FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 30852

FusionGeneSummary for RCAN1_RUNX1

check button Fusion gene summary
Fusion gene informationFusion gene name: RCAN1_RUNX1
Fusion gene ID: 30852
HgeneTgene
Gene symbol

RCAN1

RUNX1

Gene ID

1827

861

Gene nameregulator of calcineurin 1runt related transcription factor 1
SynonymsADAPT78|CSP1|DSC1|DSCR1|MCIP1|RCN1AML1|AML1-EVI-1|AMLCR1|CBF2alpha|CBFA2|EVI-1|PEBP2aB|PEBP2alpha
Cytomap

21q22.12

21q22.12

Type of geneprotein-codingprotein-coding
Descriptioncalcipressin-1Down syndrome candidate region 1Down syndrome critical region gene 1calcium and oxidant-inducible mRNAmodulatory calcineurin-interacting protein 1myocyte-enriched calcineurin-interacting protein 1near DSCR proline-rich proteinrunt-related transcription factor 1AML1-EVI-1 fusion proteinPEA2-alpha BPEBP2-alpha BSL3-3 enhancer factor 1 alpha B subunitSL3/AKV core-binding factor alpha B subunitacute myeloid leukemia 1 proteincore-binding factor, runt domain, alpha subunit 2
Modification date2018052320180527
UniProtAcc

P53805

Q01196

Ensembl transtripts involved in fusion geneENST00000487990, ENST00000399272, 
ENST00000489903, ENST00000313806, 
ENST00000443408, ENST00000482533, 
ENST00000481448, ENST00000381132, 
ENST00000381135, ENST00000492600, 
ENST00000344691, ENST00000325074, 
ENST00000437180, ENST00000300305, 
ENST00000399240, ENST00000486278, 
ENST00000494829, ENST00000358356, 
Fusion gene scores* DoF score4 X 4 X 4=6417 X 29 X 7=3451
# samples 633
** MAII scorelog2(6/64*10)=-0.0931094043914815
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(33/3451*10)=-3.3864765441897
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: RCAN1 [Title/Abstract] AND RUNX1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneRUNX1

GO:0030097

hemopoiesis

21873977

TgeneRUNX1

GO:0045893

positive regulation of transcription, DNA-templated

10207087|14970218

TgeneRUNX1

GO:0045944

positive regulation of transcription by RNA polymerase II

9199349|10207087|14970218|21873977


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-A7-A6VV-01ARCAN1chr21

35987059

-RUNX1chr21

36171759

-
TCGARVUCSTCGA-N5-A4RT-01ARCAN1chr21

35987059

-RUNX1chr21

36253010

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000487990ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000487990ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000487990ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000487990ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000487990ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000487990ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000487990ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000487990ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000399272ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000399272ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000399272ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000399272ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000399272ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000399272ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000399272ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000399272ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000489903ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000489903ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000489903ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000489903ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000489903ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000489903ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000489903ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000489903ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
Frame-shitENST00000313806ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
Frame-shitENST00000313806ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
Frame-shitENST00000313806ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
Frame-shitENST00000313806ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
Frame-shitENST00000313806ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
5CDS-intronENST00000313806ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
5CDS-intronENST00000313806ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
5CDS-intronENST00000313806ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000443408ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000443408ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000443408ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000443408ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000443408ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000443408ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000443408ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000443408ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000482533ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000482533ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000482533ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000482533ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000482533ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000482533ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000482533ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000482533ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000481448ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000481448ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000481448ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000481448ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000481448ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000481448ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000481448ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000481448ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381132ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381132ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381132ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381132ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381132ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381132ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381132ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381132ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381135ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381135ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381135ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381135ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000381135ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381135ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381135ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000381135ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000492600ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000492600ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000492600ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000492600ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000492600ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000492600ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000492600ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-intronENST00000492600ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36171759

-
intron-3CDSENST00000487990ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000487990ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000487990ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000487990ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000487990ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000487990ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000487990ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000487990ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000399272ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000399272ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000399272ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000489903ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000489903ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000489903ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
In-frameENST00000313806ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
5CDS-intronENST00000313806ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
5CDS-intronENST00000313806ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000443408ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000443408ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000443408ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000482533ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000482533ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000482533ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000481448ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000481448ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000481448ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381132ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000381132ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000381132ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000381135ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000381135ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000381135ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000344691RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000325074RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000437180RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000300305RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000399240RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-3CDSENST00000492600ENST00000486278RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000492600ENST00000494829RCAN1chr21

35987059

-RUNX1chr21

36253010

-
intron-intronENST00000492600ENST00000358356RCAN1chr21

35987059

-RUNX1chr21

36253010

-

Top

FusionProtFeatures for RCAN1_RUNX1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
RCAN1

