGATAGTTTTAGGATAGTAAATC
ATTTCTGTTATATGAGACACCCACTGTACAGTTCTCAGGGCTCTAAAACCCAACCATATTTCTGTAACCATTCAAATAACTCCTTAAAAC
AGTTATACTTGCTAGTTCGGTCTAAAATTTTCCAAATACATTAGATAGGTGAAAATTTGCATATATTCAAGAAAAATCAAAATAAAATTC
TATTTTATAAATCATGTTTAAATTTTTCTAGCCAGGCAGAAAGAGTGCTCAGGGAAAATTTGTTCCAAACTATAACCATATAATAAATTA
TGTGTTTGTAAATTATATGTAGGTCTCTGAAAAACTTTAAGATGCACTGTTTCTATTTTTTTAAGTCTTAATTTGCCTTATAACTGACAT
TTCTTCAAATTATTCAGAGAACAGACTTTAATAATGTGTGACAAAAGAGCAATTTCCATTGAAATATTGAAGTGTTACACTCAGTTTACA
CGTACAGAAATCATTCTTTTTAGTGAGTCTTTTAGTTGATAAATGAAGCTAGATGTTATTTGATAACTGGCTTTGCCAAGGTTTTTGAAC
TGCTGTTTAGAAATTTTGTTCCCATTTATATTTGTTTCAATTGTTTGATACTGTGGAAATAGACTTTTATTTTCGAAAGAAAATGTCTTG
TAGTACATATTATATGTAAGTACTCTGTTAAATACCAGAGTTTTTTTTGTAGTTTACTGTGTTTTCTGATTAAAGGATTTGGATTTGTAC
ATGTAAACAGTGCTGTAATGGTCACGACTAGATAAGGAAAAAATATATATGCTCTTTTGATTTTTAACTGATGGTAAAAAGGCAAACTGC
TTCTCCCCTGGGAGGCCTATACCACTGAATTAATTTTTACAAACCAGAGTTTATCAGAATTTGATTCTCTTCAGAATGCTTTTGGCCAGG
TGTAGTGGCTCACGCCAGTAATCCCAGCACTTTGGGAGGCCGAGGCGGGCAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAA
CGTGGTGAAACCCTATCTCTACTAAAAATACAAAAAGATTAGCCAGGCATGGTGGCATACACCTGTAGTCCCAGCTACTCGGGAGGCTGA
GGCACAAGAATTGTTTGAACCCGGGTGGCAGAGGTTGCAGTGAGCTGAGATCATGTTTCTGCGCTCCTAGCCTGGGTGACAGAGCAAGAC
TCCATCTCAATTTAAAACAAAAAAAGAATGTGTTTTTAATTTTGTTAATGTTTGTCTGTTATACATAGCACTGGTACCGCAAACATTTTA
CTTAAACTCTTAATAGCATTTCTTTCGCCAGATACTTTAATATTTCACCTTACATTAATCCTGGATTCACATTTCTTTAATTGAAATAAA

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_1586nt
AGCCGCGGGAAATTCCCCTCCCGCCAGGCTGCTCGCCTCTCGGCTGGGCCAGCACTCGGCTCTCCCCGCTCCGCCCCCTGCCCCTGGCTC
CCGTACGGTGGACGGCGACGCTGGGTGACCCGGGGTGCAAGAATTCAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGA
AGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGCCGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCT
CCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTG
AACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC
CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAA
ATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTG
AAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGA
CGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGA
ATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACG
ATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCA
CAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAA
AAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGG
AGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGG
ATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGT
CAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCA

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_2168nt
AGCCGCGGGAAATTCCCCTCCCGCCAGGCTGCTCGCCTCTCGGCTGGGCCAGCACTCGGCTCTCCCCGCTCCGCCCCCTGCCCCTGGCTC
CCGTACGGTGGACGGCGACGCTGGGTGACCCGGGGTGCAAGAATTCAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGA
AGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGCCGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCT
CCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTG
AACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC
CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAA
ATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTG
AAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGA
CGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGA
ATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACG
ATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCA
CAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAA
AAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGG
AGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGG
ATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGT
CAAAGGAAGCAAAAGAAACAGACAAACTGAGACCCAGAGACGGCACTGTGTCTAAGAGCAACAGAAAAAGTGGTTTGAGCAGTGTGCTCT
TGATGACAGTGTTGCTGTGTTAAACGAATTAATACATGAAAGGACTTGGAATACTGCTTGACATATCGTGAGGCAGAGACACAAAGATAT
GGAAGAACATTGGACAGATTTACATCGATATATTAATTAAGGTGATTTCAGAGTTGGAGCAGGAGAGGAAGCCTTATAGATATTTTTTTT
TCTTTTTGCTTGCTTGTATTTTCTTTTTAATTATTATTCAGTATTTCAAGTAGACAGAAAAGTACAGAGGATAATACAACAAATATCCAG
GTACCCACCACCCAGCATTTTTACATAGTAGCATTTGATGTTTTGAAATAAGACATAAAACATTCCAAATACCCTATCACCGAGGATCCT
GCATCCTCTTCTTTTCCCAGAAGTGAACATTTCTCTGAATTTGATGCTTATTATGCCCATGCATGTTGTTATACTTTTACTACATATTTT
ATGTAGCTACAGCATAATATGCTATGTTTACTTTATATAGTGACCTCATACTATACATATCCTCATGCAATTTTTTAGACTCTGTTTGAG
AATTATATATTTTGATTCAGGTAGCTTAAGTTTATTTTAGCTACTCAGTAGTAATGTATTCTATTAATCTACTAATATATATTTCTTGTC

>In-frame_REL_ENST00000295025_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_3698nt
AGCCGCGGGAAATTCCCCTCCCGCCAGGCTGCTCGCCTCTCGGCTGGGCCAGCACTCGGCTCTCCCCGCTCCGCCCCCTGCCCCTGGCTC
CCGTACGGTGGACGGCGACGCTGGGTGACCCGGGGTGCAAGAATTCAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGA
AGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGCCGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCT
CCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCGGAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTG
AACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAGGGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACA
ACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAGGAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAAC
CTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACTATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAA
ATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTATTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTG
AAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGAGACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGA
CGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACCGTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGA
ATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTGACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACG
ATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTCAAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCA
CAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACCAGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAA
AAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAAAGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGG
AGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGCAGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGG
ATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAGGGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGT
CAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGGAAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCA
GCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGCGTCCTGCATAAAGTACCTTAAAATATAAGTAAAAAGAGAGAAGGC
ACTCTTCTGGACATCTGAAATTGCTCACTTCTTGAAGATCTTCAGAACAATGACTTCCAACTGTTTTATGTTATTATTATTTTAATCCAC
ATAAATCATAATTCTAAAAGAAATGCATAGTTAGGTTTTATGAAAATCTAATTGTAAATATGAAACTTTTTAAATCTGATTTTCTTCTAA
TATCATTCTAGGCTATGTAGAAAGCAATTATTTACAAATTTGCATAGTTGAGACTCCCAGTGTTTTCCTTTATTTATTTGAAAAAGAAAG
GCCTAAACTGTCAGGTAGCCAAGTTTTTTTAAGACCTTAAAAGTTAGGGGAACACAACTGGTAGTGTTACCATGCATGGCACTGATTGTA
GTATGTCTTTGGAGCTGTAAATCTTGAGATAGCATTGAGAACTGCAGGTTGTGTGACGAAATTCCCAATGATGCTAATTTTAAGTCTGCA
TGAATATTAAGGAGTGACAGGTCTCAAGACTGCATTAAATGAAGTTTCAGGGTAAGGTATTTCAGTACTGTGTTGGGCAGAAGGGTTAAT
TTTTTTCAGCATTATATCGTGGAAAGTACAATGTTAATCCAACTTTTTTTTCTTTCAGTTTTTAATGCTTATCTATTGATCATCTGAGCT
GGAATTACTGATTATTACTCTGTCCTCTGTGAAACTAGTGGCATTCTGAATTTGGTAAAATAACCATTGATAGTTTTAGGATAGTAAATC
ATTTCTGTTATATGAGACACCCACTGTACAGTTCTCAGGGCTCTAAAACCCAACCATATTTCTGTAACCATTCAAATAACTCCTTAAAAC
AGTTATACTTGCTAGTTCGGTCTAAAATTTTCCAAATACATTAGATAGGTGAAAATTTGCATATATTCAAGAAAAATCAAAATAAAATTC
TATTTTATAAATCATGTTTAAATTTTTCTAGCCAGGCAGAAAGAGTGCTCAGGGAAAATTTGTTCCAAACTATAACCATATAATAAATTA
TGTGTTTGTAAATTATATGTAGGTCTCTGAAAAACTTTAAGATGCACTGTTTCTATTTTTTTAAGTCTTAATTTGCCTTATAACTGACAT
TTCTTCAAATTATTCAGAGAACAGACTTTAATAATGTGTGACAAAAGAGCAATTTCCATTGAAATATTGAAGTGTTACACTCAGTTTACA
CGTACAGAAATCATTCTTTTTAGTGAGTCTTTTAGTTGATAAATGAAGCTAGATGTTATTTGATAACTGGCTTTGCCAAGGTTTTTGAAC
TGCTGTTTAGAAATTTTGTTCCCATTTATATTTGTTTCAATTGTTTGATACTGTGGAAATAGACTTTTATTTTCGAAAGAAAATGTCTTG
TAGTACATATTATATGTAAGTACTCTGTTAAATACCAGAGTTTTTTTTGTAGTTTACTGTGTTTTCTGATTAAAGGATTTGGATTTGTAC
ATGTAAACAGTGCTGTAATGGTCACGACTAGATAAGGAAAAAATATATATGCTCTTTTGATTTTTAACTGATGGTAAAAAGGCAAACTGC
TTCTCCCCTGGGAGGCCTATACCACTGAATTAATTTTTACAAACCAGAGTTTATCAGAATTTGATTCTCTTCAGAATGCTTTTGGCCAGG
TGTAGTGGCTCACGCCAGTAATCCCAGCACTTTGGGAGGCCGAGGCGGGCAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAA
CGTGGTGAAACCCTATCTCTACTAAAAATACAAAAAGATTAGCCAGGCATGGTGGCATACACCTGTAGTCCCAGCTACTCGGGAGGCTGA
GGCACAAGAATTGTTTGAACCCGGGTGGCAGAGGTTGCAGTGAGCTGAGATCATGTTTCTGCGCTCCTAGCCTGGGTGACAGAGCAAGAC
TCCATCTCAATTTAAAACAAAAAAAGAATGTGTTTTTAATTTTGTTAATGTTTGTCTGTTATACATAGCACTGGTACCGCAAACATTTTA
CTTAAACTCTTAATAGCATTTCTTTCGCCAGATACTTTAATATTTCACCTTACATTAATCCTGGATTCACATTTCTTTAATTGAAATAAA

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000402291_chr2_61343114_+_3569nt
CAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGAAGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGC
CGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCTCCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCG
GAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAG
GGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAG
GAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACT
ATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTA
TTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGA
GACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACC
GTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTG
ACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTC
AAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACC
AGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAA
AGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGC
AGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAG
GGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGG
AAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGC
GTCCTGCATAAAGTACCTTAAAATATAAGTAAAAAGAGAGAAGGCACTCTTCTGGACATCTGAAATTGCTCACTTCTTGAAGATCTTCAG
AACAATGACTTCCAACTGTTTTATGTTATTATTATTTTAATCCACATAAATCATAATTCTAAAAGAAATGCATAGTTAGGTTTTATGAAA
ATCTAATTGTAAATATGAAACTTTTTAAATCTGATTTTCTTCTAATATCATTCTAGGCTATGTAGAAAGCAATTATTTACAAATTTGCAT
AGTTGAGACTCCCAGTGTTTTCCTTTATTTATTTGAAAAAGAAAGGCCTAAACTGTCAGGTAGCCAAGTTTTTTTAAGACCTTAAAAGTT
AGGGGAACACAACTGGTAGTGTTACCATGCATGGCACTGATTGTAGTATGTCTTTGGAGCTGTAAATCTTGAGATAGCATTGAGAACTGC
AGGTTGTGTGACGAAATTCCCAATGATGCTAATTTTAAGTCTGCATGAATATTAAGGAGTGACAGGTCTCAAGACTGCATTAAATGAAGT
TTCAGGGTAAGGTATTTCAGTACTGTGTTGGGCAGAAGGGTTAATTTTTTTCAGCATTATATCGTGGAAAGTACAATGTTAATCCAACTT
TTTTTTCTTTCAGTTTTTAATGCTTATCTATTGATCATCTGAGCTGGAATTACTGATTATTACTCTGTCCTCTGTGAAACTAGTGGCATT
CTGAATTTGGTAAAATAACCATTGATAGTTTTAGGATAGTAAATCATTTCTGTTATATGAGACACCCACTGTACAGTTCTCAGGGCTCTA
AAACCCAACCATATTTCTGTAACCATTCAAATAACTCCTTAAAACAGTTATACTTGCTAGTTCGGTCTAAAATTTTCCAAATACATTAGA
TAGGTGAAAATTTGCATATATTCAAGAAAAATCAAAATAAAATTCTATTTTATAAATCATGTTTAAATTTTTCTAGCCAGGCAGAAAGAG
TGCTCAGGGAAAATTTGTTCCAAACTATAACCATATAATAAATTATGTGTTTGTAAATTATATGTAGGTCTCTGAAAAACTTTAAGATGC
ACTGTTTCTATTTTTTTAAGTCTTAATTTGCCTTATAACTGACATTTCTTCAAATTATTCAGAGAACAGACTTTAATAATGTGTGACAAA
AGAGCAATTTCCATTGAAATATTGAAGTGTTACACTCAGTTTACACGTACAGAAATCATTCTTTTTAGTGAGTCTTTTAGTTGATAAATG
AAGCTAGATGTTATTTGATAACTGGCTTTGCCAAGGTTTTTGAACTGCTGTTTAGAAATTTTGTTCCCATTTATATTTGTTTCAATTGTT
TGATACTGTGGAAATAGACTTTTATTTTCGAAAGAAAATGTCTTGTAGTACATATTATATGTAAGTACTCTGTTAAATACCAGAGTTTTT
TTTGTAGTTTACTGTGTTTTCTGATTAAAGGATTTGGATTTGTACATGTAAACAGTGCTGTAATGGTCACGACTAGATAAGGAAAAAATA
TATATGCTCTTTTGATTTTTAACTGATGGTAAAAAGGCAAACTGCTTCTCCCCTGGGAGGCCTATACCACTGAATTAATTTTTACAAACC
AGAGTTTATCAGAATTTGATTCTCTTCAGAATGCTTTTGGCCAGGTGTAGTGGCTCACGCCAGTAATCCCAGCACTTTGGGAGGCCGAGG
CGGGCAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACGTGGTGAAACCCTATCTCTACTAAAAATACAAAAAGATTAGCCA
GGCATGGTGGCATACACCTGTAGTCCCAGCTACTCGGGAGGCTGAGGCACAAGAATTGTTTGAACCCGGGTGGCAGAGGTTGCAGTGAGC