P53805

RUNX1

Q01196


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for RCAN1_RUNX1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000344691_chr21_36253010_-_448aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQ
TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPIS
PGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHTPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000325074_chr21_36253010_-_448aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQ
TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPIS
PGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHTPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000437180_chr21_36253010_-_448aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQ
TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPIS
PGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHTPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000300305_chr21_36253010_-_448aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQ
TKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPIS
PGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHTPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPGSSQAQG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000399240_chr21_36253010_-_384aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNTRQIQPSP
PWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDLTAFSDPRQFPALPSISDPRMHTPGAFTYSPTPVTSGIGIG
MSAMGSATRYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000486278_chr21_36253010_-_183aa
MEDGVAGPQLGAAAEAAEAAEARARPGVTLRPFAPLSGAAEADEGGGDWSFIDCEMEEVDLQDLPSATIACHLDPRVFVDGLCRVVALGD
VPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRNSLTWPRTP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000344691_chr21_36253010_-_1344nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAG
ACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCA
GCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATC
CAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCA
CCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCG
CGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGC
ATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGA
GGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGC
TCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000325074_chr21_36253010_-_1344nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAG
ACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCA
GCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATC
CAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCA
CCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCG
CGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGC
ATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGA
GGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGC
TCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000437180_chr21_36253010_-_1344nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAG
ACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCA
GCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATC
CAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCA
CCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCG
CGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGC
ATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGA
GGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGC
TCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000300305_chr21_36253010_-_1344nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAG
ACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGCAGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCA
GCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTAACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATC
CAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCA
CCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCG
CGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGC
ATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGA
GGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGC
TCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTG

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000399240_chr21_36253010_-_1152nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAATACAAGGCAGATCCAACCATCCCCA
CCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCC
AGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCC
GCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGC
ATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAA
GCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGC
ATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGC

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000486278_chr21_36253010_-_549nt
ATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGGCGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTG
CGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCGGCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGAC
CTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCGTGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGAT
GTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACTACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAAC
CAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAGGGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCA
CCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGCCCCGAGAACCTCGAAACTCTTTGACCTGGCCTCGGTATCCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000344691_chr21_36253010_-_5809nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC
CCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGC
AGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTA
ACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGAT
CCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTC
GACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATC
CAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCT
ACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCT
CGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCG
CGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCG
CGCGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCG
CGCGGGCCTCCTGTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGCGCCCGACGGCCAGGA
TCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCGCCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTC
CGAGGCGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAACAGGAAGATTCCCGGAGGGAAACTGT
GAATGCTTCTGATTTAGCAATGCTGTGAATAAAAAGAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTGTTTATTCCAAAGAG
TGTGGAATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCAACTCGCCCTGTTTGGCATCTAATTCTTATTTTTAATTTTTCCGCACCTTA
TCAATTGCAAAATGCGTATTTGCATTTGGGTGGTTTTTATTTTTATATACGTTTATATAAATATATATAAATTGAGCTTGCTTCTTTCTT
GCTTTGACCATGGAAAGAAATATGATTCCCTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGACTTTTGGGTAGTTGTTTTTTTTTGTT
TTGTTTTGTTTTTTTGAGAAACAGCTACAGCTTTGGGTCATTTTTAACTACTGTATTCCCACAAGGAATCCCCAGATATTTATGTATCTT
GATGTTCAGACATTTATGTGTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAATATCAAGTACTACATTTTCTTTTGTT
CTTGATAGTAGCCAAAGTTAAATGTATCACATTGAAGAAGGCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATT
GTTTACATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTTTTTAATAGGATTTTTAGACACTGAGGGTCA
CTCCAAGGATCAGAAGTATGGAATTTTCTGCCAGGCTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAGGTCAATCTAG
TTCCAGAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAGGATTTGATTTCTGCCCAGGGATTTGCTCACCCCAAGGTCATCTGA
TAATTTCACAGATGCTGTGTAACAGAACACAGCCAAAGTAAACTGTGTAGGGGAGCCACATTTACATAGGAACCAAATCAATGAATTTAG
GGGTTACGATTATAGCAATTTAAGGGCCCACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTGTGTGCCTCAGTGGAGACAAGTGGGA
AAACATGGTCCCACCTGTGCGAGACCCCCTGTCCTGTGCTGCTCACTCAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACC
CTATGGGGTATATGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTCCGTGGCTACAATTCAAAGGTATCCA
ATGTCGCTGTAAATTTTATGGCACTATTTTTATTGGAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGATT
TTGACACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAATTCGTTGAAACGATTTCAGGTCAACTCTGAAGAGTA
TTTGAAAGCAGGACTTCAGAACAGTGTTTGATTTTTATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTGGCTGCAGGCAGCAAA
AACAGCTGGACTTATTTAAAACAACTTGTTTTTGAGTTTTCTTATATATATATTGATTATTTGTTTTACACACATGCAGTAGCACTTTGG
TAAGAGTTAAAGAGTAAAGCAGCTTATGTTGTCAGGTCGTTCTTATCTAGAGAAGAGCTATAGCAGATCTCGGACAAACTCAGAATATAT
TCACTTTCATTTTTGACAGGATTCCCTCCACAACTCAGTTTCATATATTATTCCGTATTACATTTTTGCAGCTAAATTACCATAAAATGT
CAGCAAATGTAAAAATTTAATTTCTGAAAAGCACCATTAGCCCATTTCCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACC
ATGTCTGACCTGCAAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCTGTTAACTGAAGATATTCCAACTCAA
AACCAGCCTCATGCTCTGATTAGATAATCTTTTACATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAGGC
TCACTGGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATTTAATTGTTTCAAAAAAAATCAAACTGTAGTTGTTTT
GGCGATAGGTCTCACGCAACACATTTTTGTATGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCATTCATTGACTTCAGG
TAGATTAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTTAAGGTATCAATGAGACCCTTAAGCCAATCATGTAATAACTGCATGTGTC
TGGTCCAGGAGAAGTATTGAATAAGCCATTTCTACTGCTTACTCATGTCCCTATTTATGATTTCAACATGGATACATATTTCAGTTCTTT
CTTTTTCTCACTATCTGAAAATACATTTCCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTCTCTCTTCCTCTATCTTCCAAACCCC
ACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAAGCAGATAGCACATACCCCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAG
TTCTTCCCCCTTCACATAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCAGCAGAACAGAGACATTGCCAACCAT
ATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTTCCTGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTT
TCTGTGCAGATAAACAGAAATGCTCTGATTAGAAAGGAAATGAATGGTTCCACTCAAATGTCCTGCAATTTAGGATTGCAGATTTCTGCC
TTGAAATACCTGTTTCTTTGGGACATTCCGTCCTGATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGGGAATGACATGTTTGGGTCT
TTTATACATGAAAATTTGTTTGACAATAATCTCACAAAACATATTTTACATCTGAACAAAATGCCTTTTTGTTTACCGTAGCGTATACAT
TTGTTTTGGGATTTTTGTGTGTTTGTTGGGAATTTTGTTTTTAGCCAGGTCAGTATTGATGAGGCTGATCATTTGGCTCTTTTTTTCCTT
CCAGAAGAGTTGCATCAACAAAGTTAATTGTATTTATGTATGTAAATAGATTTTAAGCTTCATTATAAAATATTGTTAATGCCTATAACT
TTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACTTTTTCTTAGGTTTGCTAAATACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTT
TATTTTAGACTTTAAAATGAGCTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCAATTTTTTTTAAGTTCACTTTTTTTG
TTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAGAACTGTTGGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAA
ACTTTCAAATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCCTATTTAAGCCAGCCCCCACCTAGGGTCTA
TTTGTGTGGCAGTTATTGGGTTTGGTCACAAAACATCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTATGGAATGCT
TCTTAAAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGAGAGAATATCCCAGAACCCTCTCTCCAAGGTGTTTCTAGATAGC
ACAGGAGAGCAGGCACTGCACTGTCCACAGTCCACGGTACACAGTCGGGTGGGCCGCCTCCCCTCTCCTGGGAGCATTCGTCGTGCCCAG
CCTGAGCAGGGCAGCTGGACTGCTGCTGTTCAGGAGCCACCAGAGCCTTCCTCTCTTTGTACCACAGTTTCTTCTGTAAATCCAGTGTTA

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000325074_chr21_36253010_-_5809nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC
CCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGC
AGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTA
ACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGAT
CCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTC
GACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATC
CAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCT
ACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCT
CGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCG
CGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCG
CGCGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCG
CGCGGGCCTCCTGTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGCGCCCGACGGCCAGGA
TCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCGCCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTC
CGAGGCGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAACAGGAAGATTCCCGGAGGGAAACTGT
GAATGCTTCTGATTTAGCAATGCTGTGAATAAAAAGAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTGTTTATTCCAAAGAG
TGTGGAATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCAACTCGCCCTGTTTGGCATCTAATTCTTATTTTTAATTTTTCCGCACCTTA
TCAATTGCAAAATGCGTATTTGCATTTGGGTGGTTTTTATTTTTATATACGTTTATATAAATATATATAAATTGAGCTTGCTTCTTTCTT
GCTTTGACCATGGAAAGAAATATGATTCCCTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGACTTTTGGGTAGTTGTTTTTTTTTGTT
TTGTTTTGTTTTTTTGAGAAACAGCTACAGCTTTGGGTCATTTTTAACTACTGTATTCCCACAAGGAATCCCCAGATATTTATGTATCTT
GATGTTCAGACATTTATGTGTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAATATCAAGTACTACATTTTCTTTTGTT
CTTGATAGTAGCCAAAGTTAAATGTATCACATTGAAGAAGGCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATT
GTTTACATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTTTTTAATAGGATTTTTAGACACTGAGGGTCA
CTCCAAGGATCAGAAGTATGGAATTTTCTGCCAGGCTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAGGTCAATCTAG
TTCCAGAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAGGATTTGATTTCTGCCCAGGGATTTGCTCACCCCAAGGTCATCTGA
TAATTTCACAGATGCTGTGTAACAGAACACAGCCAAAGTAAACTGTGTAGGGGAGCCACATTTACATAGGAACCAAATCAATGAATTTAG
GGGTTACGATTATAGCAATTTAAGGGCCCACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTGTGTGCCTCAGTGGAGACAAGTGGGA
AAACATGGTCCCACCTGTGCGAGACCCCCTGTCCTGTGCTGCTCACTCAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACC
CTATGGGGTATATGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTCCGTGGCTACAATTCAAAGGTATCCA
ATGTCGCTGTAAATTTTATGGCACTATTTTTATTGGAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGATT
TTGACACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAATTCGTTGAAACGATTTCAGGTCAACTCTGAAGAGTA
TTTGAAAGCAGGACTTCAGAACAGTGTTTGATTTTTATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTGGCTGCAGGCAGCAAA
AACAGCTGGACTTATTTAAAACAACTTGTTTTTGAGTTTTCTTATATATATATTGATTATTTGTTTTACACACATGCAGTAGCACTTTGG
TAAGAGTTAAAGAGTAAAGCAGCTTATGTTGTCAGGTCGTTCTTATCTAGAGAAGAGCTATAGCAGATCTCGGACAAACTCAGAATATAT
TCACTTTCATTTTTGACAGGATTCCCTCCACAACTCAGTTTCATATATTATTCCGTATTACATTTTTGCAGCTAAATTACCATAAAATGT
CAGCAAATGTAAAAATTTAATTTCTGAAAAGCACCATTAGCCCATTTCCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACC
ATGTCTGACCTGCAAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCTGTTAACTGAAGATATTCCAACTCAA
AACCAGCCTCATGCTCTGATTAGATAATCTTTTACATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAGGC
TCACTGGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATTTAATTGTTTCAAAAAAAATCAAACTGTAGTTGTTTT
GGCGATAGGTCTCACGCAACACATTTTTGTATGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCATTCATTGACTTCAGG
TAGATTAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTTAAGGTATCAATGAGACCCTTAAGCCAATCATGTAATAACTGCATGTGTC
TGGTCCAGGAGAAGTATTGAATAAGCCATTTCTACTGCTTACTCATGTCCCTATTTATGATTTCAACATGGATACATATTTCAGTTCTTT
CTTTTTCTCACTATCTGAAAATACATTTCCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTCTCTCTTCCTCTATCTTCCAAACCCC
ACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAAGCAGATAGCACATACCCCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAG
TTCTTCCCCCTTCACATAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCAGCAGAACAGAGACATTGCCAACCAT
ATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTTCCTGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTT
TCTGTGCAGATAAACAGAAATGCTCTGATTAGAAAGGAAATGAATGGTTCCACTCAAATGTCCTGCAATTTAGGATTGCAGATTTCTGCC
TTGAAATACCTGTTTCTTTGGGACATTCCGTCCTGATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGGGAATGACATGTTTGGGTCT
TTTATACATGAAAATTTGTTTGACAATAATCTCACAAAACATATTTTACATCTGAACAAAATGCCTTTTTGTTTACCGTAGCGTATACAT
TTGTTTTGGGATTTTTGTGTGTTTGTTGGGAATTTTGTTTTTAGCCAGGTCAGTATTGATGAGGCTGATCATTTGGCTCTTTTTTTCCTT
CCAGAAGAGTTGCATCAACAAAGTTAATTGTATTTATGTATGTAAATAGATTTTAAGCTTCATTATAAAATATTGTTAATGCCTATAACT
TTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACTTTTTCTTAGGTTTGCTAAATACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTT
TATTTTAGACTTTAAAATGAGCTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCAATTTTTTTTAAGTTCACTTTTTTTG
TTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAGAACTGTTGGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAA
ACTTTCAAATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCCTATTTAAGCCAGCCCCCACCTAGGGTCTA
TTTGTGTGGCAGTTATTGGGTTTGGTCACAAAACATCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTATGGAATGCT
TCTTAAAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGAGAGAATATCCCAGAACCCTCTCTCCAAGGTGTTTCTAGATAGC
ACAGGAGAGCAGGCACTGCACTGTCCACAGTCCACGGTACACAGTCGGGTGGGCCGCCTCCCCTCTCCTGGGAGCATTCGTCGTGCCCAG
CCTGAGCAGGGCAGCTGGACTGCTGCTGTTCAGGAGCCACCAGAGCCTTCCTCTCTTTGTACCACAGTTTCTTCTGTAAATCCAGTGTTA