TGAGATCATGTTTCTGCGCTCCTAGCCTGGGTGACAGAGCAAGACTCCATCTCAATTTAAAACAAAAAAAGAATGTGTTTTTAATTTTGT
TAATGTTTGTCTGTTATACATAGCACTGGTACCGCAAACATTTTACTTAAACTCTTAATAGCATTTCTTTCGCCAGATACTTTAATATTT

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000356719_chr2_61343114_+_1451nt
CAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGAAGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGC
CGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCTCCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCG
GAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAG
GGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAG
GAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACT
ATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTA
TTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGA
GACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACC
GTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTG
ACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTC
AAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACC
AGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAA
AGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGC
AGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAG
GGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGG
AAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGC

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000295031_chr2_61343114_+_2033nt
CAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGAAGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGC
CGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCTCCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCG
GAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAG
GGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAG
GAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACT
ATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTA
TTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGA
GACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACC
GTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTG
ACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTC
AAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACC
AGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAA
AGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGC
AGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAG
GGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAAACAGACAAACTGAGACCCAGAGACGGCA
CTGTGTCTAAGAGCAACAGAAAAAGTGGTTTGAGCAGTGTGCTCTTGATGACAGTGTTGCTGTGTTAAACGAATTAATACATGAAAGGAC
TTGGAATACTGCTTGACATATCGTGAGGCAGAGACACAAAGATATGGAAGAACATTGGACAGATTTACATCGATATATTAATTAAGGTGA
TTTCAGAGTTGGAGCAGGAGAGGAAGCCTTATAGATATTTTTTTTTCTTTTTGCTTGCTTGTATTTTCTTTTTAATTATTATTCAGTATT
TCAAGTAGACAGAAAAGTACAGAGGATAATACAACAAATATCCAGGTACCCACCACCCAGCATTTTTACATAGTAGCATTTGATGTTTTG
AAATAAGACATAAAACATTCCAAATACCCTATCACCGAGGATCCTGCATCCTCTTCTTTTCCCAGAAGTGAACATTTCTCTGAATTTGAT
GCTTATTATGCCCATGCATGTTGTTATACTTTTACTACATATTTTATGTAGCTACAGCATAATATGCTATGTTTACTTTATATAGTGACC