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000437180_chr21_36253010_-_5809nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC
CCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGC
AGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTA
ACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGAT
CCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTC
GACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATC
CAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCT
ACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCT
CGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCG
CGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCG
CGCGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCG
CGCGGGCCTCCTGTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGCGCCCGACGGCCAGGA
TCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCGCCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTC
CGAGGCGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAACAGGAAGATTCCCGGAGGGAAACTGT
GAATGCTTCTGATTTAGCAATGCTGTGAATAAAAAGAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTGTTTATTCCAAAGAG
TGTGGAATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCAACTCGCCCTGTTTGGCATCTAATTCTTATTTTTAATTTTTCCGCACCTTA
TCAATTGCAAAATGCGTATTTGCATTTGGGTGGTTTTTATTTTTATATACGTTTATATAAATATATATAAATTGAGCTTGCTTCTTTCTT
GCTTTGACCATGGAAAGAAATATGATTCCCTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGACTTTTGGGTAGTTGTTTTTTTTTGTT
TTGTTTTGTTTTTTTGAGAAACAGCTACAGCTTTGGGTCATTTTTAACTACTGTATTCCCACAAGGAATCCCCAGATATTTATGTATCTT
GATGTTCAGACATTTATGTGTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAATATCAAGTACTACATTTTCTTTTGTT
CTTGATAGTAGCCAAAGTTAAATGTATCACATTGAAGAAGGCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATT
GTTTACATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTTTTTAATAGGATTTTTAGACACTGAGGGTCA
CTCCAAGGATCAGAAGTATGGAATTTTCTGCCAGGCTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAGGTCAATCTAG
TTCCAGAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAGGATTTGATTTCTGCCCAGGGATTTGCTCACCCCAAGGTCATCTGA
TAATTTCACAGATGCTGTGTAACAGAACACAGCCAAAGTAAACTGTGTAGGGGAGCCACATTTACATAGGAACCAAATCAATGAATTTAG
GGGTTACGATTATAGCAATTTAAGGGCCCACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTGTGTGCCTCAGTGGAGACAAGTGGGA
AAACATGGTCCCACCTGTGCGAGACCCCCTGTCCTGTGCTGCTCACTCAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACC
CTATGGGGTATATGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTCCGTGGCTACAATTCAAAGGTATCCA
ATGTCGCTGTAAATTTTATGGCACTATTTTTATTGGAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGATT
TTGACACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAATTCGTTGAAACGATTTCAGGTCAACTCTGAAGAGTA
TTTGAAAGCAGGACTTCAGAACAGTGTTTGATTTTTATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTGGCTGCAGGCAGCAAA
AACAGCTGGACTTATTTAAAACAACTTGTTTTTGAGTTTTCTTATATATATATTGATTATTTGTTTTACACACATGCAGTAGCACTTTGG
TAAGAGTTAAAGAGTAAAGCAGCTTATGTTGTCAGGTCGTTCTTATCTAGAGAAGAGCTATAGCAGATCTCGGACAAACTCAGAATATAT
TCACTTTCATTTTTGACAGGATTCCCTCCACAACTCAGTTTCATATATTATTCCGTATTACATTTTTGCAGCTAAATTACCATAAAATGT
CAGCAAATGTAAAAATTTAATTTCTGAAAAGCACCATTAGCCCATTTCCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACC
ATGTCTGACCTGCAAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCTGTTAACTGAAGATATTCCAACTCAA
AACCAGCCTCATGCTCTGATTAGATAATCTTTTACATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAGGC
TCACTGGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATTTAATTGTTTCAAAAAAAATCAAACTGTAGTTGTTTT
GGCGATAGGTCTCACGCAACACATTTTTGTATGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCATTCATTGACTTCAGG
TAGATTAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTTAAGGTATCAATGAGACCCTTAAGCCAATCATGTAATAACTGCATGTGTC
TGGTCCAGGAGAAGTATTGAATAAGCCATTTCTACTGCTTACTCATGTCCCTATTTATGATTTCAACATGGATACATATTTCAGTTCTTT
CTTTTTCTCACTATCTGAAAATACATTTCCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTCTCTCTTCCTCTATCTTCCAAACCCC
ACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAAGCAGATAGCACATACCCCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAG
TTCTTCCCCCTTCACATAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCAGCAGAACAGAGACATTGCCAACCAT
ATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTTCCTGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTT
TCTGTGCAGATAAACAGAAATGCTCTGATTAGAAAGGAAATGAATGGTTCCACTCAAATGTCCTGCAATTTAGGATTGCAGATTTCTGCC
TTGAAATACCTGTTTCTTTGGGACATTCCGTCCTGATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGGGAATGACATGTTTGGGTCT
TTTATACATGAAAATTTGTTTGACAATAATCTCACAAAACATATTTTACATCTGAACAAAATGCCTTTTTGTTTACCGTAGCGTATACAT
TTGTTTTGGGATTTTTGTGTGTTTGTTGGGAATTTTGTTTTTAGCCAGGTCAGTATTGATGAGGCTGATCATTTGGCTCTTTTTTTCCTT
CCAGAAGAGTTGCATCAACAAAGTTAATTGTATTTATGTATGTAAATAGATTTTAAGCTTCATTATAAAATATTGTTAATGCCTATAACT
TTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACTTTTTCTTAGGTTTGCTAAATACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTT
TATTTTAGACTTTAAAATGAGCTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCAATTTTTTTTAAGTTCACTTTTTTTG
TTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAGAACTGTTGGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAA
ACTTTCAAATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCCTATTTAAGCCAGCCCCCACCTAGGGTCTA
TTTGTGTGGCAGTTATTGGGTTTGGTCACAAAACATCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTATGGAATGCT
TCTTAAAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGAGAGAATATCCCAGAACCCTCTCTCCAAGGTGTTTCTAGATAGC
ACAGGAGAGCAGGCACTGCACTGTCCACAGTCCACGGTACACAGTCGGGTGGGCCGCCTCCCCTCTCCTGGGAGCATTCGTCGTGCCCAG
CCTGAGCAGGGCAGCTGGACTGCTGCTGTTCAGGAGCCACCAGAGCCTTCCTCTCTTTGTACCACAGTTTCTTCTGTAAATCCAGTGTTA

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000300305_chr21_36253010_-_5809nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC
CCCGAGAACCTCGAAGACATCGGCAGAAACTAGATGATCAGACCAAGCCCGGGAGCTTGTCCTTTTCCGAGCGGCTCAGTGAACTGGAGC
AGCTGCGGCGCACAGCCATGAGGGTCAGCCCACACCACCCAGCCCCCACGCCCAACCCTCGTGCCTCCCTGAACCACTCCACTGCCTTTA
ACCCTCAGCCTCAGAGTCAGATGCAGGATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGAT
CCATTGCCTCTCCTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTC
GACTCTCAACGGCACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATC
CAGGCGCCTTCACCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCT
ACCTGCCGCCGCCCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCT
CGGCCGGCTCCTACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCG
CGCTGCTCAACCCCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCG
CGCGCCTGGAGGAGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCG
CGCGGGCCTCCTGTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGCGCCCGACGGCCAGGA
TCTCGCTGTAGGTCAGGCCCGCGCAGCCTCCTGCGCCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTC
CGAGGCGACGCACCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAACAGGAAGATTCCCGGAGGGAAACTGT
GAATGCTTCTGATTTAGCAATGCTGTGAATAAAAAGAAAGATTTTATACCCTTGACTTAACTTTTTAACCAAGTTGTTTATTCCAAAGAG
TGTGGAATTTTGGTTGGGGTGGGGGGAGAGGAGGGATGCAACTCGCCCTGTTTGGCATCTAATTCTTATTTTTAATTTTTCCGCACCTTA
TCAATTGCAAAATGCGTATTTGCATTTGGGTGGTTTTTATTTTTATATACGTTTATATAAATATATATAAATTGAGCTTGCTTCTTTCTT
GCTTTGACCATGGAAAGAAATATGATTCCCTTTTCTTTAAGTTTTATTTAACTTTTCTTTTGGACTTTTGGGTAGTTGTTTTTTTTTGTT
TTGTTTTGTTTTTTTGAGAAACAGCTACAGCTTTGGGTCATTTTTAACTACTGTATTCCCACAAGGAATCCCCAGATATTTATGTATCTT
GATGTTCAGACATTTATGTGTTGATAATTTTTTAATTATTTAAATGTACTTATATTAAGAAAAATATCAAGTACTACATTTTCTTTTGTT
CTTGATAGTAGCCAAAGTTAAATGTATCACATTGAAGAAGGCTAGAAAAAAAGAATGAGTAATGTGATCGCTTGGTTATCCAGAAGTATT
GTTTACATTAAACTCCCTTTCATGTTAATCAAACAAGTGAGTAGCTCACGCAGCAACGTTTTTAATAGGATTTTTAGACACTGAGGGTCA
CTCCAAGGATCAGAAGTATGGAATTTTCTGCCAGGCTCAACAAGGGTCTCATATCTAACTTCCTCCTTAAAACAGAGAAGGTCAATCTAG
TTCCAGAGGGTTGAGGCAGGTGCCAATAATTACATCTTTGGAGAGGATTTGATTTCTGCCCAGGGATTTGCTCACCCCAAGGTCATCTGA
TAATTTCACAGATGCTGTGTAACAGAACACAGCCAAAGTAAACTGTGTAGGGGAGCCACATTTACATAGGAACCAAATCAATGAATTTAG
GGGTTACGATTATAGCAATTTAAGGGCCCACCAGAAGCAGGCCTCGAGGAGTCAATTTGCCTCTGTGTGCCTCAGTGGAGACAAGTGGGA
AAACATGGTCCCACCTGTGCGAGACCCCCTGTCCTGTGCTGCTCACTCAACAACATCTTTGTGTTGCTTTCACCAGGCTGAGACCCTACC
CTATGGGGTATATGGGCTTTTACCTGTGCACCAGTGTGACAGGAAAGATTCATGTCACTACTGTCCGTGGCTACAATTCAAAGGTATCCA
ATGTCGCTGTAAATTTTATGGCACTATTTTTATTGGAGGATTTGGTCAGAATGCAGTTGTTGTACAACTCATAAATACTAACTGCTGATT
TTGACACATGTGTGCTCCAAATGATCTGGTGGTTATTTAACGTACCTCTTAAAATTCGTTGAAACGATTTCAGGTCAACTCTGAAGAGTA
TTTGAAAGCAGGACTTCAGAACAGTGTTTGATTTTTATTTTATAAATTTAAGCATTCAAATTAGGCAAATCTTTGGCTGCAGGCAGCAAA
AACAGCTGGACTTATTTAAAACAACTTGTTTTTGAGTTTTCTTATATATATATTGATTATTTGTTTTACACACATGCAGTAGCACTTTGG
TAAGAGTTAAAGAGTAAAGCAGCTTATGTTGTCAGGTCGTTCTTATCTAGAGAAGAGCTATAGCAGATCTCGGACAAACTCAGAATATAT
TCACTTTCATTTTTGACAGGATTCCCTCCACAACTCAGTTTCATATATTATTCCGTATTACATTTTTGCAGCTAAATTACCATAAAATGT
CAGCAAATGTAAAAATTTAATTTCTGAAAAGCACCATTAGCCCATTTCCCCCAAATTAAACGTAAATGTTTTTTTTCAGCACATGTTACC
ATGTCTGACCTGCAAAAATGCTGGAGAAAAATGAAGGAAAAAATTATGTTTTTCAGTTTAATTCTGTTAACTGAAGATATTCCAACTCAA
AACCAGCCTCATGCTCTGATTAGATAATCTTTTACATTGAACCTTTACTCTCAAAGCCATGTGTGGAGGGGGCTTGTCACTATTGTAGGC
TCACTGGATTGGTCATTTAGAGTTTCACAGACTCTTACCAGCATATATAGTATTTAATTGTTTCAAAAAAAATCAAACTGTAGTTGTTTT
GGCGATAGGTCTCACGCAACACATTTTTGTATGTGTGTGTGTGTGCGTGTGTGTGTGTGTGTGTGAAAAATTGCATTCATTGACTTCAGG
TAGATTAAGGTATCTTTTTATTCATTGCCCTCAGGAAAGTTAAGGTATCAATGAGACCCTTAAGCCAATCATGTAATAACTGCATGTGTC
TGGTCCAGGAGAAGTATTGAATAAGCCATTTCTACTGCTTACTCATGTCCCTATTTATGATTTCAACATGGATACATATTTCAGTTCTTT
CTTTTTCTCACTATCTGAAAATACATTTCCCTCCCTCTCTTCCCCCCAATATCTCCCTTTTTTTCTCTCTTCCTCTATCTTCCAAACCCC
ACTTTCTCCCTCCTCCTTTTCCTGTGTTCTCTTAAGCAGATAGCACATACCCCCACCCAGTACCAAATTTCAGAACACAAGAAGGTCCAG
TTCTTCCCCCTTCACATAAAGGAACATGGTTTGTCAGCCTTTCTCCTGTTTATGGGTTTCTTCCAGCAGAACAGAGACATTGCCAACCAT
ATTGGATCTGCTTGCTGTCCAAACCAGCAAACTTTCCTGGGCAAATCACAATCAGTGAGTAAATAGACAGCCTTTCTGCTGCCTTGGGTT
TCTGTGCAGATAAACAGAAATGCTCTGATTAGAAAGGAAATGAATGGTTCCACTCAAATGTCCTGCAATTTAGGATTGCAGATTTCTGCC
TTGAAATACCTGTTTCTTTGGGACATTCCGTCCTGATGATTTTTATTTTTGTTGGTTTTTATTTTTGGGGGGAATGACATGTTTGGGTCT
TTTATACATGAAAATTTGTTTGACAATAATCTCACAAAACATATTTTACATCTGAACAAAATGCCTTTTTGTTTACCGTAGCGTATACAT
TTGTTTTGGGATTTTTGTGTGTTTGTTGGGAATTTTGTTTTTAGCCAGGTCAGTATTGATGAGGCTGATCATTTGGCTCTTTTTTTCCTT
CCAGAAGAGTTGCATCAACAAAGTTAATTGTATTTATGTATGTAAATAGATTTTAAGCTTCATTATAAAATATTGTTAATGCCTATAACT
TTTTTTCAATTTTTTTGTGTGTGTTTCTAAGGACTTTTTCTTAGGTTTGCTAAATACTGTAGGGAAAAAAATGCTTCTTTCTACTTTGTT
TATTTTAGACTTTAAAATGAGCTACTTCTTATTCACTTTTGTAAACAGCTAATAGCATGGTTCCAATTTTTTTTAAGTTCACTTTTTTTG
TTCTAGGGGAAATGAATGTGCAAAAAAAGAAAAAGAACTGTTGGTTATTTGTGTTATTCTGGATGTATAAAAATCAATGGAAAAAAATAA
ACTTTCAAATTGAAATGACGGTATAACACATCTACTGAAAAAGCAACGGGAAATGTGGTCCTATTTAAGCCAGCCCCCACCTAGGGTCTA
TTTGTGTGGCAGTTATTGGGTTTGGTCACAAAACATCCTGAAAATTCGTGCGTGGGCTTCTTTCTCCCTGGTACAAACGTATGGAATGCT
TCTTAAAGGGGAACTGTCAAGCTGGTGTCTTCAGCCAGATGACATGAGAGAATATCCCAGAACCCTCTCTCCAAGGTGTTTCTAGATAGC
ACAGGAGAGCAGGCACTGCACTGTCCACAGTCCACGGTACACAGTCGGGTGGGCCGCCTCCCCTCTCCTGGGAGCATTCGTCGTGCCCAG
CCTGAGCAGGGCAGCTGGACTGCTGCTGTTCAGGAGCCACCAGAGCCTTCCTCTCTTTGTACCACAGTTTCTTCTGTAAATCCAGTGTTA