TCATACTATACATATCCTCATGCAATTTTTTAGACTCTGTTTGAGAATTATATATTTTGATTCAGGTAGCTTAAGTTTATTTTAGCTACT

>In-frame_REL_ENST00000394479_chr2_61145741_+_KIAA1841_ENST00000453873_chr2_61343114_+_3563nt
CAGGGGTTGGGAAGGTGTGAGCCGCAAACCCAGCGGAGGGCGGGAAGAAGGAGGAGGCCTCTAGGGTGGTCGGGGGACTGGGGGCCCCGC
CGGCAGAGGTCCCTCGGCCTCCTGACTGACTGACTGCGGCCGCCTCCGGCCAGGACGCTGGGAGCTGCCTGCGGGAAGGTGCGGGGAGCG
GAGCCATGGCCTCCGGTGCGTATAACCCGTATATAGAGATAATTGAACAACCCAGGCAGAGGGGAATGCGTTTTAGATACAAATGTGAAG
GGCGATCAGCAGGCAGCATTCCAGGGGAGCACAGCACAGACAACAACCGAACATACCCTTCTATCCAGATTATGAACTATTATGGAAAAG
GAAAAGTGAGAATTACATTAGTAACAAAGAATGACCCATATAAACCTCATCCTCATGATTTAGTTGGAAAAGACTGCAGAGACGGCTACT
ATGAAGCAGAATTTGGACAAGAACGCAGACCTTTGTTTTTCCAAAATTTGGGTATTCGATGTGTGAAGAAAAAAGAAGTAAAAGAAGCTA
TTATTACAAGAATAAAGGCAGGAATCAATCCATTCAATGTCCCTGAAAAACAGCTGAATGATATTGAAGATTGTGACCTCAATGTGGTGA
GACTGTGTTTTCAAGTTTTTCTCCCTGATGAACATGGTAATTTGACGACTGCTCTTCCTCCTGTTGTCTCGAACCCAATTTATGACAACC
GTGCTCCAAATACTGCAGAATTAAGGATTTGTCGTGTAAACAAGAATTGTGGAAGTGTCAGAGGAGGAGATGAAATATTTCTACTTTGTG
ACAAAGTTCAGAAAGATGACATAGAAGTTCGTTTTGTGTTGAACGATTGGGAAGCAAAAGGCATCTTTTCACAAGCTGATGTACACCGTC
AAGTAGCCATTGTTTTCAAAACTCCACCATATTGCAAAGCTATCACAGAACCCGTAACAGTAAAAATGCAGTTGCGGAGACCTTCTGACC
AGGAAGTTAGTGAATCTATGGATTTTAGATATCTGCCAGATGAAAAAGGGAAAAAGGAGAAGCCAAAGAAGTTCACTAGACAACCAAAAA
AGCAGGTATCTTCACCCTGTGCCCAGAGGAAAGAAAAGGCATTGGAGAAGTCAGCTTCTAGAGATGTGTCTCCTTTCGTTATGAGTATGC
AGAAGAATAAGTGGGATGCCACAAGATCCTTGAGATTCAACCAGGATGCACAAAGAGAAGACGATCAACGGCGAATGACTGAAATTACAG
GGCACCTAATAAAAATGAGATTGGGGGATCTGGACCGAGTCAAGTCAAAGGAAGCAAAAGAATTTGCAGGAGGTATTTATTCCAGGCTGG
AAGCACAAATCAAGGCCTCAGTGCCAGTTAGTGCACGCCAAAGCAGCTCAGAGAAAAACACAAGGTCTAAAAGTCGTTTTGGTCAAGGGC
GTCCTGCATAAAGTACCTTAAAATATAAGTAAAAAGAGAGAAGGCACTCTTCTGGACATCTGAAATTGCTCACTTCTTGAAGATCTTCAG
AACAATGACTTCCAACTGTTTTATGTTATTATTATTTTAATCCACATAAATCATAATTCTAAAAGAAATGCATAGTTAGGTTTTATGAAA
ATCTAATTGTAAATATGAAACTTTTTAAATCTGATTTTCTTCTAATATCATTCTAGGCTATGTAGAAAGCAATTATTTACAAATTTGCAT
AGTTGAGACTCCCAGTGTTTTCCTTTATTTATTTGAAAAAGAAAGGCCTAAACTGTCAGGTAGCCAAGTTTTTTTAAGACCTTAAAAGTT
AGGGGAACACAACTGGTAGTGTTACCATGCATGGCACTGATTGTAGTATGTCTTTGGAGCTGTAAATCTTGAGATAGCATTGAGAACTGC
AGGTTGTGTGACGAAATTCCCAATGATGCTAATTTTAAGTCTGCATGAATATTAAGGAGTGACAGGTCTCAAGACTGCATTAAATGAAGT
TTCAGGGTAAGGTATTTCAGTACTGTGTTGGGCAGAAGGGTTAATTTTTTTCAGCATTATATCGTGGAAAGTACAATGTTAATCCAACTT
TTTTTTCTTTCAGTTTTTAATGCTTATCTATTGATCATCTGAGCTGGAATTACTGATTATTACTCTGTCCTCTGTGAAACTAGTGGCATT
CTGAATTTGGTAAAATAACCATTGATAGTTTTAGGATAGTAAATCATTTCTGTTATATGAGACACCCACTGTACAGTTCTCAGGGCTCTA
AAACCCAACCATATTTCTGTAACCATTCAAATAACTCCTTAAAACAGTTATACTTGCTAGTTCGGTCTAAAATTTTCCAAATACATTAGA
TAGGTGAAAATTTGCATATATTCAAGAAAAATCAAAATAAAATTCTATTTTATAAATCATGTTTAAATTTTTCTAGCCAGGCAGAAAGAG
TGCTCAGGGAAAATTTGTTCCAAACTATAACCATATAATAAATTATGTGTTTGTAAATTATATGTAGGTCTCTGAAAAACTTTAAGATGC
ACTGTTTCTATTTTTTTAAGTCTTAATTTGCCTTATAACTGACATTTCTTCAAATTATTCAGAGAACAGACTTTAATAATGTGTGACAAA
AGAGCAATTTCCATTGAAATATTGAAGTGTTACACTCAGTTTACACGTACAGAAATCATTCTTTTTAGTGAGTCTTTTAGTTGATAAATG