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000399240_chr21_36253010_-_1632nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC
CCCGAGAACCTCGAAATACAAGGCAGATCCAACCATCCCCACCGTGGTCCTACGATCAGTCCTACCAATACCTGGGATCCATTGCCTCTC
CTTCTGTGCACCCAGCAACGCCCATTTCACCTGGACGTGCCAGCGGCATGACAACCCTCTCTGCAGAACTTTCCAGTCGACTCTCAACGG
CACCCGACCTGACAGCGTTCAGCGACCCGCGCCAGTTCCCCGCGCTGCCCTCCATCTCCGACCCCCGCATGCACTATCCAGGCGCCTTCA
CCTACTCCCCGACGCCGGTCACCTCGGGCATCGGCATCGGCATGTCGGCCATGGGCTCGGCCACGCGCTACCACACCTACCTGCCGCCGC
CCTACCCCGGCTCGTCGCAAGCGCAGGGAGGCCCGTTCCAAGCCAGCTCGCCCTCCTACCACCTGTACTACGGCGCCTCGGCCGGCTCCT
ACCAGTTCTCCATGGTGGGCGGCGAGCGCTCGCCGCCGCGCATCCTGCCGCCCTGCACCAACGCCTCCACCGGCTCCGCGCTGCTCAACC
CCAGCCTCCCGAACCAGAGCGACGTGGTGGAGGCCGAGGGCAGCCACAGCAACTCCCCCACCAACATGGCGCCCTCCGCGCGCCTGGAGG
AGGCCGTGTGGAGGCCCTACTGAGGCGCCAGGCCTGGCCCGGCTGGGCCCCGCGGGCCGCCGCCTTCGCCTCCGGGCGCGCGGGCCTCCT
GTTCGCGACAAGCCCGCCGGGATCCCGGGCCCTGGGCCCGGCCACCGTCCTGGGGCCGAGGGCGCCCGACGGCCAGGATCTCGCTGTAGG
TCAGGCCCGCGCAGCCTCCTGCGCCCAGAAGCCCACGCCGCCGCCGTCTGCTGGCGCCCCGGCCCTCGCGGAGGTGTCCGAGGCGACGCA
CCTCGAGGGTGTCCGCCGGCCCCAGCACCCAGGGGACGCGCTGGAAAGCAAACAGGAAGATTCCCGGAGGGAAACTGTGAATGCTTCTGA

>In-frame_RCAN1_ENST00000313806_chr21_35987059_-_RUNX1_ENST00000486278_chr21_36253010_-_680nt
GCCTGCCGCCGCGCGATTCCGAGGGGGTTAACGGCGGAGCCGCCGGCCGGGCGCGGACCGGAGCGCGTGAGGCTCCGGCGCGCAAGCCCG
GAGCAGCCCGCTGGGGCGCACAGGGTCGCGCGGGCGCGGGGATGGAGGACGGCGTGGCCGGTCCCCAGCTCGGGGCCGCGGCGGAGGCGG
CGGAGGCGGCCGAGGCGCGAGCGCGGCCCGGGGTGACGCTGCGGCCCTTCGCGCCCCTCTCGGGGGCGGCCGAGGCGGACGAGGGCGGCG
GCGACTGGAGCTTCATTGACTGCGAGATGGAGGAGGTGGACCTGCAGGACCTGCCCAGCGCCACCATCGCCTGTCACCTGGACCCGCGCG
TGTTCGTGGACGGCCTGTGCCGGGTGGTGGCCCTAGGGGATGTTCCAGATGGCACTCTGGTCACTGTGATGGCTGGCAATGATGAAAACT
ACTCGGCTGAGCTGAGAAATGCTACCGCAGCCATGAAGAACCAGGTTGCAAGATTTAATGACCTCAGGTTTGTCGGTCGAAGTGGAAGAG
GGAAAAGCTTCACTCTGACCATCACTGTCTTCACAAACCCACCGCAAGTCGCCACCTACCACAGAGCCATCAAAATCACAGTGGATGGGC