AAGCTAGATGTTATTTGATAACTGGCTTTGCCAAGGTTTTTGAACTGCTGTTTAGAAATTTTGTTCCCATTTATATTTGTTTCAATTGTT
TGATACTGTGGAAATAGACTTTTATTTTCGAAAGAAAATGTCTTGTAGTACATATTATATGTAAGTACTCTGTTAAATACCAGAGTTTTT
TTTGTAGTTTACTGTGTTTTCTGATTAAAGGATTTGGATTTGTACATGTAAACAGTGCTGTAATGGTCACGACTAGATAAGGAAAAAATA
TATATGCTCTTTTGATTTTTAACTGATGGTAAAAAGGCAAACTGCTTCTCCCCTGGGAGGCCTATACCACTGAATTAATTTTTACAAACC
AGAGTTTATCAGAATTTGATTCTCTTCAGAATGCTTTTGGCCAGGTGTAGTGGCTCACGCCAGTAATCCCAGCACTTTGGGAGGCCGAGG
CGGGCAGATCACCTGAGGTCAGGAGTTTGAGACCAGCCTGGCCAACGTGGTGAAACCCTATCTCTACTAAAAATACAAAAAGATTAGCCA
GGCATGGTGGCATACACCTGTAGTCCCAGCTACTCGGGAGGCTGAGGCACAAGAATTGTTTGAACCCGGGTGGCAGAGGTTGCAGTGAGC
TGAGATCATGTTTCTGCGCTCCTAGCCTGGGTGACAGAGCAAGACTCCATCTCAATTTAAAACAAAAAAAGAATGTGTTTTTAATTTTGT
TAATGTTTGTCTGTTATACATAGCACTGGTACCGCAAACATTTTACTTAAACTCTTAATAGCATTTCTTTCGCCAGATACTTTAATATTT


Top

FusionGenePPI for REL_KIAA1841


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RELPPP4C, MAP3K8, PAPOLA, RELA, NFKB1, NFKB2, TBK1, TNIP2, NFKBIE, ELF1, SRF, TBP, GTF2B, SP1, NKRF, MTPN, MAPK8, NFKBIA, NFKBIB, CDK2, CREBBP, EP300, FOXP3, DPF2, HSPA4, COMMD1, SOCS3, CXCL14, AAAS, CLIC4, TMEM165, C9orf91, AR, ADRB2, ADSL, ARNT2, BZRAP1, DGCR6, FHIT, MVP, NDE1, PARK2, PRKAB2, TDO2, ACTN3, AES, ALOX5, BID, SEPT7, CDKN2C, CKS1B, COL8A1, DHPS, DNTT, EIF4EBP1, EIF5A, EPHB6, FHL2, FKBP1B, FLNA, GRB2, HIP1, UBE2K, HLA-DOA, LASP1, LMO1, LMO2, LNPEP, FOXO4, NEDD9, NUCB1, PLCB4, POLE2, POLR2L, PSMA1, PTGER3, PTK6, RABIF, SAT1, ATXN1, SDCBP, SLC6A12, RECK, NCK2, HAT1, CGGBP1, STK16, EIF3A, EIF3D, EIF4E2, RBM39, KIAA0100, EPM2AIP1, ACOT8, CHAF1A, TSSC4, ARIH2, MAD2L2, GADD45G, MORF4L1, EXOSC8, R3HDM2, SEC31A, SZT2, TENC1, DAAM2, EML2, POLR1A, NDUFAF3, NECAP1, IL36RN, OSTF1, HSPB7, RSPH14, CPSF1, NME7, OSGIN1, A1CF, NEUROG3, EXOSC1, MEMO1, CHCHD2, DYNC1LI1, POP5, CINP, HDAC7, OAZ3, TRAPPC2L, UBASH3A, OTUD4, TTC19, SLC41A3, C1orf109, TXNL4B, MAGOHB, NAGK, ASAP3, NXT2, CABP5, EIF5A2, LGALS14, AGPAT4, MAP3K7CL, EXOSC5, PRDM10, CTNNBIP1, COL20A1, RNF213, LSM2, NGB, DMRT3, TMEM8A, PARVG, UBE2Z, OTUB2, C20orf195, ATG9A, CCNJL, SNRNP25, NOL9, FLAD1, TSSK3, RASSF5, C11orf68, PLEKHN1, MIEN1, VPS25, CEP19, KRTAP9-4, BMF, SLC39A13, ATPAF2, ZNF765, RIPPLY1, EGLN3, EFHC1, KLHL32, CIB3, PIH1D2, MRPL10, NR2C2AP, KLHL40, GLYCTK, ZNF572, ZNF417, TSTD2, PATE1, ZNF550, ZNF564, FUT11, TTC21A, STRA13, C9orf72, CPNE2, NEIL2, ZDHHC24, NUDT14, SEC14L4, BARHL2, RAB41, TRIM74, C12orf75, REXO1L6P, BTRC, RELB, TSR3, AURKA, XPO1, BIRC3, RGS3, HIF1AN, NFKBIDKIAA1841APP, SRPK1, NICN1, LRRC49, TTLL1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for REL_KIAA1841


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for REL_KIAA1841


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRELC0003873Rheumatoid Arthritis3CTD_human
HgeneRELC0018843Heat Stroke1CTD_human
HgeneRELC0019829Hodgkin Disease1CTD_human
HgeneRELC0025261Memory Disorders1CTD_human
HgeneRELC0033860Psoriasis1CTD_human