Top

FusionGenePPI for RCAN1_RUNX1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
RCAN1PPP3CA, STAT2, TOLLIP, IRAK1, TRAF6, HSP90AA1, BTRC, FBXW4, FBXW11, APP, FAM122A, PPP3CC, USP22, PPP3CB, GSK3A, PPP3R1, C6orf211, SRBD1, CST2, CST5, AMY1C, GSK3B, ZG16B, IGHA1, CLEC3A, TRIM25RUNX1SUV39H1, KAT6B, CBFB, AES, PAX5, YAP1, JUN, FOS, SMAD3, SMAD1, SMAD2, SMAD5, VDR, ELF4, ELF2, CEBPB, TLE1, CBFA2T2, TRAF6, FHL2, MYOD1, HIPK2, EP300, HDAC1, HDAC3, KAT6A, TCF12, TCF3, RUNX1T1, NCOR1, SIAH1, UBE2L6, RUNX1, PML, RARA, HDAC2, SIN3A, NR4A2, TRIM33, STUB1, SMARCA4, SMARCB1, SMARCC1, CDK1, TAL1, COPRS, KMT2A, RBM14, SPEN, DNMT1, ELAVL1, CBFA2T3, PRMT1, HLA-DMA, CREBBP, UXT, CTBP2, NOTCH1, MYC, NCOR2, FOXP3, SOX2, CTBP1, HDAC11, RAG1, SPI1, ELF1, CDK6, KLF6, NFATC1, NFATC2, ZNF131, BRCA1, CDK9, FANCD2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for RCAN1_RUNX1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneRCAN1P53805DB00975DipyridamoleCalcipressin-1small moleculeapproved

Top

RelatedDiseases for RCAN1_RUNX1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneRCAN1C0003873Rheumatoid Arthritis1CTD_human
HgeneRCAN1C0013080Down Syndrome1CTD_human
HgeneRCAN1C0018798Congenital Heart Defects1CTD_human
HgeneRCAN1C0020179Huntington Disease1CTD_human
HgeneRCAN1C0376634Craniofacial Abnormalities1CTD_human
TgeneRUNX1C0023467Leukemia, Myelocytic, Acute2CTD_human;HPO
TgeneRUNX1C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma2CTD_human
TgeneRUNX1C0003873Rheumatoid Arthritis1CTD_human
TgeneRUNX1C0017636Glioblastoma1CTD_human
TgeneRUNX1C0033578Prostatic Neoplasms1CTD_human
TgeneRUNX1C0349639Juvenile Myelomonocytic Leukemia1CTD_human
TgeneRUNX1C1832388Platelet Disorder, Familial, with Associated Myeloid Malignancy1CTD_human;ORPHANET;UNIPROT
TgeneRUNX1C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma1CTD_human